3AK2A

Superoxide dismutase from aeropyrum pernix k1, mn-bound form
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
211
structure length
211
Chain Sequence
b'MVSFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAVMRDFSFNYAGHIMHTIFWPNMAPPGKGGGTPGGRVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDPLTEELRILQVEKHNVLMTAGLVPILVIDVWEHAYYLQYKNDRGSYVENWWNVVNWDDVEKRLEQALNNAKPLYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn/Fe]
publication title Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 - insights into the enzyme mechanism and stability
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 72
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ak2A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ak2A02
3CEIA 1EN4A 3AK1A 4F6EA 3IC9A 1I08A 1PL4A 1MA1A 1BSMA 1VEWA 4JZGA 1ZUQA 3BFRA 1AP6A 1KKCA 1LUWA 2ADPA 3EVKA 1ZLZA 1XDCA 3LSUA 3OT7A 3TJTA 2ADQB 1ZSPA 4JZ2A 2P4KA 2GDSA 1SZXA 1AR4A 1AR5A 4X9QA 1BT8A 1MMMA 1WB8A 3K9SA 1JA8A 4YIPA 1IXBA 1GN6A 1AVMA 1MSDA 1VARA 1WB7A 1XREA 4C7UA 3QVNA 2CE4A 5AG2A 4E4EA 3KKYA 1XUQA 5A9GA 1QNMA 1GN2A 1EM1A 4BR6A 1D5NA 3AK3A 3DC6A 1EN6A 1N0NA 1EN5A 1LUVA 1P7GA 2RCVA 1MNGA 1BS3A 1GN3A 1I0HA 1B06A 2QKCA 1XILA 3MDSA 1ZTEA 4FFKA 1GN4A 1PM9A 2QKAA 4YIOA 2CDYA 3RN4A 2AW9A 3C3TA 3DC5A 1Y67A 4GUNA 1JR9A 1N0JA 1IX9A 3C3SA 3AK2A 1IDSA 4JYYA 1AP5A
chains in the Genus database with same CATH superfamily
3N27A 1XQ8A 4DV0O 1SQGA 4HZ3A 4DV5B 4JZGA 3CYOA 3CCSV 4UCSA 4YHHB 1VQPV 4B7EA 2ILMA 4Z1MG 1ZAUA 3G6EV 2P90A 2ZINA 4K3AA 4JI6O 2R9IA 2FMLA 4U7NA 1GKFA 5FNVA 1HWYA 3OE7G 1COWG 3ABLB 2RN9A 5FNVB 4JI4B 1HNXO 1RSOA 5H6QA 3E89A 2YI8A 4RUFA 4LBEC 3D36A 1RSOB 5B1BC 2ZNIA 4IT5A 5JJEB 2HJFC 3JD4A 4QE9A 2WA3A 1GN6A 4CH5A 4J7ZA 4LNUA 5CB4A 3E2EA 4UB6Z 4RUEA 2V7QG 1H8HG 2ZE6A 4FLUA 2QM4A 1PNKA 2HHHO 2DJVA 1FXKA 4JI5B 1XHZA 1FYJA 4LNUB 3N2KA 5CB4B 3I5DA 3ZN0A 4DUZB 2AZ2A 3KCYA 3IAYA 3FAVA 1FXKB 3N2KB 3WG7C 4PA7A 1YJNV 4PJ0Z 5L3DA 1NKDA 4B7KA 3H9VA 3U10A 1EFRG 3FAVB 5BZBA 1AI4A 3ZMVA 2ARHA 1IBKO 3L74H 2EZPA 3H1HH 3ABMC 3BCCH 3HR0A 4X1KA 4N23A 4DV7B 2JEUA 5LL6Y 1HR0B 1K92A 3E22A 1Q82W 4O4JA 2EIJB 3C90A 2P7TC 1VQ8V 3K5LA 2LGQA 4X1KB 4F6EA 1WJZA 3IC9A 3FYIB 3ZHUA 3E22B 3P30A 4O4JB 3CJHA 1ZUQA 4LF9O 3OM3B 2YDEA 4PI0A 4LF5O 4FZ1A 5B5EZ 2HG5C 4O4HA 3CXCU 4JTDB 1LUWA 4MTXA 3VBBA 4UB8Z 3CJHB 1VQ7V 4O4HB 3TJTA 1N34O 4W4KA 2ZCEA 1BMFG 5IY5C 4GLXA 1Y66A 1HDJA 4WFFA 2QTOA 4I9WA 1AJQA 5IJ0A 4PD4F 4P9PA 4X65O 4DV0B 4EFBA 4QNHB 1NJIW 5LHIA 2AGAA 2JGUA 3SR2C 3K0GA 3K5NA 4LF6B 1N8RW 3RT3C 5IJ0B 3FX7A 1VARA 4MW3A 5E79Z 4NXNO 5AG2A 5KAFZ 1J5EO 3KCXA 4MSWC 1FD9A 1EM1A 2NN4A 4H0LB 3DXRA 3UT5A 2EX3A 1BE3H 1HNXB 2X0LA 1AI6A 3UT5B 3DXRB 4WF9V 2IU0A 1R1BA 1Q6UA 1QHTA 2BCCH 2EINB 3ASNB 1R3LC 1SQFA 2QM8A 2CAZC 1MABG 3MDSA 1HW7A 1RM1C 4CS2A 1H2GA 1Y74A 2Y69B 2HHHB 4UVBA 5GONA 4EKWA 3OR6C 2VQEO 1M90W 4UV8A 1AJNA 4J10A 4FK5C 1Y74B 2GUZA 1IZ3A 5GONB 3K04A 2EIMB 1EN4A 2N04A 4X8AA 4DR2O 2GUZB 1K33A 4ZBMA 2Q6AA 4OX9O 2OCCB 2E3CA 2QEXV 2YIAA 4B3TO 1XMOB 3D8CA 2UUBO 3HB3B 5L3CA 1H2LA 1IBKB 1DK1A 2B1IA 2E75B 3ETGA 3E8FA 1MSWD 2PGGA 3CCLV 1N33B 1HNZB 2ETNA 5FLXN 4XBFA 2WLMA 5B1OA 3E8GA 4J42A 3VOUA 5H5NA 1G4YB 4LF9B 5BY1A 1VQMV 4LF5B 5IYDO 1XL4A 2PYJA 5E1AC 2ZIMA 3MD0A 4K8ZA 4DV2B 1WB7A 3UQ8A 1XNQB 4DR7O 5LGNA 3JSNA 2XAFA 1VMGA 5FPOA 1PD3A 1QLEB 1NTMH 3TGUH 5JJNB 1F4MA 1OZ0A 1XUQA 4CH3A 5H9CA 3JD1A 1N4CA 2FL4A 3O9OA 2KSDA 3L73H 3BHPA 4WBNA 1IJGA 5DM6V 1QQCA 4FIPC 4F6RA 4X65B 1WA8A 4OPAA 4W4LA 1HP8A 3S3XA 3OMNB 5JCOA 1Y4MA 4WBNB 4F6RB 1WA8B 4NXNB 3B8MA 2X6BA 3JAWA 1QVGU 1J5EB 4ZHQA 2ATKC 2W0XA 2LW1A 1YITV 5B1NA 3JAWB 4R7CA 4ZHQB 1YXBA 3K9AA 2F23A 2ZIOA 4FVMA 4JV5B 5BXZA 3OR7C 2W6JG 3J81N 3CRRA 3P32A 4JYYA 4DR4O 1HNWO 4WFBV 1KB9F 3WB2A 3CCUV 3ZHVA 2JIZG 1QCEA 5KX5A 4HNAA 2BSKA 2PYLA 1ZLZA 3CS5A 1JPXA 1MZEA 5KX5B 4HNAB 2BSKB 3LDCA 4JZ2A 2IJHA 3K58A 4GX1A 2EJ7A 3RYCA 3A8TA 3G80A 4ZOLA 3ABTA 2ZD9A 4DR2B 2XAHA 3ZRWA 2EILB 4OX9B 1BT8A 1VF5B 4H13B 3RYCB 4B3TB 2OIEA 2XOKG 4WFEA 4JI1O 2HVKC 4J7JA 4NXMO 3ZRWB 4O2AA 1IVSA 1YVWA 1FPOA 1YF2A 5CA0A 1SKVA 4RQEA 4PDVA 4O2AB 5B1AB 2HP8A 4O4LB 3L71H 3BA8A 3BA9A 5CA0B 4B08A 3JASA 1G1XB 1Y76A 4DR1O 1YSCA 1NBMG 3ZIAG 1MNGA 4CH4A 3JASB 1OCRB 3SGIA 3K59A 1SQQH 4FMTA 4DR7B 1JX9A 1ZL8A 2ZE7A 4CZZA 4FFBA 1JOYA 3QF7A 1V55B 4B3RO 4MT8A 2H8PC 4CS4A 5B66Z 1ZL8B 5LXTA 4FFBB 5CA3A 4DV3O 1T5EA 1NR1A 2P22C 2NNUA 4KFMA 5LXTB 2EZOA 4MVUA 2WA4A 4LF4O 1VIBA 1XI1A 4WFHA 2Q67A 5D5QA 3JD2A 4FM0A 1W0JG 2F4VO 1S5JA 3VQXA 2GTAA 3ETDA 2D3OW 4YY3B 5KHKA 5KLVH 5LP6C 1A32A 4DR4B 3SYPA 5KMGA 1KKDA 1Q90D 1SQXH 2UXDO 3SYOA 3TXQA 5KMGB 1JA8A 4LFCO 1RP3B 2CTQA 3BRCA 4J41A 5J2UA 4MVRA 4KHPO 3ZHQA 3P3NA 5HFMA 2VS0A 1YZBA 2DMXA 3BAAA 5TISZ 3LNMB 5C8YA 1GH6A 5J2UB 3AK3A 2VWKA 4JYCA 1YI2V 2BE3A 2OTJV 4TWKA 4KL1A 1EN5A 4ZKIA 4P2ZA 3UKMA 5C8YB 4I55A 2QM7A 1I94O 5B1BB 4NXMB 1K3EA 4I55B 1XILA 1VF6A 2B5UA 1FKAO 1P4RA 1S0VA 1R3KC 3RW0A 4DW1A 1CP9A 1BCCH 1GRJA 3RBZA 1K7DA 5GTHZ 3DC5A 3GWOA 4JI8O 2LFSA 3JAKA 2Q0OC 4BAYA 3CE2A 1QVFU 4LFAO 2MW2B 1IURA 3ZX6A 1M4UA 1P84F 4GX2A 3TK1A 4MTOA 3UO2A 4CC5A 1Q7YW 4DUYB 1AILA 1WP8A 1VP7A 4J9YB 4IHJB 4B3RB 1DLBA 2QE7G 1Q6HA 2HR3A 1SA0A 1K73W 2K1EA 4AQYO 4LR3A 2LJ2A 3O65A 3ABMB 4DV3B 3CC4V 4TV8A 1M93A 4JYBA 2Q7HA 1SA0B 5EYPA 1U96A 2GHYA 2DQ3A 3I56V 4K8XA 1AI5A 5L3FA 4TV8B 3KG2A 1GAXA 2OTLV 5EYPB 5IYZA 2ZXWC 1AVMA 1G8MA 2F4VB 2DYSC 3FD9A 5FL7G 4BIUA 3HKCA 4JI0O 3KKYA 5IYZB 2XNDG 5KUMA 1L1FA 2XAQA 3ABUA 4EB6A 3THOA 4R8CA 3T4DA 2B9ZA 4PDRA 3HKCB 2C2AA 1M56B 3VQWA 3BABA 4EB6B 5A2QN 2UXDB 1R6NA 5BMVA 1K34A 5CMUA 3SJCC 5BMVB 3G4SV 1JMKC 4FLTA 4BIZA 4PA4A 2P67A 1Q3EA 3A0BZ 5LBQA 2Y4UA 1JFFA 1F51A 1DF5A 2DN9A 3ZJZA 5EBMC 1XHXA 1WP7A 4KP4A 2DWDC 4DR6B 1JFFB 2QKSA 2BOCC 3CWBH 4MTGA 3EXAA 4OGQB 3CD6V 5KUKA 1KUQA 5KHGA 1ZWIC 4GCZA 4GKKO 1JJ2U 3UO3A 3SPCA 1TVKA 1DGSA 4FM1A 2OT5A 1RM1B 3ZRXA 1XMQB 5H2FZ 4X62B 4MVMA 2WLIA 4JI8B 5IWAO 1X4TA 1TVKB 2ADQB 4WFAV 3NXSA 4P30A 2FYUH 3ZEDA 4JYAO 4LFAB 1SZXA 1SF9A 3NR7A 2WLIB 1WNSA 1H5WA 2HEPA 2CTWA 4UUJC 2WPDG 3HKEA 5H6RA 2W0FC 4HBNA 4UCVA 1OJHA 1N36O 5EC2C 5LMUO 2ZE8A 3FYEB 3CCJV 1XNRO 3HKEB 3K0DA 5CBGA 3OTFA 1YIJV 3J7AU 3K5OA 4TQFA 3ABKC 1QU7A 1Z5WA 2JEXA 1QR8A 3W7TA 1V9PA 2UXNA 3OGIB 2EIKC 4YJ3A 2Q7EA 2W6IG 2UXBO 2CTPA 2F93B 2RCVA 4X64O 3OTOO 2AZ0A 2PUSA 4JI6B 2P5OA 4YJ3B 4DR5O 3ZMZA 4JI0B 3S3WA 3B4SA 3CRQA 1IBLO 5IT9N 2JJ2G 5CN0A 2E74B 4GKJO 4PV1B 1FFXA 2QJ1A 2ITDC 4JI7O 4FLWA 4OPHA 2DYRC 1NH2B 1W0KG 4NR1A 2YS8A 1FFXB 2HJDA 4LCUC 5GTIZ 1H38A 2IU3A 1I08A 3K79A 1ENVA 3LDDA 5KHJA 5IE9A 1S5LZ 5F2VO 2ZM6O 2UUCO 1AP6A 3OEEG 3ZHTA 3N2GA 2Q7GA 4BW5A 4Q6GA 4YJ2A 3EHBB 2CUGA 3G71V 2XUMA 1XBLA 2L6LA 2PZSA 3N2GB 4DYLA 4YJ2B 2IH3C 5JH7A 3JATA 2WAMA 2ZDIC 3CCRV 2OWOA 1BQZA 2Y4TA 3FFQA 5JH7B 1MMMA 3JATB 4IL6Z 3FB5C 2FKXA 1CEZA 3PJSK 1K8AW 3OGCC 1THZA 4E4EA 3AG3C 3L70H 4JF3A 1YTFB 3T2MA 2WWWA 2BOBC 3RVYA 5K1PA 1KU9A 3AG4C 3HKBA 1K5SA 3ZCCA 2IBZH 4X1IA 3X2QC 4CBCA 4GX5A 1Y6XA 4J11A 4DXWA 3HKBB 1N36B 1N34B 1M5IA 4MVZA 4X1IB 5IJ9A 4X20A 4YIOA 1PPJH 3C3TA 1SZTA 4GUNA 3STZC 3ZRVA 4WCEV 4R50A 3M99B 5IJ9B 4X20B 2DW4A 5KHHA 1G6UA 2UXBB 4CH6A 1VQLV 2XT9A 2Q9LA 2YI9A 3WFVA 4X64B 1GM9A 1V54C 3A0HZ 3BPZA 1S5HC 4UCOA 2KB1A 1LR1A 4DR5B 3H1KH 2WLKA 3D3IA 3AEIA 1OCCC 2Z0AA 2YSUB 4DK0A 2EINC 3BFRA 2ZE5A 1B6QA 3RVZA 3ASOB 1IBLB 2YXHA 3U11A 2ITCC 3LSSA 3LSUA 3OT7A 1MOFA 2UU9O 3M7MX 1JJOA 4IIJA 1PP9H 3IJ4A 3OUFA 1VQOV 3CCMV 5IYCO 3PN1A 1BQ0A 1AR5A 3LNNA 3K3WA 4IIJB 4L87A 4QGPA 1NTZH 1N32O 1Q8IA 4JGSA 3K57A 1FXHA 4FM2A 2A0LA 2VQEB 1H2KA 2LW7A 5EC1C 4GX0A 3ZS8C 4K0KO 5LP6A 3ZMUA 1VQ6V 1FOUA 1BHBA 3AG2C 4DK1A 1GN2A 3CRAA 4J7KA 5LP6B 3CMEV 1M9NA 4G27B 2YC0A 4IYHA 1X59A 3ZMSA 4GT1A 4UXNA 2BTOA 2UUBB 1PV0A 1Q43A 3SJAC 2RMKB 1VF7A 5JWPA 4O4LA 4UFZA 3CP1A 3BEHA 2ZQMA 4NTXA 5LA6A 4AILC 2CDYA 2WSSG 3CX5F 4DW0A 3ZMTA 2R9AA 4JAAA 1JR9A 4JI2O 3T1HO 5LA6B 2CGOA 1I5XA 1XEQA 2IJKA 1GMGA 5LMNO 1WN7A 2LFRA 4O4IA 3AG1C 3CSXA 1VQ5V 1H2SB 5KAIZ 4FJCC 2PI4A 3W7UA 2A79B 1SESA 4O4IB 1VEWA 2E5LO 1R6KA 2DOSA 3ETEA 3IFXA 3W7WA 1AI7A 1PNMA 2WLHA 3B09A 1H2MA 3EVKA 1M57B 1VQNV 2P4VA 5LGTA 2M6YA 1OCZC 1S76D 1ZSPA 1BZKA 4ZIBA 3ZHSA 3H01A 2QWQB 1SQPH 1AR4A 2OIGA 2YIDA 1E1QG 3L75H 2DWEC 1NVPB 2QGNA 5JVDA 2XAGA 4LWSA 4U7OA 2Y0IA 1WB8A 3CC2V 1WAZA 1IXBA 2GV9A 5JVDB 3JSLA 3QVNA 4LFBO 4LWSB 3WB0A 2UU9B 3KDRA 4DRXA 1HNWB 4D7SA 2YIBA 5B3SC 4TT3G 2FTKA 2Q68A 3DC6A 4KUMA 3VQYA 4DRXB 1K97A 1FXVA 1N32B 4JPRA 4NYKA 3E8HA 1KECA 1AR1B 2G38A 4DV4O 2WLLA 1FJGO 1PKXA 2DE0X 4MW8A 5BR8O 4NTYA 2ZXWB 3K08A 1W59A 4K0KB 4FFKA 4JTAB 2DYSB 1PM9A 4HAMA 1QR9A 2WLLB 2AW9A 1Y67A 4PA3A 1FFTB 3AG7A 3WB1A 5HFLA 1OV9A 3U0ZA 5JJJB 2JDIG 4JAVA 2E76B 4JI1B 1TGOA 3RYFB 4X1YA 2LGWA 4FLVA 4NKGB 2A3QA 4AHCA 3LUTB 1MA1A 1UFIA 4PA6A 4UCRA 4X1YB 3GVMA 4BIOA 1GM7A 2QDOA 2HFEC 2HVJC 1Q6IA 4JI2B 2WLJA 3D3QA 4NVPA 2Q4PA 3MHHC 3QO7A 1QLNA 4DR1B 4JAUA 4I0XA 1PNLA 2DQ0A 4D6TH 4F4LA 4PDMA 3WG7B 2OYQA 4H37A 3QO5A 4JASA 4UVAA 4I0XB 2GSMB 3TETA 4IHJA 3K03A 2ZR3A 4PA9A 4IGGA 1OCOC 3E35A 3MAQA 5LYJA 1NZ6A 4MVOA 3RGBA 3LSQA 3ZBHA 2Q5ZA 5DECA 1S72V 4MVSA 1DF4A 4UCUA 5LYJB 1QNMA 2QWNB 4LF4B 1BGYH 4DO2A 2KKWA 1PL0A 2OCHA 4JI3O 1YCIA 2ODMA 4QPKA 4ICGA 1GM8A 2XAJA 5CBHA 2F66C 2ZNJA 3QTCA 1F4NA 2GTSA 1KD1W 3ZRSA 1B06A 1WLEA 3OMIB 4LFBB 4FLXA 1D2DA 2P06A 3CC7V 4NB5A 3RYIA 4LF6O 4PELA 5IY5B 1R6TA 3ABKB 3RYIB 4G28B 2ZKOA 2EIKB 4I4TA 1TAEA 4LFCB 2VQFO 4U3JA 4LF7O 2H94A 4DV4B 1PL4A 2QWOB 1L0NH 4KHPB 1FJGB 3JD0A 4I4TB 5BR8B 2Z5UA 1Z2GA 3SDLA 4U3JB 2R70A 2ADPA 3JAMN 3G6BA 4RAIA 3R65A 2JS5A 1YJ9V 3B40A 1SERA 1KQSU 1EZVH 1ROPA 1VF6C 4TOIA 2DYRB 2V4DA 2B1GA 4CC6A 1I94B 1UJWB 3ZHRA 5EBWC 5KA6A 1M1KW 2HLDG 2ZR2A 3FB7C 2FB5A 4Z2WA 5J9PC 4I9QA 2UUAO 2Q0AA 2QWPB 1CPYA 1LNQA 2XHBA 1NU1H 1K4DC 4J80A 4ASUG 5DEDA 1XMOO 4I50A 4LP8A 1Z5VA 4FLZA 1TUEB 3P3PA 4BR6A 3EFFK 1L0LH 2QSAA 2X6CA 1FS0G 2ZDIA 3E8BA 1L8DA 5L3EA 2L35A 1N33O 4I50B 3OFNG 4HYOA 3B2EE 3GWKC 1P7GA 2M7WA 3ML0A 1HNZO 4GYCB 4QE7A 3ICXA 1BS3A 2F95B 4O2BA 3W7SA 1I0HA 3CPWU 2UXCO 2ZT9B 4AQYB 2YEVA 1GN4A 4LF8O 3T1YO 4O2BB 3AG3B 3SPIA 3ABLC 1UPGA 4YXWG 1R73A 3HPLC 4DV2O 2YEVB 1XNQO 3CRMA 4K35A 1ORQC 1XL6A 1O9HA 1OHHG 4XDKA 4JI3B 5KA5A 4B3MO 3CEIA 2A06H 3AK1A 1M56C 4X66O 3AG4B 4MVQA 4FZ0A 1BSMA 3X2QB 3VQVA 2WLNA 3D36C 1IBMO 5DN6G 3K06A 3OD4A 4I5SA 1TA8A 3ZN1A 1KKCA 2EULA 1NH2D 1NT2B 1WPBA 2AHZA 1RFYA 2Q69A 5J2TA 1FXKC 1IXMA 1MG1A 2CTRA 3OMAB 2VQFB 2XTAA 4LF7B 1RPRA 1V54B 4JV5O 5J2TB 3UCSC 3K9SA 1KP2A 3QNEA 1OCCB 4PI2A 1XREA 1VQ4V 2CE4A 3BY6A 4DV6O 3KZIZ 4DR3O 1K4CC 2HKOA 3OEHG 1N0NA 3CRCA 2EIJC 3RWRD 1K5QA 5KHIA 4GKKB 1VQKV 3JALA 4JTCB 3LDEA 4G2KA 2Y48A 2UUAB 5EBLC 2QTSA 3JALB 5L3GA 3SJQC 1I5YA 5IWAB 1EBOA 2P6JA 1YTFD 2JGDA 2QKAA 3CB2A 3DGEA 4LC1A 4JYAB 3APOA 3AG2B 4TUYA 4Q20A 2JK5C 2JGDB 3C3SA 3TXSA 2JVDA 2AHYA 2D2CB 1VQ9V 2IM9A 2X6AA 2YXLA 2LP7A 4TUYB 1AP5A 4B3SO 2F1MA 3JARA 2QWRB 3F5TA 1KBHA 5LGUA 3SPHA 5LMUB 4UV9A 5C93A 2UXCB 3JARB 2N74A 5JQGA 3F5WC 1XNRB 3RYHA 1J95A 1CXZB 1S77D 4LF8B 4RWUA 3T1YB 1URFA 1R3IC 2RDCA 5JQGB 2O57A 3RYHB 2YUAA 1WPXA 4B3MB 5ITZA 2Y0PA 3OTOB 4XDLA 3F7VC 4TSFG 3AG1B 4X66B 5EIBD 3APQA 4EFEA 5ITZB 5EK0A 1SQVH 3ASNC 4BWAA 1IBMB 2BTQA 4GKJB 1BL8A 1SC5B 3K5MA 2KQXA 1KP3A 4JI7B 2Y69C 3CXHF 5CA1A 2BTQB 1F7YA 3R66A 1E79G 1OCZB 3BVOA 2RJZA 4AI8A 5CBFA 4J9ZB 3B77A 4EEQA 4LH6A 5CA1B 4YY3O 2NR5A 2EIMC 5FPRA 3JYCA 3FB8C 2ZM6B 2UUCB 2OCCC 4XDJA 4X88A 2NLJC 2QKCA 2Q73A 1P49A 2PI5A 2MK3A 3E86A 5LOVA 1ZTEA 4DV6B 4CS3A 4BW9A 1E1RG 3FB6C 3SJBC 2GBOA 4DR3B 2JS3A 3CCQV 5LOVB 1JVMA 3ETQA 3AK2A 1ZX3A 3SPJA 2IW5A 5B3SB 2UXXA 2YICA 1AROP 3E83A 2R72A 3STLC 2Q8VA 5IYBO 2A7WA 1XOUA 4PHZA 3M8AA 1JQ0A 2IH1C 4UVCA 2V1DA 2LO1A 5D5PA 1GO3F 1YDXA 2RQ6A 3JD3A 1QLEC 1NS1A 1US6A 3A2FA 4ZOLB 1XDCA 4H44B 3OUSA 4U3FH 1YEWA 2R9RB 3SYAA 1F23A 1Q86W 3WU2Z 1B3QA 2P4KA 2QR4A 2YXYA 3CCVV 3FKSG 4B3SB 1S3JA 3SYCA 5IDJA 1Q5OA 3QO8A 3H1LH 1R3JC 4IYIA 5K1XA 4X9QA 3B8NA 3I55V 4DV1O 1NI8A 1JNBA 4YIPA 5EZYA 2AXTZ 3MHSC 5L3BA 1MSDA 1QBZA 2IJIA 1Y76B 4C7UA 4R6ZA 5EIBC 5JCOC 3QG5A 2JRIA 3TCUA 1NQTA 2LQTA 4DUYO 5EZYB 3ASOC 3SYQA 2A9HA 2EBOA 3OAAG 3H1JH 3IC7A 3A0RA 2F43G 1EN6A 1NVPD 1SETA 1LUVA 2PTMA 4FLYA 2N05A 1SRYA 3CMAV 1RPOA 4MS2A 3CHXA 1MZFA 4QJFB 1KC8W 1EZJA 2KG7A 1GN3A 1OCOB 1SQBH 4DV5O 1U97A 4YHHO 2X7RB 3L72H 2XASA 1H2NA 3T4ZA 1W2BU 3J80N 2IJJA 2KG7B 4TV9A 3SPGA 5LHGA 4FPPA 2PF4E 3H1IH 4ABMA 1N0JA 4TQDA 4Z1VA 2K9PA 3W7XA 2YIBD 1TUBA 1GK9A 4TV9B 3F7YC 4I7ZB 1SS3A 4JI4O 4MTFA 2EILC 3Q4HA 1TUBB 2EJRA 3HKDA 1YJWV 2RNBA 2PY5A 1DTOA 3L9DA 4KXRA 3Q4HB 4ZI7A 2CK3G 1KYOF 3RYFA 3HKDB 4RQFA 3JCZA 2VWJA 5B1AC 4ZI7B 4JI5O 4RO2A 2GDSA 1P7BA 4OXSA 4QIWF 4DUZO 2H3OA 3RFRA 1I7FA 4NTWA 4WFGA 4N21A 1Q81W 1AJPA 1BHAA 2JJ1G 4DR6O 1OCRC 1O9GA 4A5UB 3IGAC 3T1HB 1K9MW 1H8EG 1V55C 5LMNB 3UM7A 5A9GA 2QA4V 1M57C 1D5NA 2Z3YA 4GZRB 1XMQO 4DV7O 4LH7A 4X62O 3G67A 4PDLA 3T1CA 1HR0O 1KMIZ 2VRZA 3JCUZ 2CGNA 4P9OA 5GW7A 2E5LB 4DV1B 5LHHA 1GTOA 1AB3A 1B04A 3JAKB 4X89A 3DTUB 1NR7A 3GB7C 1D5AA 4UCTA 1FAFA 3RN4A 2CH7A 3OW2U 1YHQV 4L8JA 1IX9A 3CCEV 1IDSA 4E2LA 1JCHA 1NTKH 4D7TA 4QPJA 2CH7B 4H33A 3DSQA
chains in the Genus database with same CATH topology
3CEIA 1EN4A 3AK1A 4F6EA 3IC9A 1I08A 1PL4A 1MA1A 1BSMA 1VEWA 4JZGA 1ZUQA 3BFRA 1AP6A 1KKCA 1LUWA 2ADPA 3EVKA 1ZLZA 1XDCA 3LSUA 3OT7A 3TJTA 2ADQB 1ZSPA 4JZ2A 2P4KA 2GDSA 1SZXA 1AR4A 1AR5A 4X9QA 1BT8A 1MMMA 1WB8A 3K9SA 1JA8A 4YIPA 1IXBA 1GN6A 1AVMA 1MSDA 1VARA 1WB7A 1XREA 4C7UA 3QVNA 2CE4A 5AG2A 4E4EA 3KKYA 3KDRA 1XUQA 5A9GA 1QNMA 1GN2A 1EM1A 4BR6A 1D5NA 3AK3A 3DC6A 1EN6A 1N0NA 1EN5A 1LUVA 1P7GA 2RCVA 1MNGA 1BS3A 1GN3A 1I0HA 1B06A 2QKCA 1XILA 3MDSA 1ZTEA 4FFKA 1GN4A 1PM9A 2QKAA 4YIOA 2CDYA 3RN4A 2AW9A 3C3TA 3DC5A 1Y67A 4GUNA 1JR9A 1N0JA 1IX9A 3C3SA 3AK2A 1IDSA 4JYYA 1AP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEI A;  1EN4 A;  3AK1 A;  4F6E A;  3IC9 A;  1I08 A;  1PL4 A;  1MA1 A;  1BSM A;  1VEW A;  4JZG A;  1ZUQ A;  3BFR A;  1AP6 A;  1KKC A;  1LUW A;  2ADP A;  3EVK A;  1ZLZ A;  1XDC A;  3LSU A;  3OT7 A;  3TJT A;  2ADQ B;  1ZSP A;  4JZ2 A;  2P4K A;  2GDS A;  1SZX A;  1AR4 A;  1AR5 A;  4X9Q A;  1BT8 A;  1MMM A;  1WB8 A;  3K9S A;  1JA8 A;  4YIP A;  1IXB A;  1GN6 A;  1AVM A;  1MSD A;  1VAR A;  1WB7 A;  1XRE A;  4C7U A;  3QVN A;  2CE4 A;  5AG2 A;  4E4E A;  3KKY A;  1XUQ A;  5A9G A;  1QNM A;  1GN2 A;  1EM1 A;  4BR6 A;  1D5N A;  3AK3 A;  3DC6 A;  1EN6 A;  1N0N A;  1EN5 A;  1LUV A;  1P7G A;  2RCV A;  1MNG A;  1BS3 A;  1GN3 A;  1I0H A;  1B06 A;  2QKC A;  1XIL A;  3MDS A;  1ZTE A;  4FFK A;  1GN4 A;  1PM9 A;  2QKA A;  4YIO A;  2CDY A;  3RN4 A;  2AW9 A;  3C3T A;  3DC5 A;  1Y67 A;  4GUN A;  1JR9 A;  1N0J A;  1IX9 A;  3C3S A;  3AK2 A;  1IDS A;  4JYY A;  1AP5 A; 
#chains in the Genus database with same CATH topology
 3N27 A;  1XQ8 A;  4DV0 O;  1SQG A;  4HZ3 A;  4DV5 B;  4JZG A;  3CYO A;  3CCS V;  4UCS A;  4YHH B;  1VQP V;  4B7E A;  2ILM A;  4Z1M G;  1ZAU A;  3G6E V;  2P90 A;  2ZIN A;  4K3A A;  4JI6 O;  2R9I A;  2FML A;  4U7N A;  1GKF A;  5FNV A;  1HWY A;  3OE7 G;  1COW G;  3ABL B;  2RN9 A;  5FNV B;  4JI4 B;  1HNX O;  1RSO A;  5H6Q A;  3E89 A;  2YI8 A;  4RUF A;  4LBE C;  3D36 A;  1RSO B;  5B1B C;  2ZNI A;  4IT5 A;  5JJE B;  2HJF C;  3JD4 A;  4QE9 A;  2WA3 A;  1GN6 A;  4CH5 A;  4J7Z A;  4LNU A;  5CB4 A;  3E2E A;  4UB6 Z;  4RUE A;  2V7Q G;  1H8H G;  2ZE6 A;  4FLU A;  2QM4 A;  1PNK A;  2HHH O;  2DJV A;  1FXK A;  4JI5 B;  1XHZ A;  1FYJ A;  4LNU B;  3N2K A;  5CB4 B;  3I5D A;  3ZN0 A;  4DUZ B;  2AZ2 A;  3KCY A;  3IAY A;  3FAV A;  1FXK B;  3N2K B;  3WG7 C;  4PA7 A;  1YJN V;  4PJ0 Z;  5L3D A;  1NKD A;  4B7K A;  3H9V A;  3U10 A;  1EFR G;  3FAV B;  5BZB A;  1AI4 A;  3ZMV A;  2ARH A;  1IBK O;  3L74 H;  2EZP A;  3H1H H;  3ABM C;  3BCC H;  3HR0 A;  4X1K A;  4N23 A;  4DV7 B;  2JEU A;  5LL6 Y;  1HR0 B;  1K92 A;  3E22 A;  1Q82 W;  4O4J A;  2EIJ B;  3C90 A;  2P7T C;  1VQ8 V;  3K5L A;  2LGQ A;  4X1K B;  4F6E A;  1WJZ A;  3IC9 A;  3FYI B;  3ZHU A;  3E22 B;  3P30 A;  4O4J B;  3CJH A;  1ZUQ A;  4LF9 O;  3OM3 B;  2YDE A;  4PI0 A;  4LF5 O;  4FZ1 A;  5B5E Z;  2HG5 C;  4O4H A;  3CXC U;  4JTD B;  1LUW A;  4MTX A;  3VBB A;  4UB8 Z;  3CJH B;  1VQ7 V;  4O4H B;  3TJT A;  1N34 O;  4W4K A;  2ZCE A;  1BMF G;  5IY5 C;  4GLX A;  1Y66 A;  1HDJ A;  4WFF A;  2QTO A;  4I9W A;  1AJQ A;  5IJ0 A;  4PD4 F;  4P9P A;  4X65 O;  4DV0 B;  4EFB A;  4QNH B;  1NJI W;  5LHI A;  2AGA A;  2JGU A;  3SR2 C;  3K0G A;  3K5N A;  4LF6 B;  1N8R W;  3RT3 C;  5IJ0 B;  3FX7 A;  1VAR A;  4MW3 A;  5E79 Z;  4NXN O;  5AG2 A;  5KAF Z;  1J5E O;  3KCX A;  4MSW C;  1FD9 A;  1EM1 A;  2NN4 A;  4H0L B;  3DXR A;  3UT5 A;  2EX3 A;  1BE3 H;  1HNX B;  2X0L A;  1AI6 A;  3UT5 B;  3DXR B;  4WF9 V;  2IU0 A;  1R1B A;  1Q6U A;  1QHT A;  2BCC H;  2EIN B;  3ASN B;  1R3L C;  1SQF A;  2QM8 A;  2CAZ C;  1MAB G;  3MDS A;  1HW7 A;  1RM1 C;  4CS2 A;  1H2G A;  1Y74 A;  2Y69 B;  2HHH B;  4UVB A;  5GON A;  4EKW A;  3OR6 C;  2VQE O;  1M90 W;  4UV8 A;  1AJN A;  4J10 A;  4FK5 C;  1Y74 B;  2GUZ A;  1IZ3 A;  5GON B;  3K04 A;  2EIM B;  1EN4 A;  2N04 A;  4X8A A;  4DR2 O;  2GUZ B;  1K33 A;  4ZBM A;  2Q6A A;  4OX9 O;  2OCC B;  2E3C A;  2QEX V;  2YIA A;  4B3T O;  1XMO B;  3D8C A;  2UUB O;  3HB3 B;  5L3C A;  1H2L A;  1IBK B;  1DK1 A;  2B1I A;  2E75 B;  3ETG A;  3E8F A;  1MSW D;  2PGG A;  3CCL V;  1N33 B;  1HNZ B;  2ETN A;  5FLX N;  4XBF A;  2WLM A;  5B1O A;  3E8G A;  4J42 A;  3VOU A;  5H5N A;  1G4Y B;  4LF9 B;  5BY1 A;  1VQM V;  4LF5 B;  5IYD O;  1XL4 A;  2PYJ A;  5E1A C;  2ZIM A;  3MD0 A;  4K8Z A;  4DV2 B;  1WB7 A;  3UQ8 A;  1XNQ B;  4DR7 O;  5LGN A;  3JSN A;  2XAF A;  1VMG A;  5FPO A;  1PD3 A;  1QLE B;  1NTM H;  3TGU H;  5JJN B;  1F4M A;  1OZ0 A;  1XUQ A;  4CH3 A;  5H9C A;  3JD1 A;  1N4C A;  2FL4 A;  3O9O A;  2KSD A;  3L73 H;  3BHP A;  4WBN A;  1IJG A;  5DM6 V;  1QQC A;  4FIP C;  4F6R A;  4X65 B;  1WA8 A;  4OPA A;  4W4L A;  1HP8 A;  3S3X A;  3OMN B;  5JCO A;  1Y4M A;  4WBN B;  4F6R B;  1WA8 B;  4NXN B;  3B8M A;  2X6B A;  3JAW A;  1QVG U;  1J5E B;  4ZHQ A;  2ATK C;  2W0X A;  2LW1 A;  1YIT V;  5B1N A;  3JAW B;  4R7C A;  4ZHQ B;  1YXB A;  3K9A A;  2F23 A;  2ZIO A;  4FVM A;  4JV5 B;  5BXZ A;  3OR7 C;  2W6J G;  3J81 N;  3CRR A;  3P32 A;  4JYY A;  4DR4 O;  1HNW O;  4WFB V;  1KB9 F;  3WB2 A;  3CCU V;  3ZHV A;  2JIZ G;  1QCE A;  5KX5 A;  4HNA A;  2BSK A;  2PYL A;  1ZLZ A;  3CS5 A;  1JPX A;  1MZE A;  5KX5 B;  4HNA B;  2BSK B;  3LDC A;  4JZ2 A;  2IJH A;  3K58 A;  4GX1 A;  2EJ7 A;  3RYC A;  3A8T A;  3G80 A;  4ZOL A;  3ABT A;  2ZD9 A;  4DR2 B;  2XAH A;  3ZRW A;  2EIL B;  4OX9 B;  1BT8 A;  1VF5 B;  4H13 B;  3RYC B;  4B3T B;  2OIE A;  2XOK G;  4WFE A;  4JI1 O;  2HVK C;  4J7J A;  4NXM O;  3ZRW B;  4O2A A;  1IVS A;  1YVW A;  1FPO A;  1YF2 A;  5CA0 A;  1SKV A;  4RQE A;  4PDV A;  4O2A B;  5B1A B;  2HP8 A;  4O4L B;  3L71 H;  3BA8 A;  3BA9 A;  5CA0 B;  4B08 A;  3JAS A;  1G1X B;  1Y76 A;  4DR1 O;  1YSC A;  1NBM G;  3ZIA G;  1MNG A;  4CH4 A;  3JAS B;  1OCR B;  3SGI A;  3K59 A;  1SQQ H;  4FMT A;  4DR7 B;  1JX9 A;  1ZL8 A;  2ZE7 A;  4CZZ A;  4FFB A;  1JOY A;  3QF7 A;  1V55 B;  4B3R O;  4MT8 A;  2H8P C;  4CS4 A;  5B66 Z;  1ZL8 B;  5LXT A;  4FFB B;  5CA3 A;  4DV3 O;  1T5E A;  1NR1 A;  2P22 C;  2NNU A;  4KFM A;  5LXT B;  2EZO A;  4MVU A;  2WA4 A;  4LF4 O;  1VIB A;  1XI1 A;  4WFH A;  2Q67 A;  5D5Q A;  3JD2 A;  4FM0 A;  1W0J G;  2F4V O;  1S5J A;  3VQX A;  2GTA A;  3ETD A;  2D3O W;  4YY3 B;  5KHK A;  5KLV H;  5LP6 C;  1A32 A;  4DR4 B;  3SYP A;  5KMG A;  1KKD A;  1Q90 D;  1SQX H;  2UXD O;  3SYO A;  3TXQ A;  5KMG B;  1JA8 A;  4LFC O;  1RP3 B;  2CTQ A;  3BRC A;  4J41 A;  5J2U A;  4MVR A;  4KHP O;  3ZHQ A;  3P3N A;  5HFM A;  2VS0 A;  1YZB A;  2DMX A;  3BAA A;  5TIS Z;  3LNM B;  5C8Y A;  1GH6 A;  5J2U B;  3AK3 A;  2VWK A;  4JYC A;  1YI2 V;  2BE3 A;  2OTJ V;  4TWK A;  4KL1 A;  1EN5 A;  4ZKI A;  4P2Z A;  3UKM A;  5C8Y B;  4I55 A;  2QM7 A;  1I94 O;  5B1B B;  4NXM B;  1K3E A;  4I55 B;  1XIL A;  1VF6 A;  2B5U A;  1FKA O;  1P4R A;  1S0V A;  1R3K C;  3RW0 A;  4DW1 A;  1CP9 A;  1BCC H;  1GRJ A;  3RBZ A;  1K7D A;  5GTH Z;  3DC5 A;  3GWO A;  4JI8 O;  2LFS A;  3JAK A;  2Q0O C;  4BAY A;  3CE2 A;  1QVF U;  4LFA O;  2MW2 B;  1IUR A;  3ZX6 A;  1M4U A;  1P84 F;  4GX2 A;  3TK1 A;  4MTO A;  3UO2 A;  4CC5 A;  1Q7Y W;  4DUY B;  1AIL A;  1WP8 A;  1VP7 A;  4J9Y B;  4IHJ B;  4B3R B;  1DLB A;  2QE7 G;  1Q6H A;  2HR3 A;  1SA0 A;  1K73 W;  2K1E A;  4AQY O;  4LR3 A;  2LJ2 A;  3O65 A;  3ABM B;  4DV3 B;  3CC4 V;  4TV8 A;  1M93 A;  4JYB A;  2Q7H A;  1SA0 B;  5EYP A;  1U96 A;  2GHY A;  2DQ3 A;  3I56 V;  4K8X A;  1AI5 A;  5L3F A;  4TV8 B;  3KG2 A;  1GAX A;  2OTL V;  5EYP B;  5IYZ A;  2ZXW C;  1AVM A;  1G8M A;  2F4V B;  2DYS C;  3FD9 A;  5FL7 G;  4BIU A;  3HKC A;  4JI0 O;  3KKY A;  5IYZ B;  2XND G;  5KUM A;  1L1F A;  2XAQ A;  3ABU A;  4EB6 A;  3THO A;  4R8C A;  3T4D A;  2B9Z A;  4PDR A;  3HKC B;  2C2A A;  1M56 B;  3VQW A;  3BAB A;  4EB6 B;  5A2Q N;  2UXD B;  1R6N A;  5BMV A;  1K34 A;  5CMU A;  3SJC C;  5BMV B;  3G4S V;  1JMK C;  4FLT A;  4BIZ A;  4PA4 A;  2P67 A;  1Q3E A;  3A0B Z;  5LBQ A;  2Y4U A;  1JFF A;  1F51 A;  1DF5 A;  2DN9 A;  3ZJZ A;  5EBM C;  1XHX A;  1WP7 A;  4KP4 A;  2DWD C;  4DR6 B;  1JFF B;  2QKS A;  2BOC C;  3CWB H;  4MTG A;  3EXA A;  4OGQ B;  3CD6 V;  5KUK A;  1KUQ A;  5KHG A;  1ZWI C;  4GCZ A;  4GKK O;  1JJ2 U;  3UO3 A;  3SPC A;  1TVK A;  1DGS A;  4FM1 A;  2OT5 A;  1RM1 B;  3ZRX A;  1XMQ B;  5H2F Z;  4X62 B;  4MVM A;  2WLI A;  4JI8 B;  5IWA O;  1X4T A;  1TVK B;  2ADQ B;  4WFA V;  3NXS A;  4P30 A;  2FYU H;  3ZED A;  4JYA O;  4LFA B;  1SZX A;  1SF9 A;  3NR7 A;  2WLI B;  1WNS A;  1H5W A;  2HEP A;  2CTW A;  4UUJ C;  2WPD G;  3HKE A;  5H6R A;  2W0F C;  4HBN A;  4UCV A;  1OJH A;  1N36 O;  5EC2 C;  5LMU O;  2ZE8 A;  3FYE B;  3CCJ V;  1XNR O;  3HKE B;  3K0D A;  5CBG A;  3OTF A;  1YIJ V;  3J7A U;  3K5O A;  4TQF A;  3ABK C;  1QU7 A;  1Z5W A;  2JEX A;  1QR8 A;  3W7T A;  1V9P A;  2UXN A;  3OGI B;  2EIK C;  4YJ3 A;  2Q7E A;  2W6I G;  2UXB O;  2CTP A;  2F93 B;  2RCV A;  4X64 O;  3OTO O;  2AZ0 A;  2PUS A;  4JI6 B;  2P5O A;  4YJ3 B;  4DR5 O;  3ZMZ A;  4JI0 B;  3S3W A;  3B4S A;  3CRQ A;  1IBL O;  5IT9 N;  2JJ2 G;  5CN0 A;  2E74 B;  4GKJ O;  4PV1 B;  1FFX A;  2QJ1 A;  2ITD C;  4JI7 O;  4FLW A;  4OPH A;  2DYR C;  1NH2 B;  1W0K G;  4NR1 A;  2YS8 A;  1FFX B;  2HJD A;  4LCU C;  5GTI Z;  1H38 A;  2IU3 A;  1I08 A;  3K79 A;  1ENV A;  3LDD A;  5KHJ A;  5IE9 A;  1S5L Z;  5F2V O;  2ZM6 O;  2UUC O;  1AP6 A;  3OEE G;  3ZHT A;  3N2G A;  2Q7G A;  4BW5 A;  4Q6G A;  4YJ2 A;  3EHB B;  2CUG A;  3G71 V;  2XUM A;  1XBL A;  2L6L A;  2PZS A;  3N2G B;  4DYL A;  4YJ2 B;  2IH3 C;  5JH7 A;  3JAT A;  2WAM A;  2ZDI C;  3CCR V;  2OWO A;  1BQZ A;  2Y4T A;  3FFQ A;  5JH7 B;  1MMM A;  3JAT B;  4IL6 Z;  3FB5 C;  2FKX A;  1CEZ A;  3PJS K;  1K8A W;  3OGC C;  1THZ A;  4E4E A;  3AG3 C;  3L70 H;  4JF3 A;  1YTF B;  3T2M A;  2WWW A;  2BOB C;  3RVY A;  5K1P A;  1KU9 A;  3AG4 C;  3HKB A;  1K5S A;  3ZCC A;  2IBZ H;  4X1I A;  3X2Q C;  4CBC A;  4GX5 A;  1Y6X A;  4J11 A;  4DXW A;  3HKB B;  1N36 B;  1N34 B;  1M5I A;  4MVZ A;  4X1I B;  5IJ9 A;  4X20 A;  4YIO A;  1PPJ H;  3C3T A;  1SZT A;  4GUN A;  3STZ C;  3ZRV A;  4WCE V;  4R50 A;  3M99 B;  5IJ9 B;  4X20 B;  2DW4 A;  5KHH A;  1G6U A;  2UXB B;  4CH6 A;  1VQL V;  2XT9 A;  2Q9L A;  2YI9 A;  3WFV A;  4X64 B;  1GM9 A;  1V54 C;  3A0H Z;  3BPZ A;  1S5H C;  4UCO A;  2KB1 A;  1LR1 A;  4DR5 B;  3H1K H;  2WLK A;  3D3I A;  3AEI A;  1OCC C;  2Z0A A;  2YSU B;  4DK0 A;  2EIN C;  3BFR A;  2ZE5 A;  1B6Q A;  3RVZ A;  3ASO B;  1IBL B;  2YXH A;  3U11 A;  2ITC C;  3LSS A;  3LSU A;  3OT7 A;  1MOF A;  2UU9 O;  3M7M X;  1JJO A;  4IIJ A;  1PP9 H;  3IJ4 A;  3OUF A;  1VQO V;  3CCM V;  5IYC O;  3PN1 A;  1BQ0 A;  1AR5 A;  3LNN A;  3K3W A;  4IIJ B;  4L87 A;  4QGP A;  1NTZ H;  1N32 O;  1Q8I A;  4JGS A;  3K57 A;  1FXH A;  4FM2 A;  2A0L A;  2VQE B;  1H2K A;  2LW7 A;  5EC1 C;  4GX0 A;  3ZS8 C;  4K0K O;  5LP6 A;  3ZMU A;  1VQ6 V;  1FOU A;  1BHB A;  3AG2 C;  4DK1 A;  1GN2 A;  3CRA A;  4J7K A;  5LP6 B;  3CME V;  1M9N A;  4G27 B;  2YC0 A;  4IYH A;  1X59 A;  3ZMS A;  4GT1 A;  4UXN A;  2BTO A;  2UUB B;  1PV0 A;  1Q43 A;  3SJA C;  2RMK B;  1VF7 A;  5JWP A;  4O4L A;  4UFZ A;  3CP1 A;  3BEH A;  2ZQM A;  4NTX A;  5LA6 A;  4AIL C;  2CDY A;  2WSS G;  3CX5 F;  4DW0 A;  3ZMT A;  2R9A A;  4JAA A;  1JR9 A;  4JI2 O;  3T1H O;  5LA6 B;  2CGO A;  1I5X A;  1XEQ A;  2IJK A;  1GMG A;  5LMN O;  1WN7 A;  2LFR A;  4O4I A;  3AG1 C;  3CSX A;  1VQ5 V;  1H2S B;  5KAI Z;  4FJC C;  2PI4 A;  3W7U A;  2A79 B;  1SES A;  4O4I B;  1VEW A;  2E5L O;  1R6K A;  2DOS A;  3ETE A;  3IFX A;  3W7W A;  1AI7 A;  1PNM A;  2WLH A;  3B09 A;  1H2M A;  3EVK A;  1M57 B;  1VQN V;  2P4V A;  5LGT A;  2M6Y A;  1OCZ C;  1S76 D;  1ZSP A;  1BZK A;  4ZIB A;  3ZHS A;  3H01 A;  2QWQ B;  1SQP H;  1AR4 A;  2OIG A;  2YID A;  1E1Q G;  3L75 H;  2DWE C;  1NVP B;  2QGN A;  5JVD A;  2XAG A;  4LWS A;  4U7O A;  2Y0I A;  1WB8 A;  3CC2 V;  1WAZ A;  1IXB A;  2GV9 A;  5JVD B;  3JSL A;  3QVN A;  4LFB O;  4LWS B;  3WB0 A;  2UU9 B;  3KDR A;  4DRX A;  1HNW B;  4D7S A;  2YIB A;  5B3S C;  4TT3 G;  2FTK A;  2Q68 A;  3DC6 A;  4KUM A;  3VQY A;  4DRX B;  1K97 A;  1FXV A;  1N32 B;  4JPR A;  4NYK A;  3E8H A;  1KEC A;  1AR1 B;  2G38 A;  4DV4 O;  2WLL A;  1FJG O;  1PKX A;  2DE0 X;  4MW8 A;  5BR8 O;  4NTY A;  2ZXW B;  3K08 A;  1W59 A;  4K0K B;  4FFK A;  4JTA B;  2DYS B;  1PM9 A;  4HAM A;  1QR9 A;  2WLL B;  2AW9 A;  1Y67 A;  4PA3 A;  1FFT B;  3AG7 A;  3WB1 A;  5HFL A;  1OV9 A;  3U0Z A;  5JJJ B;  2JDI G;  4JAV A;  2E76 B;  4JI1 B;  1TGO A;  3RYF B;  4X1Y A;  2LGW A;  4FLV A;  4NKG B;  2A3Q A;  4AHC A;  3LUT B;  1MA1 A;  1UFI A;  4PA6 A;  4UCR A;  4X1Y B;  3GVM A;  4BIO A;  1GM7 A;  2QDO A;  2HFE C;  2HVJ C;  1Q6I A;  4JI2 B;  2WLJ A;  3D3Q A;  4NVP A;  2Q4P A;  3MHH C;  3QO7 A;  1QLN A;  4DR1 B;  4JAU A;  4I0X A;  1PNL A;  2DQ0 A;  4D6T H;  4F4L A;  4PDM A;  3WG7 B;  2OYQ A;  4H37 A;  3QO5 A;  4JAS A;  4UVA A;  4I0X B;  2GSM B;  3TET A;  4IHJ A;  3K03 A;  2ZR3 A;  4PA9 A;  4IGG A;  1OCO C;  3E35 A;  3MAQ A;  5LYJ A;  1NZ6 A;  4MVO A;  3RGB A;  3LSQ A;  3ZBH A;  2Q5Z A;  5DEC A;  1S72 V;  4MVS A;  1DF4 A;  4UCU A;  5LYJ B;  1QNM A;  2QWN B;  4LF4 B;  1BGY H;  4DO2 A;  2KKW A;  1PL0 A;  2OCH A;  4JI3 O;  1YCI A;  2ODM A;  4QPK A;  4ICG A;  1GM8 A;  2XAJ A;  5CBH A;  2F66 C;  2ZNJ A;  3QTC A;  1F4N A;  2GTS A;  1KD1 W;  3ZRS A;  1B06 A;  1WLE A;  3OMI B;  4LFB B;  4FLX A;  1D2D A;  2P06 A;  3CC7 V;  4NB5 A;  3RYI A;  4LF6 O;  4PEL A;  5IY5 B;  1R6T A;  3ABK B;  3RYI B;  4G28 B;  2ZKO A;  2EIK B;  4I4T A;  1TAE A;  4LFC B;  2VQF O;  4U3J A;  4LF7 O;  2H94 A;  4DV4 B;  1PL4 A;  2QWO B;  1L0N H;  4KHP B;  1FJG B;  3JD0 A;  4I4T B;  5BR8 B;  2Z5U A;  1Z2G A;  3SDL A;  4U3J B;  2R70 A;  2ADP A;  3JAM N;  3G6B A;  4RAI A;  3R65 A;  2JS5 A;  1YJ9 V;  3B40 A;  1SER A;  1KQS U;  1EZV H;  1ROP A;  1VF6 C;  4TOI A;  2DYR B;  2V4D A;  2B1G A;  4CC6 A;  1I94 B;  1UJW B;  3ZHR A;  5EBW C;  5KA6 A;  1M1K W;  2HLD G;  2ZR2 A;  3FB7 C;  2FB5 A;  4Z2W A;  5J9P C;  4I9Q A;  2UUA O;  2Q0A A;  2QWP B;  1CPY A;  1LNQ A;  2XHB A;  1NU1 H;  1K4D C;  4J80 A;  4ASU G;  5DED A;  1XMO O;  4I50 A;  4LP8 A;  1Z5V A;  4FLZ A;  1TUE B;  3P3P A;  4BR6 A;  3EFF K;  1L0L H;  2QSA A;  2X6C A;  1FS0 G;  2ZDI A;  3E8B A;  1L8D A;  5L3E A;  2L35 A;  1N33 O;  4I50 B;  3OFN G;  4HYO A;  3B2E E;  3GWK C;  1P7G A;  2M7W A;  3ML0 A;  1HNZ O;  4GYC B;  4QE7 A;  3ICX A;  1BS3 A;  2F95 B;  4O2B A;  3W7S A;  1I0H A;  3CPW U;  2UXC O;  2ZT9 B;  4AQY B;  2YEV A;  1GN4 A;  4LF8 O;  3T1Y O;  4O2B B;  3AG3 B;  3SPI A;  3ABL C;  1UPG A;  4YXW G;  1R73 A;  3HPL C;  4DV2 O;  2YEV B;  1XNQ O;  3CRM A;  4K35 A;  1ORQ C;  1XL6 A;  1O9H A;  1OHH G;  4XDK A;  4JI3 B;  5KA5 A;  4B3M O;  3CEI A;  2A06 H;  3AK1 A;  1M56 C;  4X66 O;  3AG4 B;  4MVQ A;  4FZ0 A;  1BSM A;  3X2Q B;  3VQV A;  2WLN A;  3D36 C;  1IBM O;  5DN6 G;  3K06 A;  3OD4 A;  4I5S A;  1TA8 A;  3ZN1 A;  1KKC A;  2EUL A;  1NH2 D;  1NT2 B;  1WPB A;  2AHZ A;  1RFY A;  2Q69 A;  5J2T A;  1FXK C;  1IXM A;  1MG1 A;  2CTR A;  3OMA B;  2VQF B;  2XTA A;  4LF7 B;  1RPR A;  1V54 B;  4JV5 O;  5J2T B;  3UCS C;  3K9S A;  1KP2 A;  3QNE A;  1OCC B;  4PI2 A;  1XRE A;  1VQ4 V;  2CE4 A;  3BY6 A;  4DV6 O;  3KZI Z;  4DR3 O;  1K4C C;  2HKO A;  3OEH G;  1N0N A;  3CRC A;  2EIJ C;  3RWR D;  1K5Q A;  5KHI A;  4GKK B;  1VQK V;  3JAL A;  4JTC B;  3LDE A;  4G2K A;  2Y48 A;  2UUA B;  5EBL C;  2QTS A;  3JAL B;  5L3G A;  3SJQ C;  1I5Y A;  5IWA B;  1EBO A;  2P6J A;  1YTF D;  2JGD A;  2QKA A;  3CB2 A;  3DGE A;  4LC1 A;  4JYA B;  3APO A;  3AG2 B;  4TUY A;  4Q20 A;  2JK5 C;  2JGD B;  3C3S A;  3TXS A;  2JVD A;  2AHY A;  2D2C B;  1VQ9 V;  2IM9 A;  2X6A A;  2YXL A;  2LP7 A;  4TUY B;  1AP5 A;  4B3S O;  2F1M A;  3JAR A;  2QWR B;  3F5T A;  1KBH A;  5LGU A;  3SPH A;  5LMU B;  4UV9 A;  5C93 A;  2UXC B;  3JAR B;  2N74 A;  5JQG A;  3F5W C;  1XNR B;  3RYH A;  1J95 A;  1CXZ B;  1S77 D;  4LF8 B;  4RWU A;  3T1Y B;  1URF A;  1R3I C;  2RDC A;  5JQG B;  2O57 A;  3RYH B;  2YUA A;  1WPX A;  4B3M B;  5ITZ A;  2Y0P A;  3OTO B;  4XDL A;  3F7V C;  4TSF G;  3AG1 B;  4X66 B;  5EIB D;  3APQ A;  4EFE A;  5ITZ B;  5EK0 A;  1SQV H;  3ASN C;  4BWA A;  1IBM B;  2BTQ A;  4GKJ B;  1BL8 A;  1SC5 B;  3K5M A;  2KQX A;  1KP3 A;  4JI7 B;  2Y69 C;  3CXH F;  5CA1 A;  2BTQ B;  1F7Y A;  3R66 A;  1E79 G;  1OCZ B;  3BVO A;  2RJZ A;  4AI8 A;  5CBF A;  4J9Z B;  3B77 A;  4EEQ A;  4LH6 A;  5CA1 B;  4YY3 O;  2NR5 A;  2EIM C;  5FPR A;  3JYC A;  3FB8 C;  2ZM6 B;  2UUC B;  2OCC C;  4XDJ A;  4X88 A;  2NLJ C;  2QKC A;  2Q73 A;  1P49 A;  2PI5 A;  2MK3 A;  3E86 A;  5LOV A;  1ZTE A;  4DV6 B;  4CS3 A;  4BW9 A;  1E1R G;  3FB6 C;  3SJB C;  2GBO A;  4DR3 B;  2JS3 A;  3CCQ V;  5LOV B;  1JVM A;  3ETQ A;  3AK2 A;  1ZX3 A;  3SPJ A;  2IW5 A;  5B3S B;  2UXX A;  2YIC A;  1ARO P;  3E83 A;  2R72 A;  3STL C;  2Q8V A;  5IYB O;  2A7W A;  1XOU A;  4PHZ A;  3M8A A;  1JQ0 A;  2IH1 C;  4UVC A;  2V1D A;  2LO1 A;  5D5P A;  1GO3 F;  1YDX A;  2RQ6 A;  3JD3 A;  1QLE C;  1NS1 A;  1US6 A;  3A2F A;  4ZOL B;  1XDC A;  4H44 B;  3OUS A;  4U3F H;  1YEW A;  2R9R B;  3SYA A;  1F23 A;  1Q86 W;  3WU2 Z;  1B3Q A;  2P4K A;  2QR4 A;  2YXY A;  3CCV V;  3FKS G;  4B3S B;  1S3J A;  3SYC A;  5IDJ A;  1Q5O A;  3QO8 A;  3H1L H;  1R3J C;  4IYI A;  5K1X A;  4X9Q A;  3B8N A;  3I55 V;  4DV1 O;  1NI8 A;  1JNB A;  4YIP A;  5EZY A;  2AXT Z;  3MHS C;  5L3B A;  1MSD A;  1QBZ A;  2IJI A;  1Y76 B;  4C7U A;  4R6Z A;  5EIB C;  5JCO C;  3QG5 A;  2JRI A;  3TCU A;  1NQT A;  2LQT A;  4DUY O;  5EZY B;  3ASO C;  3SYQ A;  2A9H A;  2EBO A;  3OAA G;  3H1J H;  3IC7 A;  3A0R A;  2F43 G;  1EN6 A;  1NVP D;  1SET A;  1LUV A;  2PTM A;  4FLY A;  2N05 A;  1SRY A;  3CMA V;  1RPO A;  4MS2 A;  3CHX A;  1MZF A;  4QJF B;  1KC8 W;  1EZJ A;  2KG7 A;  1GN3 A;  1OCO B;  1SQB H;  4DV5 O;  1U97 A;  4YHH O;  2X7R B;  3L72 H;  2XAS A;  1H2N A;  3T4Z A;  1W2B U;  3J80 N;  2IJJ A;  2KG7 B;  4TV9 A;  3SPG A;  5LHG A;  4FPP A;  2PF4 E;  3H1I H;  4ABM A;  1N0J A;  4TQD A;  4Z1V A;  2K9P A;  3W7X A;  2YIB D;  1TUB A;  1GK9 A;  4TV9 B;  3F7Y C;  4I7Z B;  1SS3 A;  4JI4 O;  4MTF A;  2EIL C;  3Q4H A;  1TUB B;  2EJR A;  3HKD A;  1YJW V;  2RNB A;  2PY5 A;  1DTO A;  3L9D A;  4KXR A;  3Q4H B;  4ZI7 A;  2CK3 G;  1KYO F;  3RYF A;  3HKD B;  4RQF A;  3JCZ A;  2VWJ A;  5B1A C;  4ZI7 B;  4JI5 O;  4RO2 A;  2GDS A;  1P7B A;  4OXS A;  4QIW F;  4DUZ O;  2H3O A;  3RFR A;  1I7F A;  4NTW A;  4WFG A;  4N21 A;  1Q81 W;  1AJP A;  1BHA A;  2JJ1 G;  4DR6 O;  1OCR C;  1O9G A;  4A5U B;  3IGA C;  3T1H B;  1K9M W;  1H8E G;  1V55 C;  5LMN B;  3UM7 A;  5A9G A;  2QA4 V;  1M57 C;  1D5N A;  2Z3Y A;  4GZR B;  1XMQ O;  4DV7 O;  4LH7 A;  4X62 O;  3G67 A;  4PDL A;  3T1C A;  1HR0 O;  1KMI Z;  2VRZ A;  3JCU Z;  2CGN A;  4P9O A;  5GW7 A;  2E5L B;  4DV1 B;  5LHH A;  1GTO A;  1AB3 A;  1B04 A;  3JAK B;  4X89 A;  3DTU B;  1NR7 A;  3GB7 C;  1D5A A;  4UCT A;  1FAF A;  3RN4 A;  2CH7 A;  3OW2 U;  1YHQ V;  4L8J A;  1IX9 A;  3CCE V;  1IDS A;  4E2L A;  1JCH A;  1NTK H;  4D7T A;  4QPJ A;  2CH7 B;  4H33 A;  3DSQ A; 
#chains in the Genus database with same CATH homology
 3CEI A;  1EN4 A;  3AK1 A;  4F6E A;  3IC9 A;  1I08 A;  1PL4 A;  1MA1 A;  1BSM A;  1VEW A;  4JZG A;  1ZUQ A;  3BFR A;  1AP6 A;  1KKC A;  1LUW A;  2ADP A;  3EVK A;  1ZLZ A;  1XDC A;  3LSU A;  3OT7 A;  3TJT A;  2ADQ B;  1ZSP A;  4JZ2 A;  2P4K A;  2GDS A;  1SZX A;  1AR4 A;  1AR5 A;  4X9Q A;  1BT8 A;  1MMM A;  1WB8 A;  3K9S A;  1JA8 A;  4YIP A;  1IXB A;  1GN6 A;  1AVM A;  1MSD A;  1VAR A;  1WB7 A;  1XRE A;  4C7U A;  3QVN A;  2CE4 A;  5AG2 A;  4E4E A;  3KKY A;  3KDR A;  1XUQ A;  5A9G A;  1QNM A;  1GN2 A;  1EM1 A;  4BR6 A;  1D5N A;  3AK3 A;  3DC6 A;  1EN6 A;  1N0N A;  1EN5 A;  1LUV A;  1P7G A;  2RCV A;  1MNG A;  1BS3 A;  1GN3 A;  1I0H A;  1B06 A;  2QKC A;  1XIL A;  3MDS A;  1ZTE A;  4FFK A;  1GN4 A;  1PM9 A;  2QKA A;  4YIO A;  2CDY A;  3RN4 A;  2AW9 A;  3C3T A;  3DC5 A;  1Y67 A;  4GUN A;  1JR9 A;  1N0J A;  1IX9 A;  3C3S A;  3AK2 A;  1IDS A;  4JYY A;  1AP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...