3AK2A

Superoxide dismutase from aeropyrum pernix k1, mn-bound form
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
211
structure length
211
Chain Sequence
MVSFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAVMRDFSFNYAGHIMHTIFWPNMAPPGKGGGTPGGRVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDPLTEELRILQVEKHNVLMTAGLVPILVIDVWEHAYYLQYKNDRGSYVENWWNVVNWDDVEKRLEQALNNAKPLYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn/Fe]
publication title Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 - insights into the enzyme mechanism and stability
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 72
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ak2A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ak2A02
1BSMA 1ZLZA 1BT8A 3DC6A 1ZTEA 4JZGA 3DC5A 3MDSA 2AW9A 4BR6A 1IDSA 2ADQB 3TJTA 4FFKA 1SZXA 1MA1A 1JA8A 1PL4A 4F6EA 1MSDA 1QNMA 1WB7A 1EM1A 1P7GA 2P4KA 2RCVA 2QKCA 1MMMA 1XUQA 4GUNA 3RN4A 1GN6A 3OT7A 1AP5A 1WB8A 4C7UA 1VEWA 1EN4A 1IX9A 1XDCA 3C3SA 1GN4A 3BFRA 3QVNA 1D5NA 1AR4A 1JR9A 1XILA 1AR5A 4JZ2A 4X9QA 3LSUA 2CE4A 1KKCA 4E4EA 1EN6A 3EVKA 1XREA 3K9SA 3AK2A 2CDYA 3IC9A 3AK1A 1GN2A 1LUVA 1LUWA 1BS3A 1AP6A 3AK3A 1I08A 4JYYA 5A9GA 1Y67A 1IXBA 4YIOA 1VARA 4YIPA 1GN3A 1MNGA 1EN5A 1B06A 3C3TA 1N0JA 3CEIA 1ZSPA 2ADPA 1AVMA 1N0NA 5AG2A 2GDSA 3KKYA 1PM9A 2QKAA 1ZUQA 1I0HA
chains in the Genus database with same CATH superfamily
4WFHA 3HKCB 3QTCA 1OCCC 2UUCB 3WU2Z 1YITV 2F66C 3THOA 4Q6GA 2HHHO 2AW9A 3CRAA 3CJHB 3VQYA 5IWAO 4O2AA 1VQKV 2H3OA 1H2MA 3ZMSA 4X88A 1V54B 5TISZ 4BW9A 1TUBA 1JA8A 3ZHSA 1QVFU 1XMOO 2PY5A 3ZMZA 5KX5A 4YXWG 2P4KA 2PI5A 5EBLC 1GKFA 2QM7A 1US6A 2ZE8A 1M93A 1KD1W 4JYAB 2WLIB 4HNAB 2YXLA 2Q0AA 3RYFB 2QKSA 1Q82W 5D5QA 3TCUA 1IBLO 4UVAA 5KAIZ 2BTQB 2UUBB 4UCVA 2Q0OC 1S76D 1ZL8A 2QTSA 1P4RA 1AR5A 1D5AA 3HKCA 4FLUA 4DV4O 1KBHA 1SRYA 1EN6A 2DYSC 3CJHA 5JQGB 3RYCA 4L87A 1OCOB 1VQLV 2WA4A 1MG1A 3OAAG 3ZJZA 3JARB 3BHPA 4X20B 2OTJV 4JAVA 2Q6AA 5GTIZ 4AI8A 3CC7V 3QO5A 2NR5A 2HKOA 3S3XA 1IXBA 2ZE7A 1PV0A 3JD3A 2BTOA 3VQVA 1GMGA 1EN5A 4HNAA 5CB4A 3RYFA 3D36A 4GX0A 1K73W 1CEZA 4X8AA 2QTOA 4P2ZA 4J11A 1MOFA 5JWPA 1ZSPA 5CA0B 2HEPA 2ZR2A 3OR6C 3K5LA 1M57C 2F43G 2E74B 1XHXA 1VIBA 1QR8A 4U7OA 1HNWB 5JQGA 2UXXA 4DO2A 4I5SA 1HNXB 5KHJA 3L75H 2XUMA 2UXDB 1PL0A 4P9OA 4LBEC 1V54C 3K59A 1QR9A 1VP7A 5DM6V 3ZMTA 4AQYB 2UXCB 3B8MA 4QJFB 2R70A 1O9HA 1AJNA 2DMXA 1VQ6V 4TV9A 1EM1A 1WA8B 4PDLA 5LOVB 4G27B 1K8AW 3D36C 1UJWB 1L8DA 1NKDA 4U3JB 1BHBA 1T5EA 2YIBD 1YXBA 5D5PA 1SQXH 3KCXA 3DXRA 5CA0A 1W59A 3PJSK 3UQ8A 1JR9A 3E83A 3EHBB 3ZIAG 2QE7G 2ZM6B 4JZ2A 1NJIW 4LF9O 3LSUA 5DEDA 1AILA 3CCJV 1F4NA 2YC0A 1AJPA 1OCOC 3OUSA 1JJOA 2AXTZ 2ZD9A 1VF6C 3FKSG 3CRCA 1HR0B 3P32A 3SPGA 3BVOA 2QA4V 4I7ZB 1AI6A 4LFBO 3AG2B 4O4IB 4MW8A 2E5LO 1O9GA 1WA8A 3VQWA 5LOVA 2EJ7A 2BOCC 1I7FA 1MNGA 3NXSA 5LXTB 3ABLB 5H2FZ 3JD0A 4U3JA 2VRZA 3N27A 2HP8A 2RMKB 1AVMA 5JCOC 1SQQH 1EBOA 3ASOB 2QWOB 1I0HA 3A0RA 1JPXA 2EILB 1BSMA 2QM4A 3RVYA 4JZGA 5BZBA 1NT2B 3RYHA 4CH5A 1TVKA 4RUFA 1YEWA 3W7UA 1MA1A 1IBKO 4O4IA 2AHYA 2FYUH 3T1YO 2IBZH 2IJJA 3HR0A 4IIJB 3FB7C 2HVJC 2VQEO 1V55B 3TXSA 3WB0A 1P7GA 2WPDG 2DW4A 1ZAUA 3IFXA 4FM0A 4CS4A 1H2NA 2UXNA 1NTMH 1NU1H 2YIDA 2RJZA 1AI7A 3RVZA 5BR8B 3OUFA 3C3SA 5A2QN 3CRRA 4O2BB 1NBMG 3ETQA 2X6AA 4DYLA 5HFMA 4DV2B 3RFRA 1WPXA 3ETEA 4DV7O 2HR3A 1GK9A 4E4EA 1WP7A 1E79G 3R66A 1QLEB 4MVSA 3J81N 3E86A 2FB5A 1B6QA 5BXZA 2ZDIC 4U7NA 5K1PA 4UV9A 4QE9A 2ZE6A 1VQ4V 4MTFA 2PGGA 3UM7A 4K8XA 3ABLC 1Q7YW 4WFEA 1RPOA 1P84F 3STZC 2IW5A 4MSWC 3AG4C 1Q43A 4X64B 1J5EB 4DR4O 5H9CA 1N0NA 3ASOC 4O2BA 2Q7GA 4QGPA 2ZNIA 2Y0IA 1Q6UA 3BPZA 2MW2B 4W4KA 4RO2A 2EILC 1Y76A 2JGUA 4YY3O 1ZLZA 2ZE5A 4NYKA 3KCYA 2YS8A 3APOA 3ZS8C 5IYCO 4LF5B 4GLXA 2JRIA 1G4YB 2MK3A 4NKGB 2DQ0A 3SYAA 2R9AA 3UCSC 3JAKB 3O65A 4I4TB 4KHPO 3UKMA 2H8PC 2UXBB 1DGSA 1FD9A 4B7EA 1BCCH 4NXMB 1XL4A 5CBHA 2XAQA 4IL6Z 4JI6B 4DR7O 1V55C 5LMNB 2RCVA 4PDMA 1K5QA 1Y4MA 2E3CA 3H1IH 1SA0B 2O57A 4LFCO 1GAXA 4JI0O 2LO1A 4R7CA 3OW2U 2IJIA 3JYCA 2XAJA 5EK0A 3AG7A 4BIUA 3LDDA 4XDJA 2EBOA 1F4MA 2UUCO 2AHZA 4BW5A 4Q20A 3ZHUA 2GSMB 4HAMA 1GRJA 1KKCA 4PDVA 3JATA 4OGQB 3A0HZ 3JALB 3WG7B 3JAKA 1QLEC 2Q73A 3E35A 4I4TA 2D3OW 3AK1A 1YJNV 4PI2A 4TSFG 3BA8A 1BS3A 1PD3A 4Z1VA 2A7WA 4CBCA 4BWAA 1N32B 4JYAO 5LP6A 1QVGU 3OR7C 2Y4UA 3CHXA 1NQTA 2P90A 3SJQC 1SA0A 2UUAB 3KZIZ 4ZOLA 4ZBMA 5H6QA 2IH3C 2Q4PA 2UUBO 4LWSA 3B8NA 1GM8A 3OE7G 4UB8Z 4X1YB 5EBMC 3ZHTA 3G71V 1JOYA 3HKDA 3OMNB 2FKXA 4DR6B 3L72H 4JTAB 2P7TC 2DYRB 3JSLA 3NR7A 4UVCA 4JGSA 3GWKC 5IDJA 3K9AA 4BAYA 3CCEV 3SYCA 1ENVA 1SETA 2WA3A 2PF4E 4X1KB 1SQFA 5KLVH 2X7RB 1S5JA 5L3FA 4F6RB 2KG7B 4PV1B 1UFIA 4N21A 4FLVA 4H44B 2CGNA 2WLNA 4PA3A 5JJNB 3W7XA 1N33B 1YSCA 5IYZB 1VF7A 2HJFC 1Y74B 1SQBH 2JJ1G 4LF6B 4PA6A 1MMMA 1FXKB 1XUQA 5K1XA 3W7WA 2LFRA 2WLKA 1VEWA 4LNUB 3JD2A 3K0DA 1EN4A 4DV1O 1YCIA 1I5XA 3BAAA 3CPWU 1HNWO 3G6BA 1FXVA 3CXCU 1NTZH 1HNXO 3JASB 4GT1A 2NLJC 2Q7EA 2OCCB 4DV6B 5EIBC 2UXDO 4KP4A 4J41A 3K9SA 3WG7C 3P3PA 4X1KA 1HNZO 1GN2A 3L71H 2KG7A 4QPKA 3H1KH 4I50B 1YHQV 1R1BA 1I94B 3AEIA 2WAMA 4ABMA 2VQFO 1FXHA 1I5YA 1SKVA 2W0XA 4YIPA 1KMIZ 1Y74A 1B06A 1DF4A 1FXKA 1M90W 3K06A 4RQFA 2W6JG 3CP1A 2JK5C 1TUBB 2XASA 2LJ2A 2K1EA 5B1AB 3OD4A 1XL6A 1K4DC 2CH7B 3GWOA 3RW0A 5J2TA 3OTOB 1QQCA 5KX5B 1FOUA 2DYRC 2Y48A 1H8EG 3HPLC 3DSQA 1KP2A 4WFGA 2QSAA 4LFAB 1K3EA 2DJVA 1NR1A 3G67A 1L0LH 1QNMA 2V7QG 5J9PC 4LF4B 5IE9A 4X1IB 4JI8B 3L9DA 3OMAB 2Q9LA 4OXSA 2F93B 3SJAC 4FLZA 2JDIG 1WLEA 3ZRWB 2DE0X 1FXKC 3RYCB 3RN4A 4J7KA 3JCZA 1N36O 1GM9A 1PNLA 3FFQA 4DW1A 1M9NA 1D5NA 3HB3B 4DR1B 3P3NA 2EIMB 5J2UB 2CH7A 1H2LA 1SZTA 2CTQA 4GZRB 2OCCC 1D2DA 4ZI7B 3E22B 3CXHF 2EINB 3CWBH 2L35A 4DK0A 5CB4B 4TT3G 3K5NA 3AK2A 3IC9A 3U10A 2C2AA 4JYBA 4DXWA 2ODMA 3CS5A 2LGWA 5C8YA 1XNQO 4X1IA 4PA7A 1H2GA 2RN9A 4JI1B 4R8CA 2OTLV 4MVQA 2FMLA 3ZRWA 5DN6G 3X2QB 3H1JH 3I56V 4GX5A 1OZ0A 4IGGA 1HP8A 4LF7O 1NTKH 4YHHO 5AG2A 4DK1A 4UCRA 3B77A 3JCUZ 5J2UA 1BQZA 2YIAA 4NXNO 4WF9V 4TV9B 1BT8A 4ZI7A 5E1AC 3E22A 5KHKA 1M4UA 1JNBA 1RM1B 1XHZA 4B3TB 4DV3B 4FLXA 1SQGA 3TJTA 4JYCA 5KUKA 3BY6A 4H13B 3DXRB 3SYPA 5KUMA 1URFA 1MABG 3HKBA 1AJQA 4NTYA 3WB2A 5KHIA 3CRQA 3DTUB 4P30A 4X64O 3B4SA 4FM1A 4MT8A 1WB8A 4X65B 1S5LZ 2ZIMA 3CYOA 1ZX3A 4JI5O 2ZINA 2EIMC 4XDKA 4NR1A 2IJKA 2ATKC 4JF3A 1MZFA 4WCEV 4OX9B 2X6CA 4JV5O 3SJBC 2GTAA 1IXMA 2LGQA 3T1CA 2UXBO 3AG1B 4NXMO 2ETNA 1JQ0A 3JAMN 3MHSC 2F95B 3QO7A 4DUYB 3FB5C 4JI6O 3JSNA 4FM2A 5LMNO 1I08A 5EC2C 1WP8A 3GVMA 1BGYH 3TGUH 3W7TA 4JI2B 2YIBA 5EBWC 3E2EA 1YJ9V 2A3QA 1JJ2U 4JI7B 1Z5VA 2FL4A 5LGNA 3X2QC 2QWQB 3RYHB 3D3IA 5LHIA 2Q68A 1ROPA 3TETA 1TVKB 1R3IC 1OHHG 2N04A 2W6IG 2QM8A 4R6ZA 3VQXA 2JEXA 1VQMV 3ABMB 1CXZB 1RM1C 1ZTEA 4JTDB 1YI2V 1N32O 3BABA 1SZXA 1HDJA 1LNQA 2Y69B 2OIGA 4MVZA 5IJ9B 2UUAO 3CCMV 5KMGB 4XDLA 2HG5C 4DR2O 1G1XB 5B3SB 2NN4A 3H9VA 1YDXA 1GN6A 1BHAA 3C90A 4DR6O 4D7SA 1WNSA 3T1HO 1OJHA 1VQ7V 2WLLB 3OEHG 1RSOB 4YJ3A 4B08A 2QEXV 2F1MA 3M7MX 3ZMVA 3AG1C 3CCQV 1DK1A 4W4LA 4UCOA 4CC6A 1S72V 4KL1A 2EULA 5B5EZ 1PPJH 3U0ZA 1LUVA 1YZBA 2L6LA 3QG5A 2GV9A 2CAZC 1N33O 2V1DA 4UFZA 3U11A 5IJ9A 1VARA 1X59A 4LF6O 5KMGA 4UCUA 1Y76B 3FB8C 4LC1A 4UV8A 4GKKB 3D3QA 1NH2B 2GBOA 5LYJA 1B3QA 3SYOA 1NR7A 2Q7HA 1GH6A 2ADPA 5B1BB 4DV5B 4GCZA 2YXHA 4MVRA 1PM9A 1G6UA 3AG2C 4DV6O 3M8AA 3K3WA 2WLLA 4B3SB 1RSOA 1KP3A 2DWDC 3ABMC 3AG3B 3DC6A 3HKEB 4OPHA 1R3JC 3MDSA 1Z2GA 1IDSA 1P49A 3B40A 1NS1A 1I94O 2IU3A 3ZRVA 1VF5B 3Q4HB 2ZIOA 1KB9F 3RYIA 5CBGA 4F6EA 2Y69C 4K0KB 5CA1B 1YVWA 1WPBA 5L3GA 3EFFK 1V9PA 3ZN1A 1SC5B 5JH7A 3ZCCA 3JATB 5JVDA 3ZX6A 3RGBA 2JGDB 2QGNA 2Q5ZA 3ZRXA 1FFTB 3OTOO 2Q67A 1VQOV 3IJ4A 4A5UB 2Y0PA 5BMVB 3F7YC 4PA4A 3N2KA 2ZR3A 1KQSU 4PI0A 5LP6B 5CN0A 2CE4A 3CB2A 3HKEA 4EFEA 4FMTA 3UT5B 3CCUV 4N23A 4LFAO 4ZOLB 4MVOA 3OGIB 4LWSB 3Q4HA 3ZMUA 1LUWA 5L3EA 2EZOA 2KKWA 5KA5A 5A9GA 4X89A 2CTWA 5CA1A 1XEQA 4TV8A 3S3WA 4EEQA 5H6RA 5B1NA 3HKDB 5FPRA 4FZ1A 4DUZB 1LR1A 2GHYA 4I9QA 1GM7A 2ZNJA 2D2CB 2JGDA 4KUMA 3CCVV 4EB6A 2LW1A 5B1BC 3CCSV 3CCLV 4E2LA 1R3LC 5BMVA 4GKJB 4LF8B 2LQTA 1J95A 4UXNA 5LMUB 3P30A 4UB6Z 2E5LB 4MVMA 4WFAV 4ZHQA 1K33A 3AG3C 1CP9A 2Q69A 3LDCA 3UT5A 4BR6A 1KU9A 3ZN0A 1M5IA 4K35A 4O4LB 3JD4A 4FJCC 2YI9A 4O4JB 2WLHA 1K92A 5EYPB 2WSSG 1CPYA 1MSDA 2AGAA 1SS3A 2V4DA 3E8BA 3SDLA 3B2EE 3I5DA 2F4VB 1IBMB 1WB7A 2H94A 4K3AA 1COWG 2HLDG 2JEUA 2OT5A 2DWEC 1Q6IA 3CX5F 1IVSA 4FLTA 5L3BA 2YI8A 3E89A 3A8TA 3OFNG 2R72A 2XOKG 4B3RB 1AR4A 2RNBA 1XILA 2E75B 4HZ3A 1FJGB 2OCHA 5LP6C 4B3TO 4DV3O 2P5OA 4DR5B 3F5TA 3K08A 1K4CC 4O4LA 2CDYA 3SJCC 1TUEB 4YJ2A 1YJWV 4O4JA 5EYPA 3CCRV 1AP6A 4EFBA 1SERA 1PNKA 3UO2A 5FPOA 4IT5A 1KYOF 1K97A 3B09A 5J2TB 1K5SA 2P67A 2XNDG 4H33A 3ETDA 4FFBB 1EFRG 1XBLA 3FB6C 2ZXWB 1AR1B 1FYJA 1PP9H 2KQXA 4AQYO 2UXCO 3ZRSA 4G28B 2WLJA 3CSXA 4OX9O 4QPJA 4DV0B 2F23A 4NTXA 2GDSA 1E1RG 2P4VA 3KKYA 1H5WA 5GONB 5DECA 2IM9A 2P6JA 1Q5OA 3O9OA 2VWJA 1QU7A 4DUYO 2CK3G 2ITDC 3VBBA 3W7SA 5L3CA 4MS2A 1K7DA 4D6TH 2UU9B 3MD0A 1K9MW 4JI2O 1PL4A 3F7VC 3E8FA 2ZM6O 5LGUA 3N2GB 4JI7O 4R50A 4PD4F 2YEVA 5GW7A 4IHJA 4FFBA 2DYSB 3J7AU 3CC2V 2HJDA 1HR0O 4YY3B 4X66B 3L70H 3FX7A 1ZWIC 3K04A 4X62B 2GTSA 1VQ5V 1Q8IA 4JPRA 1IX9A 1XDCA 2OYQA 1R6NA 5C8YB 5GONA 4CS3A 1KECA 2ZQMA 4BIZA 2HVKC 4X9QA 4NVPA 2R9IA 3ML0A 1OCRB 1N4CA 3LUTB 4JI4B 3OTFA 2NNUA 1YTFD 4LFCB 1FFXB 5EC1C 3L73H 2QJ1A 3A0BZ 3N2GA 4Z2WA 2DN9A 1U97A 1H8HG 3FAVA 4JAUA 5JJJB 4GYCB 3BCCH 4B3MB 1BQ0A 2GUZA 1G8MA 2ZXWC 5FLXN 1OCZB 1S3JA 1N0JA 4O4HB 4WFBV 2N74A 3K57A 5KA6A 5LA6B 5ITZA 4ZKIA 1NVPD 4DW0A 1H2KA 3HKBB 1S5HC 5LHHA 1XNRB 3EXAA 2QDOA 5BR8O 1FFXA 1VQ8V 1SF9A 4WBNB 1QLNA 3ETGA 2B1IA 4F4LA 4DRXA 1XI1A 2ARHA 5B1AC 3DGEA 1L0NH 4DV2O 4GKKO 2EIKB 1W0KG 2VWKA 1THZA 2XAFA 4I55B 2IJHA 2RQ6A 4UUJC 2ZCEA 3E8HA 3A2FA 5KAFZ 1XMQB 4GUNA 4DV5O 4FLWA 3OT7A 4O4HA 5LHGA 5CMUA 2JS5A 4FIPC 3FYIB 5E79Z 4H0LB 4B3SO 1TA8A 3BFRA 4J80A 4MVUA 2A79B 3QVNA 1RFYA 5LA6A 3ZHQA 1Q81W 3H1LH 3KG2A 4TQDA 1DLBA 3OM3B 4JI3B 3SPHA 3WB1A 5KHGA 4PA9A 4LCUC 4DR3B 1XQ8A 1OCRC 4J7ZA 2WLIA 1R6KA 2Z0AA 4Z1MG 2IU0A 3K5MA 1J5EO 2B5UA 2BOBC 2LP7A 1KC8W 5HFLA 4K0KO 4WBNA 4G2KA 2G38A 2BTQA 4RAIA 4AHCA 2PYLA 1BZKA 4DV1B 3CD6V 4EKWA 4LF5O 5LGTA 4TOIA 5H5NA 1K34A 1N34B 4I55A 2BE3A 1S77D 1L1FA 4J7JA 2EINC 1OCZC 3QO8A 4LR3A 1VF6A 3JARA 3C3TA 3R65A 1W2BU 3LSSA 4X20A 1IJGA 3ASNB 1Q86W 1HNZB 2Z3YA 3H01A 1HW7A 1TGOA 4JTCB 4GX1A 2HFEC 3SPJA 1BL8A 2ZT9B 1PNMA 1Y6XA 1GTOA 2VQFB 2PZSA 3UO3A 2ZKOA 3I55V 5IYBO 2OIEA 3LNMB 1F7YA 2PYJA 4L8JA 3JD1A 1WN7A 4GX2A 2JS3A 4ZIBA 1E1QG 4CS2A 5JCOA 4B7KA 4KFMA 3G6EV 4DUZO 1UPGA 2EIKC 1AI4A 3K0GA 2EJRA 3KDRA 4IYIA 1VMGA 3ICXA 3PN1A 4YJ3B 1U96A 3LDEA 5C93A 4GKJO 2YXYA 4LF8O 3H1HH 2M7WA 1R6TA 2YUAA 5LMUO 1VQ9V 5KHHA 2XAGA 1R3KC 2FTKA 3QF7A 2IH1C 5GTHZ 1AB3A 5FNVB 2W0FC 5EZYB 5LYJB 3D8CA 2HHHB 2F4VO 3AG4B 5IWAB 1R73A 1NI8A 1IBMO 3LSQA 1N36B 1RP3B 1BE3H 1KKDA 4JYYA 1Y67A 1S0VA 4ICGA 4MW3A 2QR4A 1XMOB 4FK5C 3SYQA 4HBNA 1QCEA 1AROP 1Q90D 5L3DA 1JVMA 4J42A 4B3RO 3T4ZA 4FLYA 1M1KW 3ASNC 1SQPH 2M6YA 1FJGO 3ABTA 3RYIB 1IBLB 2ZDIA 4DR5O 1IZ3A 2BCCH 3STLC 4RUEA 2OWOA 4MTOA 3ABUA 5LXTA 2RDCA 1B04A 1XNQB 2BSKB 4BIOA 5JH7B 5FNVA 3ZHVA 3DC5A 4AILC 1FKAO 4RWUA 5B1OA 5JVDB 4DV4B 5EZYA 1JFFB 4FFKA 1VQPV 1SESA 3ZHRA 3L74H 4LF7B 3K03A 4YHHB 3N2KB 1N8RW 2QKCA 1X4TA 4NXNB 3G80A 4UVBA 1JX9A 3OGCC 4DV0O 4C7UA 1NZ6A 2YICA 2CTRA 1F51A 2DOSA 2AZ0A 4P9PA 1H38A 1GN4A 3K5OA 2XHBA 4IIJA 4J10A 2A06H 4TV8B 1FS0G 1KUQA 2EIJB 2N05A 3CE2A 2BSKA 1WAZA 4J9YB 3EVKA 1XREA 2VS0A 4LH6A 4TQFA 5B3SC 4CH3A 2UU9O 1W0JG 4FPPA 1JFFA 3QNEA 4OPAA 4EB6B 1NH2D 4LP8A 3BEHA 2A9HA 4JI5B 4X66O 1DF5A 4UCSA 4NB5A 4X62O 3ABKB 4ZHQB 2P22C 4JV5B 4TUYB 2R9RB 4J9ZB 4U3FH 1XOUA 1P7BA 1Q6HA 1MZEA 1FAFA 3SGIA 3OEEG 4LF4O 4NTWA 1YIJV 4FZ0A 1HWYA 4JI8O 2X0LA 2QKAA 1ZUQA 3MHHC 2Z5UA 4JI4O 2WWWA 4KXRA 4CH6A 1Z5WA 4LF9B 4H37A 3CMAV 1Q3EA 4JAAA 2LW7A 3TK1A 5IY5B 2CUGA 2QWPB 4DR1O 3CRMA 3ZBHA 2QWRB 3RT3C 4B3MO 2WLMA 2K9PA 1EZVH 2AZ2A 4LFBB 3BA9A 3ZEDA 4TUYA 1H2SB 1F23A 1PKXA 4YJ2B 4PHZA 2A0LA 2X6BA 5BY1A 1M56B 3G4SV 3TXQA 1XNRO 2DQ3A 4JI1O 2EIJC 3E8GA 2XAHA 3SPIA 3F5WC 3GB7C 4LH7A 3J80N 2JVDA 4DR2B 2XT9A 3SPCA 4D7TA 3CC4V 5FL7G 3AK3A 2ITCC 5EIBD 5F2VO 2ILMA 3IAYA 4YIOA 3T1HB 1A32A 4MTXA 4WFFA 4I0XB 1XMQO 1IBKB 5CBFA 3ABKC 3T1YB 1GN3A 2Y4TA 5IJ0B 3JALA 2VQEB 5JJEB 2B1GA 3CEIA 2PUSA 1QHTA 4XBFA 4CZZA 4RQEA 1OV9A 1VQNV 1RPRA 2CGOA 4JI3O 2KSDA 3VOUA 2CTPA 4DR3O 4TWKA 3BRCA 5LL6Y 4HYOA 1JMKC 2JJ2G 2YEVB 1OCCB 2B9ZA 3RWRD 1TAEA 4IHJB 4X65O 3T2MA 2ADQB 2YSUB 4DV7B 5IY5C 4PDRA 1QBZA 2E76B 3JAWB 1YF2A 4X1YA 5IYDO 2XTAA 3LNNA 1N34O 4CH4A 3T4DA 2JIZG 4I0XA 2YDEA 5LBQA 1ORQC 1IURA 5IJ0A 3FD9A 1AP5A 2QWNB 1MSWD 4F6RA 3K79A 5IT9N 1M56C 2LFSA 1YTFB 4DR4B 5IYZA 3FAVB 2EX3A 1JCHA 2GUZB 3RBZA 2P06A 4I9WA 3SR2C 4O2AB 2PI4A 3IGAC 5B66Z 3APQA 3OMIB 4LNUA 3CMEV 4MTGA 3JAWA 2Q8VA 1WJZA 1GO3F 4KHPB 3WFVA 1Y66A 4PJ0Z 5ITZB 4K8ZA 2KB1A 3JASA 1FPOA 4PELA 4FVMA 3MAQA 3M99B 4DR7B 5CA3A 2PTMA 4UCTA 4IYHA 1NVPB 4QE7A 3FYEB 1AI5A 3IC7A 4ASUG 4JI0B 1EZJA 4I50A 1BMFG 4JASA 4DRXB 1DTOA 1SQVH 4QNHB 4CC5A 4QIWF 1M57B 1ZL8B 3K58A 2EZPA
chains in the Genus database with same CATH topology
1BSMA 1ZLZA 1BT8A 3DC6A 1ZTEA 4JZGA 3DC5A 3MDSA 2AW9A 4BR6A 1IDSA 2ADQB 3TJTA 4FFKA 1SZXA 1MA1A 1JA8A 1PL4A 4F6EA 1MSDA 1QNMA 1WB7A 3KDRA 1EM1A 1P7GA 2P4KA 2RCVA 2QKCA 1MMMA 1XUQA 4GUNA 3RN4A 1GN6A 3OT7A 1AP5A 1WB8A 4C7UA 1VEWA 1EN4A 1IX9A 1XDCA 3C3SA 1GN4A 3BFRA 3QVNA 1D5NA 1AR4A 1JR9A 1XILA 1AR5A 4JZ2A 4X9QA 3LSUA 2CE4A 1KKCA 4E4EA 1EN6A 3EVKA 1XREA 3K9SA 3AK2A 2CDYA 3IC9A 3AK1A 1GN2A 1LUVA 1LUWA 1BS3A 1AP6A 3AK3A 1I08A 4JYYA 5A9GA 1Y67A 1IXBA 4YIOA 1VARA 4YIPA 1GN3A 1MNGA 1EN5A 1B06A 3C3TA 1N0JA 3CEIA 1ZSPA 2ADPA 1AVMA 1N0NA 5AG2A 2GDSA 3KKYA 1PM9A 2QKAA 1ZUQA 1I0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSM A;  1ZLZ A;  1BT8 A;  3DC6 A;  1ZTE A;  4JZG A;  3DC5 A;  3MDS A;  2AW9 A;  4BR6 A;  1IDS A;  2ADQ B;  3TJT A;  4FFK A;  1SZX A;  1MA1 A;  1JA8 A;  1PL4 A;  4F6E A;  1MSD A;  1QNM A;  1WB7 A;  1EM1 A;  1P7G A;  2P4K A;  2RCV A;  2QKC A;  1MMM A;  1XUQ A;  4GUN A;  3RN4 A;  1GN6 A;  3OT7 A;  1AP5 A;  1WB8 A;  4C7U A;  1VEW A;  1EN4 A;  1IX9 A;  1XDC A;  3C3S A;  1GN4 A;  3BFR A;  3QVN A;  1D5N A;  1AR4 A;  1JR9 A;  1XIL A;  1AR5 A;  4JZ2 A;  4X9Q A;  3LSU A;  2CE4 A;  1KKC A;  4E4E A;  1EN6 A;  3EVK A;  1XRE A;  3K9S A;  3AK2 A;  2CDY A;  3IC9 A;  3AK1 A;  1GN2 A;  1LUV A;  1LUW A;  1BS3 A;  1AP6 A;  3AK3 A;  1I08 A;  4JYY A;  5A9G A;  1Y67 A;  1IXB A;  4YIO A;  1VAR A;  4YIP A;  1GN3 A;  1MNG A;  1EN5 A;  1B06 A;  3C3T A;  1N0J A;  3CEI A;  1ZSP A;  2ADP A;  1AVM A;  1N0N A;  5AG2 A;  2GDS A;  3KKY A;  1PM9 A;  2QKA A;  1ZUQ A;  1I0H A; 
#chains in the Genus database with same CATH topology
 4WFH A;  3HKC B;  3QTC A;  1OCC C;  2UUC B;  3WU2 Z;  1YIT V;  2F66 C;  3THO A;  4Q6G A;  2HHH O;  2AW9 A;  3CRA A;  3CJH B;  3VQY A;  5IWA O;  4O2A A;  1VQK V;  2H3O A;  1H2M A;  3ZMS A;  4X88 A;  1V54 B;  5TIS Z;  4BW9 A;  1TUB A;  1JA8 A;  3ZHS A;  1QVF U;  1XMO O;  2PY5 A;  3ZMZ A;  5KX5 A;  4YXW G;  2P4K A;  2PI5 A;  5EBL C;  1GKF A;  2QM7 A;  1US6 A;  2ZE8 A;  1M93 A;  1KD1 W;  4JYA B;  2WLI B;  4HNA B;  2YXL A;  2Q0A A;  3RYF B;  2QKS A;  1Q82 W;  5D5Q A;  3TCU A;  1IBL O;  4UVA A;  5KAI Z;  2BTQ B;  2UUB B;  4UCV A;  2Q0O C;  1S76 D;  1ZL8 A;  2QTS A;  1P4R A;  1AR5 A;  1D5A A;  3HKC A;  4FLU A;  4DV4 O;  1KBH A;  1SRY A;  1EN6 A;  2DYS C;  3CJH A;  5JQG B;  3RYC A;  4L87 A;  1OCO B;  1VQL V;  2WA4 A;  1MG1 A;  3OAA G;  3ZJZ A;  3JAR B;  3BHP A;  4X20 B;  2OTJ V;  4JAV A;  2Q6A A;  5GTI Z;  4AI8 A;  3CC7 V;  3QO5 A;  2NR5 A;  2HKO A;  3S3X A;  1IXB A;  2ZE7 A;  1PV0 A;  3JD3 A;  2BTO A;  3VQV A;  1GMG A;  1EN5 A;  4HNA A;  5CB4 A;  3RYF A;  3D36 A;  4GX0 A;  1K73 W;  1CEZ A;  4X8A A;  2QTO A;  4P2Z A;  4J11 A;  1MOF A;  5JWP A;  1ZSP A;  5CA0 B;  2HEP A;  2ZR2 A;  3OR6 C;  3K5L A;  1M57 C;  2F43 G;  2E74 B;  1XHX A;  1VIB A;  1QR8 A;  4U7O A;  1HNW B;  5JQG A;  2UXX A;  4DO2 A;  4I5S A;  1HNX B;  5KHJ A;  3L75 H;  2XUM A;  2UXD B;  1PL0 A;  4P9O A;  4LBE C;  1V54 C;  3K59 A;  1QR9 A;  1VP7 A;  5DM6 V;  3ZMT A;  4AQY B;  2UXC B;  3B8M A;  4QJF B;  2R70 A;  1O9H A;  1AJN A;  2DMX A;  1VQ6 V;  4TV9 A;  1EM1 A;  1WA8 B;  4PDL A;  5LOV B;  4G27 B;  1K8A W;  3D36 C;  1UJW B;  1L8D A;  1NKD A;  4U3J B;  1BHB A;  1T5E A;  2YIB D;  1YXB A;  5D5P A;  1SQX H;  3KCX A;  3DXR A;  5CA0 A;  1W59 A;  3PJS K;  3UQ8 A;  1JR9 A;  3E83 A;  3EHB B;  3ZIA G;  2QE7 G;  2ZM6 B;  4JZ2 A;  1NJI W;  4LF9 O;  3LSU A;  5DED A;  1AIL A;  3CCJ V;  1F4N A;  2YC0 A;  1AJP A;  1OCO C;  3OUS A;  1JJO A;  2AXT Z;  2ZD9 A;  1VF6 C;  3FKS G;  3CRC A;  1HR0 B;  3P32 A;  3SPG A;  3BVO A;  2QA4 V;  4I7Z B;  1AI6 A;  4LFB O;  3AG2 B;  4O4I B;  4MW8 A;  2E5L O;  1O9G A;  1WA8 A;  3VQW A;  5LOV A;  2EJ7 A;  2BOC C;  1I7F A;  1MNG A;  3NXS A;  5LXT B;  3ABL B;  5H2F Z;  3JD0 A;  4U3J A;  2VRZ A;  3N27 A;  2HP8 A;  2RMK B;  1AVM A;  5JCO C;  1SQQ H;  1EBO A;  3ASO B;  2QWO B;  1I0H A;  3A0R A;  1JPX A;  2EIL B;  1BSM A;  2QM4 A;  3RVY A;  4JZG A;  5BZB A;  1NT2 B;  3RYH A;  4CH5 A;  1TVK A;  4RUF A;  1YEW A;  3W7U A;  1MA1 A;  1IBK O;  4O4I A;  2AHY A;  2FYU H;  3T1Y O;  2IBZ H;  2IJJ A;  3HR0 A;  4IIJ B;  3FB7 C;  2HVJ C;  2VQE O;  1V55 B;  3TXS A;  3WB0 A;  1P7G A;  2WPD G;  2DW4 A;  1ZAU A;  3IFX A;  4FM0 A;  4CS4 A;  1H2N A;  2UXN A;  1NTM H;  1NU1 H;  2YID A;  2RJZ A;  1AI7 A;  3RVZ A;  5BR8 B;  3OUF A;  3C3S A;  5A2Q N;  3CRR A;  4O2B B;  1NBM G;  3ETQ A;  2X6A A;  4DYL A;  5HFM A;  4DV2 B;  3RFR A;  1WPX A;  3ETE A;  4DV7 O;  2HR3 A;  1GK9 A;  4E4E A;  1WP7 A;  1E79 G;  3R66 A;  1QLE B;  4MVS A;  3J81 N;  3E86 A;  2FB5 A;  1B6Q A;  5BXZ A;  2ZDI C;  4U7N A;  5K1P A;  4UV9 A;  4QE9 A;  2ZE6 A;  1VQ4 V;  4MTF A;  2PGG A;  3UM7 A;  4K8X A;  3ABL C;  1Q7Y W;  4WFE A;  1RPO A;  1P84 F;  3STZ C;  2IW5 A;  4MSW C;  3AG4 C;  1Q43 A;  4X64 B;  1J5E B;  4DR4 O;  5H9C A;  1N0N A;  3ASO C;  4O2B A;  2Q7G A;  4QGP A;  2ZNI A;  2Y0I A;  1Q6U A;  3BPZ A;  2MW2 B;  4W4K A;  4RO2 A;  2EIL C;  1Y76 A;  2JGU A;  4YY3 O;  1ZLZ A;  2ZE5 A;  4NYK A;  3KCY A;  2YS8 A;  3APO A;  3ZS8 C;  5IYC O;  4LF5 B;  4GLX A;  2JRI A;  1G4Y B;  2MK3 A;  4NKG B;  2DQ0 A;  3SYA A;  2R9A A;  3UCS C;  3JAK B;  3O65 A;  4I4T B;  4KHP O;  3UKM A;  2H8P C;  2UXB B;  1DGS A;  1FD9 A;  4B7E A;  1BCC H;  4NXM B;  1XL4 A;  5CBH A;  2XAQ A;  4IL6 Z;  4JI6 B;  4DR7 O;  1V55 C;  5LMN B;  2RCV A;  4PDM A;  1K5Q A;  1Y4M A;  2E3C A;  3H1I H;  1SA0 B;  2O57 A;  4LFC O;  1GAX A;  4JI0 O;  2LO1 A;  4R7C A;  3OW2 U;  2IJI A;  3JYC A;  2XAJ A;  5EK0 A;  3AG7 A;  4BIU A;  3LDD A;  4XDJ A;  2EBO A;  1F4M A;  2UUC O;  2AHZ A;  4BW5 A;  4Q20 A;  3ZHU A;  2GSM B;  4HAM A;  1GRJ A;  1KKC A;  4PDV A;  3JAT A;  4OGQ B;  3A0H Z;  3JAL B;  3WG7 B;  3JAK A;  1QLE C;  2Q73 A;  3E35 A;  4I4T A;  2D3O W;  3AK1 A;  1YJN V;  4PI2 A;  4TSF G;  3BA8 A;  1BS3 A;  1PD3 A;  4Z1V A;  2A7W A;  4CBC A;  4BWA A;  1N32 B;  4JYA O;  5LP6 A;  1QVG U;  3OR7 C;  2Y4U A;  3CHX A;  1NQT A;  2P90 A;  3SJQ C;  1SA0 A;  2UUA B;  3KZI Z;  4ZOL A;  4ZBM A;  5H6Q A;  2IH3 C;  2Q4P A;  2UUB O;  4LWS A;  3B8N A;  1GM8 A;  3OE7 G;  4UB8 Z;  4X1Y B;  5EBM C;  3ZHT A;  3G71 V;  1JOY A;  3HKD A;  3OMN B;  2FKX A;  4DR6 B;  3L72 H;  4JTA B;  2P7T C;  2DYR B;  3JSL A;  3NR7 A;  4UVC A;  4JGS A;  3GWK C;  5IDJ A;  3K9A A;  4BAY A;  3CCE V;  3SYC A;  1ENV A;  1SET A;  2WA3 A;  2PF4 E;  4X1K B;  1SQF A;  5KLV H;  2X7R B;  1S5J A;  5L3F A;  4F6R B;  2KG7 B;  4PV1 B;  1UFI A;  4N21 A;  4FLV A;  4H44 B;  2CGN A;  2WLN A;  4PA3 A;  5JJN B;  3W7X A;  1N33 B;  1YSC A;  5IYZ B;  1VF7 A;  2HJF C;  1Y74 B;  1SQB H;  2JJ1 G;  4LF6 B;  4PA6 A;  1MMM A;  1FXK B;  1XUQ A;  5K1X A;  3W7W A;  2LFR A;  2WLK A;  1VEW A;  4LNU B;  3JD2 A;  3K0D A;  1EN4 A;  4DV1 O;  1YCI A;  1I5X A;  3BAA A;  3CPW U;  1HNW O;  3G6B A;  1FXV A;  3CXC U;  1NTZ H;  1HNX O;  3JAS B;  4GT1 A;  2NLJ C;  2Q7E A;  2OCC B;  4DV6 B;  5EIB C;  2UXD O;  4KP4 A;  4J41 A;  3K9S A;  3WG7 C;  3P3P A;  4X1K A;  1HNZ O;  1GN2 A;  3L71 H;  2KG7 A;  4QPK A;  3H1K H;  4I50 B;  1YHQ V;  1R1B A;  1I94 B;  3AEI A;  2WAM A;  4ABM A;  2VQF O;  1FXH A;  1I5Y A;  1SKV A;  2W0X A;  4YIP A;  1KMI Z;  1Y74 A;  1B06 A;  1DF4 A;  1FXK A;  1M90 W;  3K06 A;  4RQF A;  2W6J G;  3CP1 A;  2JK5 C;  1TUB B;  2XAS A;  2LJ2 A;  2K1E A;  5B1A B;  3OD4 A;  1XL6 A;  1K4D C;  2CH7 B;  3GWO A;  3RW0 A;  5J2T A;  3OTO B;  1QQC A;  5KX5 B;  1FOU A;  2DYR C;  2Y48 A;  1H8E G;  3HPL C;  3DSQ A;  1KP2 A;  4WFG A;  2QSA A;  4LFA B;  1K3E A;  2DJV A;  1NR1 A;  3G67 A;  1L0L H;  1QNM A;  2V7Q G;  5J9P C;  4LF4 B;  5IE9 A;  4X1I B;  4JI8 B;  3L9D A;  3OMA B;  2Q9L A;  4OXS A;  2F93 B;  3SJA C;  4FLZ A;  2JDI G;  1WLE A;  3ZRW B;  2DE0 X;  1FXK C;  3RYC B;  3RN4 A;  4J7K A;  3JCZ A;  1N36 O;  1GM9 A;  1PNL A;  3FFQ A;  4DW1 A;  1M9N A;  1D5N A;  3HB3 B;  4DR1 B;  3P3N A;  2EIM B;  5J2U B;  2CH7 A;  1H2L A;  1SZT A;  2CTQ A;  4GZR B;  2OCC C;  1D2D A;  4ZI7 B;  3E22 B;  3CXH F;  2EIN B;  3CWB H;  2L35 A;  4DK0 A;  5CB4 B;  4TT3 G;  3K5N A;  3AK2 A;  3IC9 A;  3U10 A;  2C2A A;  4JYB A;  4DXW A;  2ODM A;  3CS5 A;  2LGW A;  5C8Y A;  1XNQ O;  4X1I A;  4PA7 A;  1H2G A;  2RN9 A;  4JI1 B;  4R8C A;  2OTL V;  4MVQ A;  2FML A;  3ZRW A;  5DN6 G;  3X2Q B;  3H1J H;  3I56 V;  4GX5 A;  1OZ0 A;  4IGG A;  1HP8 A;  4LF7 O;  1NTK H;  4YHH O;  5AG2 A;  4DK1 A;  4UCR A;  3B77 A;  3JCU Z;  5J2U A;  1BQZ A;  2YIA A;  4NXN O;  4WF9 V;  4TV9 B;  1BT8 A;  4ZI7 A;  5E1A C;  3E22 A;  5KHK A;  1M4U A;  1JNB A;  1RM1 B;  1XHZ A;  4B3T B;  4DV3 B;  4FLX A;  1SQG A;  3TJT A;  4JYC A;  5KUK A;  3BY6 A;  4H13 B;  3DXR B;  3SYP A;  5KUM A;  1URF A;  1MAB G;  3HKB A;  1AJQ A;  4NTY A;  3WB2 A;  5KHI A;  3CRQ A;  3DTU B;  4P30 A;  4X64 O;  3B4S A;  4FM1 A;  4MT8 A;  1WB8 A;  4X65 B;  1S5L Z;  2ZIM A;  3CYO A;  1ZX3 A;  4JI5 O;  2ZIN A;  2EIM C;  4XDK A;  4NR1 A;  2IJK A;  2ATK C;  4JF3 A;  1MZF A;  4WCE V;  4OX9 B;  2X6C A;  4JV5 O;  3SJB C;  2GTA A;  1IXM A;  2LGQ A;  3T1C A;  2UXB O;  3AG1 B;  4NXM O;  2ETN A;  1JQ0 A;  3JAM N;  3MHS C;  2F95 B;  3QO7 A;  4DUY B;  3FB5 C;  4JI6 O;  3JSN A;  4FM2 A;  5LMN O;  1I08 A;  5EC2 C;  1WP8 A;  3GVM A;  1BGY H;  3TGU H;  3W7T A;  4JI2 B;  2YIB A;  5EBW C;  3E2E A;  1YJ9 V;  2A3Q A;  1JJ2 U;  4JI7 B;  1Z5V A;  2FL4 A;  5LGN A;  3X2Q C;  2QWQ B;  3RYH B;  3D3I A;  5LHI A;  2Q68 A;  1ROP A;  3TET A;  1TVK B;  1R3I C;  1OHH G;  2N04 A;  2W6I G;  2QM8 A;  4R6Z A;  3VQX A;  2JEX A;  1VQM V;  3ABM B;  1CXZ B;  1RM1 C;  1ZTE A;  4JTD B;  1YI2 V;  1N32 O;  3BAB A;  1SZX A;  1HDJ A;  1LNQ A;  2Y69 B;  2OIG A;  4MVZ A;  5IJ9 B;  2UUA O;  3CCM V;  5KMG B;  4XDL A;  2HG5 C;  4DR2 O;  1G1X B;  5B3S B;  2NN4 A;  3H9V A;  1YDX A;  1GN6 A;  1BHA A;  3C90 A;  4DR6 O;  4D7S A;  1WNS A;  3T1H O;  1OJH A;  1VQ7 V;  2WLL B;  3OEH G;  1RSO B;  4YJ3 A;  4B08 A;  2QEX V;  2F1M A;  3M7M X;  3ZMV A;  3AG1 C;  3CCQ V;  1DK1 A;  4W4L A;  4UCO A;  4CC6 A;  1S72 V;  4KL1 A;  2EUL A;  5B5E Z;  1PPJ H;  3U0Z A;  1LUV A;  1YZB A;  2L6L A;  3QG5 A;  2GV9 A;  2CAZ C;  1N33 O;  2V1D A;  4UFZ A;  3U11 A;  5IJ9 A;  1VAR A;  1X59 A;  4LF6 O;  5KMG A;  4UCU A;  1Y76 B;  3FB8 C;  4LC1 A;  4UV8 A;  4GKK B;  3D3Q A;  1NH2 B;  2GBO A;  5LYJ A;  1B3Q A;  3SYO A;  1NR7 A;  2Q7H A;  1GH6 A;  2ADP A;  5B1B B;  4DV5 B;  4GCZ A;  2YXH A;  4MVR A;  1PM9 A;  1G6U A;  3AG2 C;  4DV6 O;  3M8A A;  3K3W A;  2WLL A;  4B3S B;  1RSO A;  1KP3 A;  2DWD C;  3ABM C;  3AG3 B;  3DC6 A;  3HKE B;  4OPH A;  1R3J C;  3MDS A;  1Z2G A;  1IDS A;  1P49 A;  3B40 A;  1NS1 A;  1I94 O;  2IU3 A;  3ZRV A;  1VF5 B;  3Q4H B;  2ZIO A;  1KB9 F;  3RYI A;  5CBG A;  4F6E A;  2Y69 C;  4K0K B;  5CA1 B;  1YVW A;  1WPB A;  5L3G A;  3EFF K;  1V9P A;  3ZN1 A;  1SC5 B;  5JH7 A;  3ZCC A;  3JAT B;  5JVD A;  3ZX6 A;  3RGB A;  2JGD B;  2QGN A;  2Q5Z A;  3ZRX A;  1FFT B;  3OTO O;  2Q67 A;  1VQO V;  3IJ4 A;  4A5U B;  2Y0P A;  5BMV B;  3F7Y C;  4PA4 A;  3N2K A;  2ZR3 A;  1KQS U;  4PI0 A;  5LP6 B;  5CN0 A;  2CE4 A;  3CB2 A;  3HKE A;  4EFE A;  4FMT A;  3UT5 B;  3CCU V;  4N23 A;  4LFA O;  4ZOL B;  4MVO A;  3OGI B;  4LWS B;  3Q4H A;  3ZMU A;  1LUW A;  5L3E A;  2EZO A;  2KKW A;  5KA5 A;  5A9G A;  4X89 A;  2CTW A;  5CA1 A;  1XEQ A;  4TV8 A;  3S3W A;  4EEQ A;  5H6R A;  5B1N A;  3HKD B;  5FPR A;  4FZ1 A;  4DUZ B;  1LR1 A;  2GHY A;  4I9Q A;  1GM7 A;  2ZNJ A;  2D2C B;  2JGD A;  4KUM A;  3CCV V;  4EB6 A;  2LW1 A;  5B1B C;  3CCS V;  3CCL V;  4E2L A;  1R3L C;  5BMV A;  4GKJ B;  4LF8 B;  2LQT A;  1J95 A;  4UXN A;  5LMU B;  3P30 A;  4UB6 Z;  2E5L B;  4MVM A;  4WFA V;  4ZHQ A;  1K33 A;  3AG3 C;  1CP9 A;  2Q69 A;  3LDC A;  3UT5 A;  4BR6 A;  1KU9 A;  3ZN0 A;  1M5I A;  4K35 A;  4O4L B;  3JD4 A;  4FJC C;  2YI9 A;  4O4J B;  2WLH A;  1K92 A;  5EYP B;  2WSS G;  1CPY A;  1MSD A;  2AGA A;  1SS3 A;  2V4D A;  3E8B A;  3SDL A;  3B2E E;  3I5D A;  2F4V B;  1IBM B;  1WB7 A;  2H94 A;  4K3A A;  1COW G;  2HLD G;  2JEU A;  2OT5 A;  2DWE C;  1Q6I A;  3CX5 F;  1IVS A;  4FLT A;  5L3B A;  2YI8 A;  3E89 A;  3A8T A;  3OFN G;  2R72 A;  2XOK G;  4B3R B;  1AR4 A;  2RNB A;  1XIL A;  2E75 B;  4HZ3 A;  1FJG B;  2OCH A;  5LP6 C;  4B3T O;  4DV3 O;  2P5O A;  4DR5 B;  3F5T A;  3K08 A;  1K4C C;  4O4L A;  2CDY A;  3SJC C;  1TUE B;  4YJ2 A;  1YJW V;  4O4J A;  5EYP A;  3CCR V;  1AP6 A;  4EFB A;  1SER A;  1PNK A;  3UO2 A;  5FPO A;  4IT5 A;  1KYO F;  1K97 A;  3B09 A;  5J2T B;  1K5S A;  2P67 A;  2XND G;  4H33 A;  3ETD A;  4FFB B;  1EFR G;  1XBL A;  3FB6 C;  2ZXW B;  1AR1 B;  1FYJ A;  1PP9 H;  2KQX A;  4AQY O;  2UXC O;  3ZRS A;  4G28 B;  2WLJ A;  3CSX A;  4OX9 O;  4QPJ A;  4DV0 B;  2F23 A;  4NTX A;  2GDS A;  1E1R G;  2P4V A;  3KKY A;  1H5W A;  5GON B;  5DEC A;  2IM9 A;  2P6J A;  1Q5O A;  3O9O A;  2VWJ A;  1QU7 A;  4DUY O;  2CK3 G;  2ITD C;  3VBB A;  3W7S A;  5L3C A;  4MS2 A;  1K7D A;  4D6T H;  2UU9 B;  3MD0 A;  1K9M W;  4JI2 O;  1PL4 A;  3F7V C;  3E8F A;  2ZM6 O;  5LGU A;  3N2G B;  4JI7 O;  4R50 A;  4PD4 F;  2YEV A;  5GW7 A;  4IHJ A;  4FFB A;  2DYS B;  3J7A U;  3CC2 V;  2HJD A;  1HR0 O;  4YY3 B;  4X66 B;  3L70 H;  3FX7 A;  1ZWI C;  3K04 A;  4X62 B;  2GTS A;  1VQ5 V;  1Q8I A;  4JPR A;  1IX9 A;  1XDC A;  2OYQ A;  1R6N A;  5C8Y B;  5GON A;  4CS3 A;  1KEC A;  2ZQM A;  4BIZ A;  2HVK C;  4X9Q A;  4NVP A;  2R9I A;  3ML0 A;  1OCR B;  1N4C A;  3LUT B;  4JI4 B;  3OTF A;  2NNU A;  1YTF D;  4LFC B;  1FFX B;  5EC1 C;  3L73 H;  2QJ1 A;  3A0B Z;  3N2G A;  4Z2W A;  2DN9 A;  1U97 A;  1H8H G;  3FAV A;  4JAU A;  5JJJ B;  4GYC B;  3BCC H;  4B3M B;  1BQ0 A;  2GUZ A;  1G8M A;  2ZXW C;  5FLX N;  1OCZ B;  1S3J A;  1N0J A;  4O4H B;  4WFB V;  2N74 A;  3K57 A;  5KA6 A;  5LA6 B;  5ITZ A;  4ZKI A;  1NVP D;  4DW0 A;  1H2K A;  3HKB B;  1S5H C;  5LHH A;  1XNR B;  3EXA A;  2QDO A;  5BR8 O;  1FFX A;  1VQ8 V;  1SF9 A;  4WBN B;  1QLN A;  3ETG A;  2B1I A;  4F4L A;  4DRX A;  1XI1 A;  2ARH A;  5B1A C;  3DGE A;  1L0N H;  4DV2 O;  4GKK O;  2EIK B;  1W0K G;  2VWK A;  1THZ A;  2XAF A;  4I55 B;  2IJH A;  2RQ6 A;  4UUJ C;  2ZCE A;  3E8H A;  3A2F A;  5KAF Z;  1XMQ B;  4GUN A;  4DV5 O;  4FLW A;  3OT7 A;  4O4H A;  5LHG A;  5CMU A;  2JS5 A;  4FIP C;  3FYI B;  5E79 Z;  4H0L B;  4B3S O;  1TA8 A;  3BFR A;  4J80 A;  4MVU A;  2A79 B;  3QVN A;  1RFY A;  5LA6 A;  3ZHQ A;  1Q81 W;  3H1L H;  3KG2 A;  4TQD A;  1DLB A;  3OM3 B;  4JI3 B;  3SPH A;  3WB1 A;  5KHG A;  4PA9 A;  4LCU C;  4DR3 B;  1XQ8 A;  1OCR C;  4J7Z A;  2WLI A;  1R6K A;  2Z0A A;  4Z1M G;  2IU0 A;  3K5M A;  1J5E O;  2B5U A;  2BOB C;  2LP7 A;  1KC8 W;  5HFL A;  4K0K O;  4WBN A;  4G2K A;  2G38 A;  2BTQ A;  4RAI A;  4AHC A;  2PYL A;  1BZK A;  4DV1 B;  3CD6 V;  4EKW A;  4LF5 O;  5LGT A;  4TOI A;  5H5N A;  1K34 A;  1N34 B;  4I55 A;  2BE3 A;  1S77 D;  1L1F A;  4J7J A;  2EIN C;  1OCZ C;  3QO8 A;  4LR3 A;  1VF6 A;  3JAR A;  3C3T A;  3R65 A;  1W2B U;  3LSS A;  4X20 A;  1IJG A;  3ASN B;  1Q86 W;  1HNZ B;  2Z3Y A;  3H01 A;  1HW7 A;  1TGO A;  4JTC B;  4GX1 A;  2HFE C;  3SPJ A;  1BL8 A;  2ZT9 B;  1PNM A;  1Y6X A;  1GTO A;  2VQF B;  2PZS A;  3UO3 A;  2ZKO A;  3I55 V;  5IYB O;  2OIE A;  3LNM B;  1F7Y A;  2PYJ A;  4L8J A;  3JD1 A;  1WN7 A;  4GX2 A;  2JS3 A;  4ZIB A;  1E1Q G;  4CS2 A;  5JCO A;  4B7K A;  4KFM A;  3G6E V;  4DUZ O;  1UPG A;  2EIK C;  1AI4 A;  3K0G A;  2EJR A;  3KDR A;  4IYI A;  1VMG A;  3ICX A;  3PN1 A;  4YJ3 B;  1U96 A;  3LDE A;  5C93 A;  4GKJ O;  2YXY A;  4LF8 O;  3H1H H;  2M7W A;  1R6T A;  2YUA A;  5LMU O;  1VQ9 V;  5KHH A;  2XAG A;  1R3K C;  2FTK A;  3QF7 A;  2IH1 C;  5GTH Z;  1AB3 A;  5FNV B;  2W0F C;  5EZY B;  5LYJ B;  3D8C A;  2HHH B;  2F4V O;  3AG4 B;  5IWA B;  1R73 A;  1NI8 A;  1IBM O;  3LSQ A;  1N36 B;  1RP3 B;  1BE3 H;  1KKD A;  4JYY A;  1Y67 A;  1S0V A;  4ICG A;  4MW3 A;  2QR4 A;  1XMO B;  4FK5 C;  3SYQ A;  4HBN A;  1QCE A;  1ARO P;  1Q90 D;  5L3D A;  1JVM A;  4J42 A;  4B3R O;  3T4Z A;  4FLY A;  1M1K W;  3ASN C;  1SQP H;  2M6Y A;  1FJG O;  3ABT A;  3RYI B;  1IBL B;  2ZDI A;  4DR5 O;  1IZ3 A;  2BCC H;  3STL C;  4RUE A;  2OWO A;  4MTO A;  3ABU A;  5LXT A;  2RDC A;  1B04 A;  1XNQ B;  2BSK B;  4BIO A;  5JH7 B;  5FNV A;  3ZHV A;  3DC5 A;  4AIL C;  1FKA O;  4RWU A;  5B1O A;  5JVD B;  4DV4 B;  5EZY A;  1JFF B;  4FFK A;  1VQP V;  1SES A;  3ZHR A;  3L74 H;  4LF7 B;  3K03 A;  4YHH B;  3N2K B;  1N8R W;  2QKC A;  1X4T A;  4NXN B;  3G80 A;  4UVB A;  1JX9 A;  3OGC C;  4DV0 O;  4C7U A;  1NZ6 A;  2YIC A;  2CTR A;  1F51 A;  2DOS A;  2AZ0 A;  4P9P A;  1H38 A;  1GN4 A;  3K5O A;  2XHB A;  4IIJ A;  4J10 A;  2A06 H;  4TV8 B;  1FS0 G;  1KUQ A;  2EIJ B;  2N05 A;  3CE2 A;  2BSK A;  1WAZ A;  4J9Y B;  3EVK A;  1XRE A;  2VS0 A;  4LH6 A;  4TQF A;  5B3S C;  4CH3 A;  2UU9 O;  1W0J G;  4FPP A;  1JFF A;  3QNE A;  4OPA A;  4EB6 B;  1NH2 D;  4LP8 A;  3BEH A;  2A9H A;  4JI5 B;  4X66 O;  1DF5 A;  4UCS A;  4NB5 A;  4X62 O;  3ABK B;  4ZHQ B;  2P22 C;  4JV5 B;  4TUY B;  2R9R B;  4J9Z B;  4U3F H;  1XOU A;  1P7B A;  1Q6H A;  1MZE A;  1FAF A;  3SGI A;  3OEE G;  4LF4 O;  4NTW A;  1YIJ V;  4FZ0 A;  1HWY A;  4JI8 O;  2X0L A;  2QKA A;  1ZUQ A;  3MHH C;  2Z5U A;  4JI4 O;  2WWW A;  4KXR A;  4CH6 A;  1Z5W A;  4LF9 B;  4H37 A;  3CMA V;  1Q3E A;  4JAA A;  2LW7 A;  3TK1 A;  5IY5 B;  2CUG A;  2QWP B;  4DR1 O;  3CRM A;  3ZBH A;  2QWR B;  3RT3 C;  4B3M O;  2WLM A;  2K9P A;  1EZV H;  2AZ2 A;  4LFB B;  3BA9 A;  3ZED A;  4TUY A;  1H2S B;  1F23 A;  1PKX A;  4YJ2 B;  4PHZ A;  2A0L A;  2X6B A;  5BY1 A;  1M56 B;  3G4S V;  3TXQ A;  1XNR O;  2DQ3 A;  4JI1 O;  2EIJ C;  3E8G A;  2XAH A;  3SPI A;  3F5W C;  3GB7 C;  4LH7 A;  3J80 N;  2JVD A;  4DR2 B;  2XT9 A;  3SPC A;  4D7T A;  3CC4 V;  5FL7 G;  3AK3 A;  2ITC C;  5EIB D;  5F2V O;  2ILM A;  3IAY A;  4YIO A;  3T1H B;  1A32 A;  4MTX A;  4WFF A;  4I0X B;  1XMQ O;  1IBK B;  5CBF A;  3ABK C;  3T1Y B;  1GN3 A;  2Y4T A;  5IJ0 B;  3JAL A;  2VQE B;  5JJE B;  2B1G A;  3CEI A;  2PUS A;  1QHT A;  4XBF A;  4CZZ A;  4RQE A;  1OV9 A;  1VQN V;  1RPR A;  2CGO A;  4JI3 O;  2KSD A;  3VOU A;  2CTP A;  4DR3 O;  4TWK A;  3BRC A;  5LL6 Y;  4HYO A;  1JMK C;  2JJ2 G;  2YEV B;  1OCC B;  2B9Z A;  3RWR D;  1TAE A;  4IHJ B;  4X65 O;  3T2M A;  2ADQ B;  2YSU B;  4DV7 B;  5IY5 C;  4PDR A;  1QBZ A;  2E76 B;  3JAW B;  1YF2 A;  4X1Y A;  5IYD O;  2XTA A;  3LNN A;  1N34 O;  4CH4 A;  3T4D A;  2JIZ G;  4I0X A;  2YDE A;  5LBQ A;  1ORQ C;  1IUR A;  5IJ0 A;  3FD9 A;  1AP5 A;  2QWN B;  1MSW D;  4F6R A;  3K79 A;  5IT9 N;  1M56 C;  2LFS A;  1YTF B;  4DR4 B;  5IYZ A;  3FAV B;  2EX3 A;  1JCH A;  2GUZ B;  3RBZ A;  2P06 A;  4I9W A;  3SR2 C;  4O2A B;  2PI4 A;  3IGA C;  5B66 Z;  3APQ A;  3OMI B;  4LNU A;  3CME V;  4MTG A;  3JAW A;  2Q8V A;  1WJZ A;  1GO3 F;  4KHP B;  3WFV A;  1Y66 A;  4PJ0 Z;  5ITZ B;  4K8Z A;  2KB1 A;  3JAS A;  1FPO A;  4PEL A;  4FVM A;  3MAQ A;  3M99 B;  4DR7 B;  5CA3 A;  2PTM A;  4UCT A;  4IYH A;  1NVP B;  4QE7 A;  3FYE B;  1AI5 A;  3IC7 A;  4ASU G;  4JI0 B;  1EZJ A;  4I50 A;  1BMF G;  4JAS A;  4DRX B;  1DTO A;  1SQV H;  4QNH B;  4CC5 A;  4QIW F;  1M57 B;  1ZL8 B;  3K58 A;  2EZP A; 
#chains in the Genus database with same CATH homology
 1BSM A;  1ZLZ A;  1BT8 A;  3DC6 A;  1ZTE A;  4JZG A;  3DC5 A;  3MDS A;  2AW9 A;  4BR6 A;  1IDS A;  2ADQ B;  3TJT A;  4FFK A;  1SZX A;  1MA1 A;  1JA8 A;  1PL4 A;  4F6E A;  1MSD A;  1QNM A;  1WB7 A;  3KDR A;  1EM1 A;  1P7G A;  2P4K A;  2RCV A;  2QKC A;  1MMM A;  1XUQ A;  4GUN A;  3RN4 A;  1GN6 A;  3OT7 A;  1AP5 A;  1WB8 A;  4C7U A;  1VEW A;  1EN4 A;  1IX9 A;  1XDC A;  3C3S A;  1GN4 A;  3BFR A;  3QVN A;  1D5N A;  1AR4 A;  1JR9 A;  1XIL A;  1AR5 A;  4JZ2 A;  4X9Q A;  3LSU A;  2CE4 A;  1KKC A;  4E4E A;  1EN6 A;  3EVK A;  1XRE A;  3K9S A;  3AK2 A;  2CDY A;  3IC9 A;  3AK1 A;  1GN2 A;  1LUV A;  1LUW A;  1BS3 A;  1AP6 A;  3AK3 A;  1I08 A;  4JYY A;  5A9G A;  1Y67 A;  1IXB A;  4YIO A;  1VAR A;  4YIP A;  1GN3 A;  1MNG A;  1EN5 A;  1B06 A;  3C3T A;  1N0J A;  3CEI A;  1ZSP A;  2ADP A;  1AVM A;  1N0N A;  5AG2 A;  2GDS A;  3KKY A;  1PM9 A;  2QKA A;  1ZUQ A;  1I0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...