3AK2A

Superoxide dismutase from aeropyrum pernix k1, mn-bound form
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
211
structure length
211
Chain Sequence
MVSFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAVMRDFSFNYAGHIMHTIFWPNMAPPGKGGGTPGGRVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDPLTEELRILQVEKHNVLMTAGLVPILVIDVWEHAYYLQYKNDRGSYVENWWNVVNWDDVEKRLEQALNNAKPLYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 - insights into the enzyme mechanism and stability
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn/Fe]
total genus 72
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ak2A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ak2A02
1IDSA 3DC5A 1MMMA 5A9GA 2ADPA 1MA1A 4GUNA 4F6EA 3OT7A 1MNGA 4E4EA 1WB7A 1ZUQA 2P4KA 3K9SA 3TJTA 1BT8A 4JZGA 1JR9A 4YIOA 4BR6A 3QVNA 4JYYA 1ZTEA 1XREA 1GN2A 1D5NA 3BFRA 1AP5A 1B06A 1GN4A 1IXBA 1BSMA 1KKCA 2QKCA 3C3SA 1VARA 3LSUA 2ADQB 1ZLZA 1EN6A 2QKAA 1EN5A 1AR5A 1AR4A 3EVKA 1I08A 1IX9A 3AK3A 4X9QA 1MSDA 2GDSA 3CEIA 1LUVA 4FFKA 1XILA 1EM1A 4JZ2A 4C7UA 2RCVA 1PL4A 1EN4A 4YIPA 3DC6A 1JA8A 1Y67A 1N0NA 3C3TA 1XUQA 1PM9A 1GN6A 2CDYA 1XDCA 3AK1A 3IC9A 1GN3A 3RN4A 1LUWA 1QNMA 1P7GA 1WB8A 1I0HA 1AVMA 3KKYA 5AG2A 1AP6A 1SZXA 1N0JA 1BS3A 1VEWA 2CE4A 1ZSPA 2AW9A 3AK2A 3MDSA
chains in the Genus database with same CATH superfamily
2Q4PA 2E3CA 3ZMSA 4QJFB 2X0LA 1TUEB 1FYJA 2A3QA 1TVKA 1VIBA 4NKGB 3CCVV 3RYHA 3CD6V 4X65O 2A0LA 4UFZA 1O9HA 2W6IG 2HVJC 1FKAO 3EFFK 1N32B 4AILC 4BR6A 1FXKC 3JAKA 4UV8A 4RUEA 3CX5F 4XDKA 4O4HB 1FAFA 3BFRA 1VQKV 3P3NA 5KHGA 1CP9A 3JSNA 1G6UA 4J41A 2XASA 2PF4E 1Z2GA 4PA3A 2W0XA 2ITCC 4ZI7B 3SYAA 3A2FA 2DJVA 2HP8A 3DXRA 4DV2O 5FPOA 3RYFB 1E1RG 4G28B 4XDJA 3I5DA 5LMNB 4DV4O 4FLZA 3ABUA 4FZ0A 1GAXA 5FNVB 4YXWG 3HKDA 4L87A 2BCCH 3OGCC 1YSCA 4Z1MG 1I94O 1K92A 4DR4B 4CS4A 3B8MA 3THOA 1YJNV 2Y4UA 4ZI7A 1IURA 2ZCEA 3K0DA 2EZPA 1PNMA 5IWAB 1GN3A 2LO1A 2OCHA 3K5NA 4JYAO 5HFMA 2EIJB 5CA0A 3MD0A 1AVMA 4RUFA 1NI8A 2B1GA 3E86A 3ETDA 1AP6A 3R66A 2A7WA 4O4LB 4EFEA 1BS3A 1SQXH 2WWWA 5D5QA 4G2KA 3IJ4A 1AJQA 3ASNB 4MVMA 4O2BB 5DECA 3W7SA 4JAVA 3RYHB 2YUAA 3JAWA 3OT7A 4NR1A 4WCEV 5BR8B 1V55B 3FB5C 2OTJV 3E8GA 4DV5O 1I94B 5KA5A 3LNMB 3ABLC 2HHHB 1Y74A 2X7RB 1JMKC 5KUKA 1HNWB 2HVKC 1K33A 1XREA 3VQVA 3QF7A 3OGIB 4K8XA 1DK1A 1VQ8V 1V54B 3G71V 4IIJB 3QTCA 1BSMA 2EIJC 2WLIA 1N36O 4DO2A 3LSUA 5IE9A 1RM1B 2VQEO 2IBZH 3H1JH 1OCOC 1S5LZ 1UJWB 1SETA 5LOVB 1M4UA 3K58A 1IBLO 3G67A 4HNAA 4ASUG 2JS5A 4QGPA 4GKKB 1XOUA 4UV9A 2JGUA 3BABA 1OV9A 4H37A 2E5LO 4DRXB 3F5WC 5L3GA 4J9YB 4TV9A 1HNWO 2NR5A 2YDEA 1U97A 2ETNA 1YTFB 3JARB 4B7EA 3CMEV 4JPRA 5GTIZ 2F23A 3CRMA 1EZVH 1YJWV 2PUSA 5BMVB 3H9VA 4X1YA 2P22C 3KKYA 2PYLA 1M56C 3WB1A 3IFXA 3NR7A 3ZHUA 2IJJA 2AGAA 5LGUA 1H2MA 2HFEC 4TV8B 1FXKA 4MVRA 4IHJA 3OMIB 2ZIMA 3JAMN 1TUBA 5BXZA 3N2KB 4DR2B 1KKDA 2ZNIA 1WPXA 1ZUQA 3K9SA 2ZT9B 1FD9A 1HNZB 2EINC 2XTAA 3DXRB 2ZIOA 1KP2A 3L73H 4DV1B 5BY1A 1I7FA 4FFBA 2QKSA 4EB6B 3SPJA 3LNNA 1JJ2U 2B9ZA 1MZFA 1HR0B 2DYSB 5LGNA 2H3OA 5IJ0B 1W59A 1V55C 4DW1A 3OMNB 4UVAA 3K03A 2MK3A 1EN5A 3OEHG 4IYIA 4J11A 5J2UB 3JATA 4CH3A 4Z1VA 3LDDA 4GYCB 3SPCA 4NTYA 1SF9A 4OX9O 4DK1A 3OE7G 2C2AA 3OFNG 4FJCC 2LQTA 1B6QA 1M1KW 1XUQA 1YI2V 2WLKA 2QM7A 3H1HH 2EINB 2WLLA 1OJHA 4KXRA 1FJGO 1QBZA 3TGUH 4PDLA 2ZXWB 3B2EE 1HR0O 2AHZA 3AG1C 5LP6C 1WB8A 4NXNO 1NVPB 1KB9F 4J7JA 4UCOA 3KG2A 2D2CB 3BVOA 1EBOA 1FS0G 1XQ8A 2KQXA 2CE4A 4DK0A 2BOBC 4YHHB 2P67A 1JNBA 1BZKA 4TUYA 5JJNB 1BCCH 3N2KA 4DR7B 4W4LA 1MA1A 1M9NA 3ZRVA 1QLNA 2P6JA 4K8ZA 1QR8A 3JD2A 4DR5B 4O4IB 4JV5O 3FD9A 1G8MA 2RJZA 2CUGA 2P4KA 4HYOA 4LF5B 5KAIZ 4JASA 3ZHSA 4ZKIA 4JYYA 4MTFA 5H6RA 4WF9V 1YDXA 4FM1A 4D6TH 4JI4O 4I0XB 4FLXA 5J2TB 4OPHA 1VQMV 2EIMB 2VWJA 1ZAUA 4LFAB 3PN1A 3M8AA 2CH7B 1HP8A 1MOFA 3QO7A 1XBLA 1Q6IA 2JGDA 3HR0A 3W7WA 3CRCA 3D8CA 4MVOA 3DSQA 1TAEA 5DN6G 1KU9A 1AI5A 2ZR3A 4P9PA 2AZ2A 1PKXA 3JASB 4DR7O 1T5EA 1Q5OA 4C7UA 4JZ2A 4MS2A 2UUCO 3JALB 2ODMA 3CCSV 4JAUA 4X65B 4LF5O 4F6RA 4L8JA 4KP4A 1XMOB 2UUBO 4HBNA 1NR1A 4DYLA 2QE7G 5K1XA 4N21A 3QG5A 1CXZB 1IBMO 1KECA 4PELA 2N04A 4ICGA 2ZE8A 2AHYA 1HNXO 2E75B 1GM9A 3PJSK 3G80A 4O4JB 4PJ0Z 3E8BA 1AI6A 4LWSA 4O2AA 2M6YA 1F51A 1R6TA 3CPWU 1VMGA 3ABMB 3CS5A 1P84F 1PV0A 3K3WA 2YI8A 1VF5B 2IM9A 2QWNB 2ZE7A 4AHCA 2OT5A 3HKBB 4RWUA 5EBLC 1RPOA 4JI5O 4MTXA 1NU1H 2NN4A 1FFXA 2RN9A 4LFCO 5LHHA 2YIAA 4LFBO 3TCUA 4TT3G 4YIOA 5H6QA 1BGYH 4CS3A 1R1BA 1ZTEA 2BOCC 3F7YC 3K5OA 1SQGA 2EULA 3AG1B 5LP6B 4LF4O 2Q5ZA 1BHAA 1FFXB 1GN4A 2LGWA 2K9PA 2OIGA 1UPGA 1X59A 1H2LA 3J7AU 5CA1A 1S5HC 2LFSA 1FXKB 2AXTZ 4YJ3A 4UVCA 5KHKA 5LA6B 2ZDIA 1N8RW 4MSWC 2GDSA 4F4LA 5J9PC 3B40A 1RSOA 2PI4A 2X6CA 5J2TA 4JI5B 1SRYA 4X20A 2YEVB 5EK0A 5LYJA 1JFFB 4TV9B 2CK3G 1PM9A 2HR3A 4UB6Z 3GWKC 2QM8A 1VQ7V 4IHJB 4YY3B 1RM1C 2PGGA 5JVDA 3G6BA 4TSFG 2Q7GA 4UCSA 5TISZ 3AG3B 3R65A 1UFIA 3T1YB 4X88A 3SPGA 4XBFA 4KL1A 1Q8IA 4GX1A 4HNAB 1GTOA 1VF6A 1J5EO 2PZSA 4IYHA 4O2AB 5L3EA 5GTHZ 3ABTA 5B1OA 1YXBA 2UXDO 3SYPA 1QVFU 2MW2B 1KYOF 2H94A 1N33O 1KMIZ 3UT5B 2LJ2A 1Q7YW 1IDSA 5B1BC 3L9DA 1SC5B 1Y6XA 2DYSC 1R3KC 1RFYA 1N34O 4PV1B 2Y0IA 3RVZA 1J95A 5IJ9A 2ZQMA 5EC1C 4KHPB 1FXHA 3E8FA 3CRAA 1YIJV 1V9PA 2BE3A 4DUYO 1S5JA 3IAYA 3OUSA 4I0XA 4I9QA 3G4SV 4BIOA 5JJEB 1MSWD 2GBOA 3RW0A 1PPJH 1U96A 1NBMG 1B06A 4X1IA 4UCVA 2JJ2G 3CMAV 4IGGA 3K08A 4MVQA 2QA4V 3BA8A 2XT9A 4LNUA 2ADQB 3OW2U 4X64O 4GZRB 1IX9A 1BL8A 2P7TC 2R9IA 5IY5C 3ABMC 4CBCA 3ZHRA 5C8YA 3SJCC 1W2BU 3FX7A 2ZD9A 4FFKA 3OM3B 4EB6A 4KHPO 2XAJA 1Y66A 3UKMA 4K3AA 3G6EV 3HKCB 1M57B 2WPDG 1BE3H 4DRXA 5CA1B 5JJJB 3ZRXA 1THZA 1D5AA 1NR7A 2QM4A 1OCRB 3O9OA 4ZHQB 2Q7HA 4O2BA 3OEEG 2P5OA 2BSKA 2CDYA 1Q81W 4DV1O 4W4KA 1GMGA 1MZEA 1XNRB 3APOA 3OR6C 1LUWA 3RBZA 5LA6A 3WG7C 2QTOA 2YEVA 3SJQC 3WB2A 4I55A 3SYOA 2ZNJA 2F4VO 4CS2A 2DYRC 1SZXA 1N0JA 3VQWA 1AJPA 5B5EZ 2VRZA 2LW1A 4X64B 2L6LA 3UT5A 3RFRA 2JRIA 2A06H 1K5SA 3GVMA 4JI0B 2PTMA 3ZMUA 1US6A 4OX9B 2QSAA 3ZMVA 1R3IC 1NTKH 5FNVA 1AROP 4X62B 4FLTA 1E1QG 1K7DA 2EIKC 2WLLB 1VF7A 4JI3B 1OCRC 1SA0B 2P90A 4RQFA 1R3JC 1XNRO 3BY6A 2Z3YA 1K73W 1VP7A 4FMTA 2R70A 5LYJB 5EBWC 1H2NA 2OIEA 5LOVA 4J9ZB 4DR3O 1VARA 2Q9LA 2IU0A 1NT2B 1EN6A 4O4JA 3JD3A 2Q0AA 3LDCA 3P32A 4OPAA 5IWAO 1K3EA 3E35A 1M90W 1IVSA 1E79G 1Z5VA 4YIPA 4MT8A 3JD0A 1JA8A 4Q6GA 4X62O 2DW4A 1MG1A 2WAMA 2ZM6O 1X4TA 2YXHA 4B3RO 1N4CA 3ZJZA 2FB5A 4GCZA 5B3SB 4QNHB 4GX0A 3T1HO 3FKSG 3W7TA 5KUMA 3CCQV 3WFVA 3ZRWB 1WLEA 5BR8O 4LBEC 1VQPV 4JI1B 2HLDG 3X2QB 3DTUB 1P7GA 1PNLA 2YIDA 2KG7A 3CHXA 3HPLC 3S3WA 4PA9A 3FB7C 2JDIG 3D3IA 4UXNA 3K9AA 5B3SC 3UCSC 2ZE6A 4P9OA 4JTDB 3CC7V 3RYIB 1VQOV 1S3JA 3APQA 4I55B 4TUYB 2GTAA 3AG2C 4JYBA 1BHBA 3OTFA 2F93B 1FOUA 4LNUB 4QIWF 2ZM6B 4IIJA 1DLBA 3TJTA 3D36A 4MW8A 1GRJA 2LP7A 4PD4F 2Y48A 2F43G 3OR7C 3BPZA 2IW5A 2Q7EA 3B8NA 5L3CA 1Y4MA 2P06A 1SA0A 5H5NA 4JI1O 4B3SO 1YTFD 4J7ZA 2JVDA 1ZWIC 2DOSA 4E2LA 4R6ZA 3CCLV 3RVYA 1KKCA 2E5LB 3T1CA 4BAYA 3STLC 1ZLZA 2HHHO 3OUFA 2GTSA 5IYBO 3KDRA 4UB8Z 1K4DC 1H8EG 2IJIA 1S72V 3ICXA 3JD4A 3L72H 2DQ0A 3WG7B 2R9RB 4NTWA 1ZL8B 2WA4A 1AJNA 1A32A 3H1IH 4MW3A 2V7QG 1N0NA 3L70H 5JH7B 3IC7A 2CH7A 1KP3A 5LMUO 5IYDO 3CRRA 3H1LH 1XDCA 2D3OW 1JPXA 4X66B 5DEDA 2UXBB 4BIUA 2NLJC 4DR2O 1IXMA 4B3SB 3RWRD 2KG7B 2YICA 4O4IA 4QE9A 2FKXA 1I0HA 4P30A 3HKEB 3VQYA 4JTCB 1JJOA 1JCHA 2ZDIC 4XDLA 3TK1A 1NTZH 2LFRA 5FLXN 1SQQH 4O4LA 4DR1B 3SYQA 4I7ZB 1QQCA 5A9GA 1H2GA 2QWOB 3K5MA 2N05A 5B1AB 1Q43A 3K59A 4OGQB 3ABKC 2CTQA 1S0VA 1K9MW 2HJFC 2BTOA 3LUTB 3QO5A 5EZYB 5JQGB 4U3FH 1JQ0A 3TETA 3VQXA 5ITZA 1YEWA 2QWRB 3JSLA 3SJAC 4FM0A 2X6AA 3F7VC 2ITDC 3CSXA 1D5NA 4CH5A 4FK5C 4FZ1A 3P30A 1BQ0A 4JI6O 3OTOB 1IZ3A 1XEQA 2UXNA 5KX5B 3OAAG 4AQYO 5IJ9B 4LR3A 4I50A 1ROPA 3HKCA 2UU9B 4N23A 2UXDB 4QPKA 2Y0PA 1OCZC 3ZRSA 1DGSA 2YIBA 2EBOA 1K8AW 3CEIA 1L0LH 3A0RA 5JH7A 2RDCA 2W0FC 3K79A 2R9AA 2M7WA 3JAKB 1M5IA 4JTAB 4DUYB 5BZBA 5JCOA 1K4CC 1XI1A 3Q4HB 1H8HG 2KSDA 1QVGU 2OCCC 3RN4A 1AI4A 4I4TB 4H13B 1WNSA 3KZIZ 2RMKB 4LF6B 2Q0OC 1MABG 2DWEC 1COWG 4H44B 1XNQO 3CJHA 1ZSPA 1L8DA 5L3BA 5L3DA 2XAHA 3ASOC 1Q6UA 1MMMA 3KCXA 2GHYA 2OTLV 2F95B 4LFAO 5EYPB 4X1KB 1SQPH 4LF7B 4TOIA 3UM7A 1KD1W 1R3LC 2YS8A 4J80A 3ZHTA 4MTGA 1AR1B 4IL6Z 4JI7B 4ZHQA 2Y4TA 3JAWB 3J81N 2UUCB 1DF5A 3FYIB 3SDLA 1AP5A 2YI9A 1S77D 2Q69A 5IYZA 3CC4V 1WA8B 2ATKC 4WFBV 1VQ6V 1YVWA 2F4VB 1IXBA 4D7SA 3CB2A 4JV5B 3ZMZA 4RQEA 5C8YB 1CPYA 1AB3A 2DMXA 3VBBA 1SQBH 3CCRV 3T2MA 2ZKOA 4K0KB 4JI4B 1AILA 2HEPA 1JOYA 5IY5B 1P49A 5HFLA 2YXYA 2UXCB 2EIMC 1R73A 2QDOA 3ETEA 2EX3A 5F2VO 4JYCA 1OCOB 4KFMA 1K5QA 1YCIA 2V1DA 1RP3B 2OWOA 5FPRA 2RQ6A 4JAAA 1HWYA 4LFBB 1M57C 4DR3B 4LH7A 4BW9A 4DV3O 1VEWA 3Q4HA 1XMOO 3S3XA 2EZOA 3CWBH 3E2EA 3DC5A 5J2UA 4NVPA 3L74H 2UXCO 2VQFO 1NQTA 1VQ9V 1NS1A 5CA0B 4FLWA 2FTKA 5EIBC 2E74B 4DV7B 1OCCC 1PL0A 1IJGA 1WPBA 4BIZA 2JS3A 1KBHA 2F66C 1Q86W 1G4YB 3CC2V 3CXHF 4UCTA 1OCZB 2A9HA 2CTPA 1VQ5V 3E22B 1DF4A 3B09A 2OYQA 1NKDA 3CE2A 1RSOB 4GX2A 3ZCCA 5LBQA 4DR4O 1H38A 5CB4B 2IJKA 4DV3B 2F1MA 1SQFA 3C90A 2Q8VA 4LFCB 4G27B 4LP8A 3ZHVA 1SQVH 4X89A 3STZC 4IT5A 5KMGB 4H0LB 4DW0A 3JCUZ 2VQFB 4FLVA 1PNKA 3SPHA 1PL4A 1I5XA 2B5UA 3E89A 4DV7O 3BA9A 3ABKB 4QPJA 1BMFG 1NTMH 2AZ0A 4B3MB 3CCEV 4ZOLB 4R50A 5CN0A 5LXTB 1PD3A 1WAZA 3AG4C 2ARHA 5GONA 4DV2B 4X1KA 1H5WA 2IH1C 1M93A 5LMNO 4DV4B 3BHPA 2LGQA 1I5YA 3BCCH 1O9GA 2O57A 2Q6AA 1XHXA 4U3JB 2JIZG 3KCYA 4YY3O 1VQLV 3OD4A 1JX9A 1F4MA 2CTRA 5BMVA 1GM7A 2KKWA 2ZE5A 3CP1A 2GUZB 3WU2Z 4PDVA 1N36B 2WLIB 4RAIA 4MVZA 4B3MO 1JVMA 3AG2B 4DV0B 3QO8A 2VQEB 4JZGA 4CZZA 1NH2D 1JR9A 1BQZA 3L75H 1L0NH 5CA3A 2QGNA 4PDMA 2WA3A 2WLNA 1IBLB 1TVKB 4DR6B 1GN2A 4FM2A 1N33B 2YSUB 4GKKO 1XMQB 4MTOA 4X8AA 2NNUA 2FYUH 1F4NA 4DV5B 2QKAA 1TUBB 4CH4A 2WLHA 1TA8A 1SERA 4U3JA 2WLJA 2B1IA 3ETQA 1RPRA 1OHHG 2V4DA 1IBKO 3JD1A 4KUMA 2EJ7A 1L1FA 4JI8O 3AG7A 3ZBHA 4B7KA 4DV0O 3ZIAG 4X20B 2PI5A 5CBFA 3B4SA 4YJ2B 5JCOC 5B1BB 2PYJA 3EHBB 2G38A 4DR6O 1SKVA 3U10A 4TWKA 4J7KA 3T4DA 1WA8A 4CC6A 5LGTA 1QNMA 2P4VA 5H9CA 5KX5A 3H01A 4JI6B 1HNZO 3OTOO 5A2QN 3SJBC 4GT1A 1F23A 2GSMB 2QEXV 1WP8A 4GX5A 2XHBA 4FPPA 4EFBA 4FLYA 2UU9O 3UQ8A 1EZJA 1ZX3A 3UO3A 2CGOA 4UCRA 4I5SA 1IBKB 2ADPA 2QWQB 4F6EA 4JI8B 3CCMV 4JI2O 2OCCB 2EIKB 1MNGA 3FYEB 2EJRA 4LCUC 3ZS8C 3F5TA 3CXCU 3FB6C 5KMGA 1S76D 5KA6A 3CCJV 1Q82W 3K06A 2DWDC 4GKJO 1KQSU 1ZL8A 3LDEA 1YZBA 1QLEC 2VS0A 2UUAB 5IJ0A 2Z0AA 3CRQA 2A79B 1Z5WA 2Q73A 1WP7A 5B66Z 4LF6O 3U0ZA 1URFA 3E22A 3P3PA 2IJHA 3EVKA 4I50B 1I08A 1GM8A 4JI3O 1NVPD 3ASOB 4TQDA 5KHJA 2H8PC 4HZ3A 1MSDA 1K97A 2W6JG 4WBNA 4FVMA 3X2QC 2XNDG 2WLMA 5B1AC 1EN4A 4PDRA 4MVUA 4EKWA 1G1XB 4WFGA 3LSSA 1Y67A 3C3TA 1N32O 4ZOLA 4LC1A 4RO2A 1GN6A 4YJ3B 2KB1A 4YHHO 4FFBB 2YIBD 4PI2A 2WSSG 1WJZA 4GKJB 3K5LA 3BEHA 3WB0A 1H2KA 2BTQA 1Y76B 1QLEB 2YC0A 1WN7A 3RYIA 4ZBMA 3SGIA 4F6RB 4ZIBA 3I56V 5IDJA 2QTSA 4U7OA 3D3QA 2QWPB 2ILMA 1YITV 2AW9A 5EZYA 5JQGA 3N2GA 3H1KH 4B3RB 1SZTA 5CBHA 1FJGB 1NJIW 3HKBA 3T1HB 1VQNV 4GUNA 1P4RA 2R72A 3A8TA 4LF9B 5IT9N 4NXNB 5GW7A 3RGBA 2VWKA 4YJ2A 5LXTA 1HW7A 3SPIA 4LH6A 3ABLB 4QE7A 1Y76A 4FIPC 4JYAB 4JF3A 1GK9A 3ZN1A 2QJ1A 1SESA 5EYPA 2UUBB 4FLUA 3CJHB 1B3QA 3O65A 4BWAA 5LMUB 4DR5O 3JYCA 3RT3C 3CYOA 4X66O 2FMLA 1AI7A 3ZRWA 1IBMB 1GKFA 2UXXA 5K1PA 4X9QA 4WBNB 1FXVA 5EC2C 4I4TA 1H2SB 3JALA 1XILA 1FFTB 4LF9O 3K0GA 1K34A 1EFRG 3DC6A 3FAVB 1OCCB 3L71H 3U11A 1KUQA 1FPOA 3IGAC 4D7TA 4OXSA 2CTWA 4NTXA 3JATB 3FB8C 3IC9A 4WFFA 2HJDA 1ENVA 2GUZA 3A0BZ 3E8HA 5CBGA 2XAGA 4O4HA 4EEQA 2HKOA 4WFHA 2YXLA 1Y74B 2LW7A 3DGEA 5DM6V 4LF8B 5JVDB 1GH6A 2ZR2A 3I55V 4JGSA 3JASA 3K04A 2JEXA 5IYCO 2CGNA 2UXBO 1NH2B 1CEZA 3HKDB 1JFFA 3AG3C 1VF6C 3CCUV 1YJ9V 5CB4A 4U7NA 5KHHA 2JGDB 1Q3EA 2XAQA 4Z2WA 1HNXB 3UO2A 1BT8A 4ABMA 2EILB 2ZINA 1DTOA 2Y69C 3J80N 1P7BA 3RYCA 2ZXWC 4AI8A 2X6BA 5EIBD 4DR1O 1XHZA 1PP9H 1NZ6A 4TQFA 4UCUA 3ZEDA 5LP6A 1W0KG 4BW5A 5KLVH 2QKCA 3C3SA 2L35A 2PY5A 4B3TO 4LF8O 5CMUA 5LHGA 5H2FZ 2IU3A 4GLXA 1OZ0A 3SR2C 2DN9A 3AK3A 2HG5C 1ORQC 5ITZB 3AG4B 1SS3A 3W7UA 2N74A 1W0JG 4HAMA 3RYFA 1LUVA 2DQ3A 1EM1A 1B04A 3HKEA 2RCVA 1J5EB 1QCEA 3MAQA 4LF4B 1M56B 3ETGA 3GB7C 3SYCA 3MHSC 1VQ4V 3QNEA 4R7CA 3N27A 2IH3C 1XL4A 4DUZB 4NXMO 4CH6A 5D5PA 4AQYB 2Y69B 2GV9A 4UVBA 4MVSA 3ZMTA 4LWSB 4DXWA 3ZN0A 3HB3B 2XOKG 2Q68A 1LNQA 5EBMC 1KC8W 3JARA 1GO3F 5FL7G 4LF7O 4J42A 1Q6HA 2XUMA 5LL6Y 1XMQO 3ML0A 4B3TB 3ASNC 3FAVA 3T4ZA 4PI0A 3M7MX 3FFQA 2JJ1G 3AK2A 5B1NA 5L3FA 3MDSA 5E79Z 3ZX6A 2K1EA 3K57A 4UUJC 5KHIA 4WFAV 2JK5C 4P2ZA 4WFEA 3T1YO 4E4EA 1WB7A 4PA7A 3JCZA 2Q67A 4DUZO 4NXMB 4A5UB 1R6KA 3EXAA 3QVNA 1V54C 1F7YA 2RNBA 4B08A 3M99B 1XNQB 3W7XA 2JEUA 1QR9A 4J10A 3ZHQA 4PA4A 3RYCB 4R8CA 2XAFA 5GONB 4PHZA 1QU7A 4I9WA 1N34B 3TXQA 1Q90D 4DV6O 2BSKB 4H33A 1AR5A 1AR4A 2EILC 5C93A 3MHHC 1TGOA 3OMAB 3N2GB 1HDJA 4JI7O 4TV8A 5IYZB 3GWOA 5E1AC 2CAZC 3BRCA 1YHQV 4JI2B 3A0HZ 5JWPA 2DYRB 3D36C 3LSQA 4X1YB 3B77A 3NXSA 4Q20A 4CC5A 3BAAA 2QR4A 4K35A 4NB5A 4JI0O 2BTQB 4NYKA 3AEIA 1XL6A 3AK1A 4X1IB 4K0KO 3E83A 2UUAO 2DE0X 5LHIA 3TXSA 2Z5UA 4DV6B 5AG2A 1R6NA 1LR1A 3VOUA 4PA6A 2FL4A 2E76B 1D2DA 1YF2A 5KAFZ 1QHTA
chains in the Genus database with same CATH topology
1IDSA 3DC5A 1MMMA 5A9GA 2ADPA 1MA1A 4GUNA 4F6EA 3OT7A 1MNGA 4E4EA 1WB7A 1ZUQA 2P4KA 3K9SA 3TJTA 1BT8A 4JZGA 1JR9A 4YIOA 4BR6A 3QVNA 4JYYA 1ZTEA 1XREA 1GN2A 1D5NA 3BFRA 1AP5A 1B06A 1GN4A 1IXBA 1BSMA 1KKCA 2QKCA 3C3SA 1VARA 3LSUA 2ADQB 1ZLZA 1EN6A 2QKAA 1EN5A 1AR5A 1AR4A 3EVKA 1I08A 1IX9A 3AK3A 3KDRA 4X9QA 1MSDA 2GDSA 3CEIA 1LUVA 4FFKA 1XILA 1EM1A 4JZ2A 4C7UA 2RCVA 1PL4A 1EN4A 4YIPA 3DC6A 1JA8A 1Y67A 1N0NA 3C3TA 1XUQA 1PM9A 1GN6A 2CDYA 1XDCA 3AK1A 3IC9A 1GN3A 3RN4A 1LUWA 1QNMA 1P7GA 1WB8A 1I0HA 1AVMA 3KKYA 5AG2A 1AP6A 1SZXA 1N0JA 1BS3A 1VEWA 2CE4A 1ZSPA 2AW9A 3AK2A 3MDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDS A;  3DC5 A;  1MMM A;  5A9G A;  2ADP A;  1MA1 A;  4GUN A;  4F6E A;  3OT7 A;  1MNG A;  4E4E A;  1WB7 A;  1ZUQ A;  2P4K A;  3K9S A;  3TJT A;  1BT8 A;  4JZG A;  1JR9 A;  4YIO A;  4BR6 A;  3QVN A;  4JYY A;  1ZTE A;  1XRE A;  1GN2 A;  1D5N A;  3BFR A;  1AP5 A;  1B06 A;  1GN4 A;  1IXB A;  1BSM A;  1KKC A;  2QKC A;  3C3S A;  1VAR A;  3LSU A;  2ADQ B;  1ZLZ A;  1EN6 A;  2QKA A;  1EN5 A;  1AR5 A;  1AR4 A;  3EVK A;  1I08 A;  1IX9 A;  3AK3 A;  4X9Q A;  1MSD A;  2GDS A;  3CEI A;  1LUV A;  4FFK A;  1XIL A;  1EM1 A;  4JZ2 A;  4C7U A;  2RCV A;  1PL4 A;  1EN4 A;  4YIP A;  3DC6 A;  1JA8 A;  1Y67 A;  1N0N A;  3C3T A;  1XUQ A;  1PM9 A;  1GN6 A;  2CDY A;  1XDC A;  3AK1 A;  3IC9 A;  1GN3 A;  3RN4 A;  1LUW A;  1QNM A;  1P7G A;  1WB8 A;  1I0H A;  1AVM A;  3KKY A;  5AG2 A;  1AP6 A;  1SZX A;  1N0J A;  1BS3 A;  1VEW A;  2CE4 A;  1ZSP A;  2AW9 A;  3AK2 A;  3MDS A; 
#chains in the Genus database with same CATH topology
 2Q4P A;  2E3C A;  3ZMS A;  4QJF B;  2X0L A;  1TUE B;  1FYJ A;  2A3Q A;  1TVK A;  1VIB A;  4NKG B;  3CCV V;  3RYH A;  3CD6 V;  4X65 O;  2A0L A;  4UFZ A;  1O9H A;  2W6I G;  2HVJ C;  1FKA O;  3EFF K;  1N32 B;  4AIL C;  4BR6 A;  1FXK C;  3JAK A;  4UV8 A;  4RUE A;  3CX5 F;  4XDK A;  4O4H B;  1FAF A;  3BFR A;  1VQK V;  3P3N A;  5KHG A;  1CP9 A;  3JSN A;  1G6U A;  4J41 A;  2XAS A;  2PF4 E;  1Z2G A;  4PA3 A;  2W0X A;  2ITC C;  4ZI7 B;  3SYA A;  3A2F A;  2DJV A;  2HP8 A;  3DXR A;  4DV2 O;  5FPO A;  3RYF B;  1E1R G;  4G28 B;  4XDJ A;  3I5D A;  5LMN B;  4DV4 O;  4FLZ A;  3ABU A;  4FZ0 A;  1GAX A;  5FNV B;  4YXW G;  3HKD A;  4L87 A;  2BCC H;  3OGC C;  1YSC A;  4Z1M G;  1I94 O;  1K92 A;  4DR4 B;  4CS4 A;  3B8M A;  3THO A;  1YJN V;  2Y4U A;  4ZI7 A;  1IUR A;  2ZCE A;  3K0D A;  2EZP A;  1PNM A;  5IWA B;  1GN3 A;  2LO1 A;  2OCH A;  3K5N A;  4JYA O;  5HFM A;  2EIJ B;  5CA0 A;  3MD0 A;  1AVM A;  4RUF A;  1NI8 A;  2B1G A;  3E86 A;  3ETD A;  1AP6 A;  3R66 A;  2A7W A;  4O4L B;  4EFE A;  1BS3 A;  1SQX H;  2WWW A;  5D5Q A;  4G2K A;  3IJ4 A;  1AJQ A;  3ASN B;  4MVM A;  4O2B B;  5DEC A;  3W7S A;  4JAV A;  3RYH B;  2YUA A;  3JAW A;  3OT7 A;  4NR1 A;  4WCE V;  5BR8 B;  1V55 B;  3FB5 C;  2OTJ V;  3E8G A;  4DV5 O;  1I94 B;  5KA5 A;  3LNM B;  3ABL C;  2HHH B;  1Y74 A;  2X7R B;  1JMK C;  5KUK A;  1HNW B;  2HVK C;  1K33 A;  1XRE A;  3VQV A;  3QF7 A;  3OGI B;  4K8X A;  1DK1 A;  1VQ8 V;  1V54 B;  3G71 V;  4IIJ B;  3QTC A;  1BSM A;  2EIJ C;  2WLI A;  1N36 O;  4DO2 A;  3LSU A;  5IE9 A;  1RM1 B;  2VQE O;  2IBZ H;  3H1J H;  1OCO C;  1S5L Z;  1UJW B;  1SET A;  5LOV B;  1M4U A;  3K58 A;  1IBL O;  3G67 A;  4HNA A;  4ASU G;  2JS5 A;  4QGP A;  4GKK B;  1XOU A;  4UV9 A;  2JGU A;  3BAB A;  1OV9 A;  4H37 A;  2E5L O;  4DRX B;  3F5W C;  5L3G A;  4J9Y B;  4TV9 A;  1HNW O;  2NR5 A;  2YDE A;  1U97 A;  2ETN A;  1YTF B;  3JAR B;  4B7E A;  3CME V;  4JPR A;  5GTI Z;  2F23 A;  3CRM A;  1EZV H;  1YJW V;  2PUS A;  5BMV B;  3H9V A;  4X1Y A;  2P22 C;  3KKY A;  2PYL A;  1M56 C;  3WB1 A;  3IFX A;  3NR7 A;  3ZHU A;  2IJJ A;  2AGA A;  5LGU A;  1H2M A;  2HFE C;  4TV8 B;  1FXK A;  4MVR A;  4IHJ A;  3OMI B;  2ZIM A;  3JAM N;  1TUB A;  5BXZ A;  3N2K B;  4DR2 B;  1KKD A;  2ZNI A;  1WPX A;  1ZUQ A;  3K9S A;  2ZT9 B;  1FD9 A;  1HNZ B;  2EIN C;  2XTA A;  3DXR B;  2ZIO A;  1KP2 A;  3L73 H;  4DV1 B;  5BY1 A;  1I7F A;  4FFB A;  2QKS A;  4EB6 B;  3SPJ A;  3LNN A;  1JJ2 U;  2B9Z A;  1MZF A;  1HR0 B;  2DYS B;  5LGN A;  2H3O A;  5IJ0 B;  1W59 A;  1V55 C;  4DW1 A;  3OMN B;  4UVA A;  3K03 A;  2MK3 A;  1EN5 A;  3OEH G;  4IYI A;  4J11 A;  5J2U B;  3JAT A;  4CH3 A;  4Z1V A;  3LDD A;  4GYC B;  3SPC A;  4NTY A;  1SF9 A;  4OX9 O;  4DK1 A;  3OE7 G;  2C2A A;  3OFN G;  4FJC C;  2LQT A;  1B6Q A;  1M1K W;  1XUQ A;  1YI2 V;  2WLK A;  2QM7 A;  3H1H H;  2EIN B;  2WLL A;  1OJH A;  4KXR A;  1FJG O;  1QBZ A;  3TGU H;  4PDL A;  2ZXW B;  3B2E E;  1HR0 O;  2AHZ A;  3AG1 C;  5LP6 C;  1WB8 A;  4NXN O;  1NVP B;  1KB9 F;  4J7J A;  4UCO A;  3KG2 A;  2D2C B;  3BVO A;  1EBO A;  1FS0 G;  1XQ8 A;  2KQX A;  2CE4 A;  4DK0 A;  2BOB C;  4YHH B;  2P67 A;  1JNB A;  1BZK A;  4TUY A;  5JJN B;  1BCC H;  3N2K A;  4DR7 B;  4W4L A;  1MA1 A;  1M9N A;  3ZRV A;  1QLN A;  2P6J A;  4K8Z A;  1QR8 A;  3JD2 A;  4DR5 B;  4O4I B;  4JV5 O;  3FD9 A;  1G8M A;  2RJZ A;  2CUG A;  2P4K A;  4HYO A;  4LF5 B;  5KAI Z;  4JAS A;  3ZHS A;  4ZKI A;  4JYY A;  4MTF A;  5H6R A;  4WF9 V;  1YDX A;  4FM1 A;  4D6T H;  4JI4 O;  4I0X B;  4FLX A;  5J2T B;  4OPH A;  1VQM V;  2EIM B;  2VWJ A;  1ZAU A;  4LFA B;  3PN1 A;  3M8A A;  2CH7 B;  1HP8 A;  1MOF A;  3QO7 A;  1XBL A;  1Q6I A;  2JGD A;  3HR0 A;  3W7W A;  3CRC A;  3D8C A;  4MVO A;  3DSQ A;  1TAE A;  5DN6 G;  1KU9 A;  1AI5 A;  2ZR3 A;  4P9P A;  2AZ2 A;  1PKX A;  3JAS B;  4DR7 O;  1T5E A;  1Q5O A;  4C7U A;  4JZ2 A;  4MS2 A;  2UUC O;  3JAL B;  2ODM A;  3CCS V;  4JAU A;  4X65 B;  4LF5 O;  4F6R A;  4L8J A;  4KP4 A;  1XMO B;  2UUB O;  4HBN A;  1NR1 A;  4DYL A;  2QE7 G;  5K1X A;  4N21 A;  3QG5 A;  1CXZ B;  1IBM O;  1KEC A;  4PEL A;  2N04 A;  4ICG A;  2ZE8 A;  2AHY A;  1HNX O;  2E75 B;  1GM9 A;  3PJS K;  3G80 A;  4O4J B;  4PJ0 Z;  3E8B A;  1AI6 A;  4LWS A;  4O2A A;  2M6Y A;  1F51 A;  1R6T A;  3CPW U;  1VMG A;  3ABM B;  3CS5 A;  1P84 F;  1PV0 A;  3K3W A;  2YI8 A;  1VF5 B;  2IM9 A;  2QWN B;  2ZE7 A;  4AHC A;  2OT5 A;  3HKB B;  4RWU A;  5EBL C;  1RPO A;  4JI5 O;  4MTX A;  1NU1 H;  2NN4 A;  1FFX A;  2RN9 A;  4LFC O;  5LHH A;  2YIA A;  4LFB O;  3TCU A;  4TT3 G;  4YIO A;  5H6Q A;  1BGY H;  4CS3 A;  1R1B A;  1ZTE A;  2BOC C;  3F7Y C;  3K5O A;  1SQG A;  2EUL A;  3AG1 B;  5LP6 B;  4LF4 O;  2Q5Z A;  1BHA A;  1FFX B;  1GN4 A;  2LGW A;  2K9P A;  2OIG A;  1UPG A;  1X59 A;  1H2L A;  3J7A U;  5CA1 A;  1S5H C;  2LFS A;  1FXK B;  2AXT Z;  4YJ3 A;  4UVC A;  5KHK A;  5LA6 B;  2ZDI A;  1N8R W;  4MSW C;  2GDS A;  4F4L A;  5J9P C;  3B40 A;  1RSO A;  2PI4 A;  2X6C A;  5J2T A;  4JI5 B;  1SRY A;  4X20 A;  2YEV B;  5EK0 A;  5LYJ A;  1JFF B;  4TV9 B;  2CK3 G;  1PM9 A;  2HR3 A;  4UB6 Z;  3GWK C;  2QM8 A;  1VQ7 V;  4IHJ B;  4YY3 B;  1RM1 C;  2PGG A;  5JVD A;  3G6B A;  4TSF G;  2Q7G A;  4UCS A;  5TIS Z;  3AG3 B;  3R65 A;  1UFI A;  3T1Y B;  4X88 A;  3SPG A;  4XBF A;  4KL1 A;  1Q8I A;  4GX1 A;  4HNA B;  1GTO A;  1VF6 A;  1J5E O;  2PZS A;  4IYH A;  4O2A B;  5L3E A;  5GTH Z;  3ABT A;  5B1O A;  1YXB A;  2UXD O;  3SYP A;  1QVF U;  2MW2 B;  1KYO F;  2H94 A;  1N33 O;  1KMI Z;  3UT5 B;  2LJ2 A;  1Q7Y W;  1IDS A;  5B1B C;  3L9D A;  1SC5 B;  1Y6X A;  2DYS C;  1R3K C;  1RFY A;  1N34 O;  4PV1 B;  2Y0I A;  3RVZ A;  1J95 A;  5IJ9 A;  2ZQM A;  5EC1 C;  4KHP B;  1FXH A;  3E8F A;  3CRA A;  1YIJ V;  1V9P A;  2BE3 A;  4DUY O;  1S5J A;  3IAY A;  3OUS A;  4I0X A;  4I9Q A;  3G4S V;  4BIO A;  5JJE B;  1MSW D;  2GBO A;  3RW0 A;  1PPJ H;  1U96 A;  1NBM G;  1B06 A;  4X1I A;  4UCV A;  2JJ2 G;  3CMA V;  4IGG A;  3K08 A;  4MVQ A;  2QA4 V;  3BA8 A;  2XT9 A;  4LNU A;  2ADQ B;  3OW2 U;  4X64 O;  4GZR B;  1IX9 A;  1BL8 A;  2P7T C;  2R9I A;  5IY5 C;  3ABM C;  4CBC A;  3ZHR A;  5C8Y A;  3SJC C;  1W2B U;  3FX7 A;  2ZD9 A;  4FFK A;  3OM3 B;  4EB6 A;  4KHP O;  2XAJ A;  1Y66 A;  3UKM A;  4K3A A;  3G6E V;  3HKC B;  1M57 B;  2WPD G;  1BE3 H;  4DRX A;  5CA1 B;  5JJJ B;  3ZRX A;  1THZ A;  1D5A A;  1NR7 A;  2QM4 A;  1OCR B;  3O9O A;  4ZHQ B;  2Q7H A;  4O2B A;  3OEE G;  2P5O A;  2BSK A;  2CDY A;  1Q81 W;  4DV1 O;  4W4K A;  1GMG A;  1MZE A;  1XNR B;  3APO A;  3OR6 C;  1LUW A;  3RBZ A;  5LA6 A;  3WG7 C;  2QTO A;  2YEV A;  3SJQ C;  3WB2 A;  4I55 A;  3SYO A;  2ZNJ A;  2F4V O;  4CS2 A;  2DYR C;  1SZX A;  1N0J A;  3VQW A;  1AJP A;  5B5E Z;  2VRZ A;  2LW1 A;  4X64 B;  2L6L A;  3UT5 A;  3RFR A;  2JRI A;  2A06 H;  1K5S A;  3GVM A;  4JI0 B;  2PTM A;  3ZMU A;  1US6 A;  4OX9 B;  2QSA A;  3ZMV A;  1R3I C;  1NTK H;  5FNV A;  1ARO P;  4X62 B;  4FLT A;  1E1Q G;  1K7D A;  2EIK C;  2WLL B;  1VF7 A;  4JI3 B;  1OCR C;  1SA0 B;  2P90 A;  4RQF A;  1R3J C;  1XNR O;  3BY6 A;  2Z3Y A;  1K73 W;  1VP7 A;  4FMT A;  2R70 A;  5LYJ B;  5EBW C;  1H2N A;  2OIE A;  5LOV A;  4J9Z B;  4DR3 O;  1VAR A;  2Q9L A;  2IU0 A;  1NT2 B;  1EN6 A;  4O4J A;  3JD3 A;  2Q0A A;  3LDC A;  3P32 A;  4OPA A;  5IWA O;  1K3E A;  3E35 A;  1M90 W;  1IVS A;  1E79 G;  1Z5V A;  4YIP A;  4MT8 A;  3JD0 A;  1JA8 A;  4Q6G A;  4X62 O;  2DW4 A;  1MG1 A;  2WAM A;  2ZM6 O;  1X4T A;  2YXH A;  4B3R O;  1N4C A;  3ZJZ A;  2FB5 A;  4GCZ A;  5B3S B;  4QNH B;  4GX0 A;  3T1H O;  3FKS G;  3W7T A;  5KUM A;  3CCQ V;  3WFV A;  3ZRW B;  1WLE A;  5BR8 O;  4LBE C;  1VQP V;  4JI1 B;  2HLD G;  3X2Q B;  3DTU B;  1P7G A;  1PNL A;  2YID A;  2KG7 A;  3CHX A;  3HPL C;  3S3W A;  4PA9 A;  3FB7 C;  2JDI G;  3D3I A;  4UXN A;  3K9A A;  5B3S C;  3UCS C;  2ZE6 A;  4P9O A;  4JTD B;  3CC7 V;  3RYI B;  1VQO V;  1S3J A;  3APQ A;  4I55 B;  4TUY B;  2GTA A;  3AG2 C;  4JYB A;  1BHB A;  3OTF A;  2F93 B;  1FOU A;  4LNU B;  4QIW F;  2ZM6 B;  4IIJ A;  1DLB A;  3TJT A;  3D36 A;  4MW8 A;  1GRJ A;  2LP7 A;  4PD4 F;  2Y48 A;  2F43 G;  3OR7 C;  3BPZ A;  2IW5 A;  2Q7E A;  3B8N A;  5L3C A;  1Y4M A;  2P06 A;  1SA0 A;  5H5N A;  4JI1 O;  4B3S O;  1YTF D;  4J7Z A;  2JVD A;  1ZWI C;  2DOS A;  4E2L A;  4R6Z A;  3CCL V;  3RVY A;  1KKC A;  2E5L B;  3T1C A;  4BAY A;  3STL C;  1ZLZ A;  2HHH O;  3OUF A;  2GTS A;  5IYB O;  3KDR A;  4UB8 Z;  1K4D C;  1H8E G;  2IJI A;  1S72 V;  3ICX A;  3JD4 A;  3L72 H;  2DQ0 A;  3WG7 B;  2R9R B;  4NTW A;  1ZL8 B;  2WA4 A;  1AJN A;  1A32 A;  3H1I H;  4MW3 A;  2V7Q G;  1N0N A;  3L70 H;  5JH7 B;  3IC7 A;  2CH7 A;  1KP3 A;  5LMU O;  5IYD O;  3CRR A;  3H1L H;  1XDC A;  2D3O W;  1JPX A;  4X66 B;  5DED A;  2UXB B;  4BIU A;  2NLJ C;  4DR2 O;  1IXM A;  4B3S B;  3RWR D;  2KG7 B;  2YIC A;  4O4I A;  4QE9 A;  2FKX A;  1I0H A;  4P30 A;  3HKE B;  3VQY A;  4JTC B;  1JJO A;  1JCH A;  2ZDI C;  4XDL A;  3TK1 A;  1NTZ H;  2LFR A;  5FLX N;  1SQQ H;  4O4L A;  4DR1 B;  3SYQ A;  4I7Z B;  1QQC A;  5A9G A;  1H2G A;  2QWO B;  3K5M A;  2N05 A;  5B1A B;  1Q43 A;  3K59 A;  4OGQ B;  3ABK C;  2CTQ A;  1S0V A;  1K9M W;  2HJF C;  2BTO A;  3LUT B;  3QO5 A;  5EZY B;  5JQG B;  4U3F H;  1JQ0 A;  3TET A;  3VQX A;  5ITZ A;  1YEW A;  2QWR B;  3JSL A;  3SJA C;  4FM0 A;  2X6A A;  3F7V C;  2ITD C;  3CSX A;  1D5N A;  4CH5 A;  4FK5 C;  4FZ1 A;  3P30 A;  1BQ0 A;  4JI6 O;  3OTO B;  1IZ3 A;  1XEQ A;  2UXN A;  5KX5 B;  3OAA G;  4AQY O;  5IJ9 B;  4LR3 A;  4I50 A;  1ROP A;  3HKC A;  2UU9 B;  4N23 A;  2UXD B;  4QPK A;  2Y0P A;  1OCZ C;  3ZRS A;  1DGS A;  2YIB A;  2EBO A;  1K8A W;  3CEI A;  1L0L H;  3A0R A;  5JH7 A;  2RDC A;  2W0F C;  3K79 A;  2R9A A;  2M7W A;  3JAK B;  1M5I A;  4JTA B;  4DUY B;  5BZB A;  5JCO A;  1K4C C;  1XI1 A;  3Q4H B;  1H8H G;  2KSD A;  1QVG U;  2OCC C;  3RN4 A;  1AI4 A;  4I4T B;  4H13 B;  1WNS A;  3KZI Z;  2RMK B;  4LF6 B;  2Q0O C;  1MAB G;  2DWE C;  1COW G;  4H44 B;  1XNQ O;  3CJH A;  1ZSP A;  1L8D A;  5L3B A;  5L3D A;  2XAH A;  3ASO C;  1Q6U A;  1MMM A;  3KCX A;  2GHY A;  2OTL V;  2F95 B;  4LFA O;  5EYP B;  4X1K B;  1SQP H;  4LF7 B;  4TOI A;  3UM7 A;  1KD1 W;  1R3L C;  2YS8 A;  4J80 A;  3ZHT A;  4MTG A;  1AR1 B;  4IL6 Z;  4JI7 B;  4ZHQ A;  2Y4T A;  3JAW B;  3J81 N;  2UUC B;  1DF5 A;  3FYI B;  3SDL A;  1AP5 A;  2YI9 A;  1S77 D;  2Q69 A;  5IYZ A;  3CC4 V;  1WA8 B;  2ATK C;  4WFB V;  1VQ6 V;  1YVW A;  2F4V B;  1IXB A;  4D7S A;  3CB2 A;  4JV5 B;  3ZMZ A;  4RQE A;  5C8Y B;  1CPY A;  1AB3 A;  2DMX A;  3VBB A;  1SQB H;  3CCR V;  3T2M A;  2ZKO A;  4K0K B;  4JI4 B;  1AIL A;  2HEP A;  1JOY A;  5IY5 B;  1P49 A;  5HFL A;  2YXY A;  2UXC B;  2EIM C;  1R73 A;  2QDO A;  3ETE A;  2EX3 A;  5F2V O;  4JYC A;  1OCO B;  4KFM A;  1K5Q A;  1YCI A;  2V1D A;  1RP3 B;  2OWO A;  5FPR A;  2RQ6 A;  4JAA A;  1HWY A;  4LFB B;  1M57 C;  4DR3 B;  4LH7 A;  4BW9 A;  4DV3 O;  1VEW A;  3Q4H A;  1XMO O;  3S3X A;  2EZO A;  3CWB H;  3E2E A;  3DC5 A;  5J2U A;  4NVP A;  3L74 H;  2UXC O;  2VQF O;  1NQT A;  1VQ9 V;  1NS1 A;  5CA0 B;  4FLW A;  2FTK A;  5EIB C;  2E74 B;  4DV7 B;  1OCC C;  1PL0 A;  1IJG A;  1WPB A;  4BIZ A;  2JS3 A;  1KBH A;  2F66 C;  1Q86 W;  1G4Y B;  3CC2 V;  3CXH F;  4UCT A;  1OCZ B;  2A9H A;  2CTP A;  1VQ5 V;  3E22 B;  1DF4 A;  3B09 A;  2OYQ A;  1NKD A;  3CE2 A;  1RSO B;  4GX2 A;  3ZCC A;  5LBQ A;  4DR4 O;  1H38 A;  5CB4 B;  2IJK A;  4DV3 B;  2F1M A;  1SQF A;  3C90 A;  2Q8V A;  4LFC B;  4G27 B;  4LP8 A;  3ZHV A;  1SQV H;  4X89 A;  3STZ C;  4IT5 A;  5KMG B;  4H0L B;  4DW0 A;  3JCU Z;  2VQF B;  4FLV A;  1PNK A;  3SPH A;  1PL4 A;  1I5X A;  2B5U A;  3E89 A;  4DV7 O;  3BA9 A;  3ABK B;  4QPJ A;  1BMF G;  1NTM H;  2AZ0 A;  4B3M B;  3CCE V;  4ZOL B;  4R50 A;  5CN0 A;  5LXT B;  1PD3 A;  1WAZ A;  3AG4 C;  2ARH A;  5GON A;  4DV2 B;  4X1K A;  1H5W A;  2IH1 C;  1M93 A;  5LMN O;  4DV4 B;  3BHP A;  2LGQ A;  1I5Y A;  3BCC H;  1O9G A;  2O57 A;  2Q6A A;  1XHX A;  4U3J B;  2JIZ G;  3KCY A;  4YY3 O;  1VQL V;  3OD4 A;  1JX9 A;  1F4M A;  2CTR A;  5BMV A;  1GM7 A;  2KKW A;  2ZE5 A;  3CP1 A;  2GUZ B;  3WU2 Z;  4PDV A;  1N36 B;  2WLI B;  4RAI A;  4MVZ A;  4B3M O;  1JVM A;  3AG2 B;  4DV0 B;  3QO8 A;  2VQE B;  4JZG A;  4CZZ A;  1NH2 D;  1JR9 A;  1BQZ A;  3L75 H;  1L0N H;  5CA3 A;  2QGN A;  4PDM A;  2WA3 A;  2WLN A;  1IBL B;  1TVK B;  4DR6 B;  1GN2 A;  4FM2 A;  1N33 B;  2YSU B;  4GKK O;  1XMQ B;  4MTO A;  4X8A A;  2NNU A;  2FYU H;  1F4N A;  4DV5 B;  2QKA A;  1TUB B;  4CH4 A;  2WLH A;  1TA8 A;  1SER A;  4U3J A;  2WLJ A;  2B1I A;  3ETQ A;  1RPR A;  1OHH G;  2V4D A;  1IBK O;  3JD1 A;  4KUM A;  2EJ7 A;  1L1F A;  4JI8 O;  3AG7 A;  3ZBH A;  4B7K A;  4DV0 O;  3ZIA G;  4X20 B;  2PI5 A;  5CBF A;  3B4S A;  4YJ2 B;  5JCO C;  5B1B B;  2PYJ A;  3EHB B;  2G38 A;  4DR6 O;  1SKV A;  3U10 A;  4TWK A;  4J7K A;  3T4D A;  1WA8 A;  4CC6 A;  5LGT A;  1QNM A;  2P4V A;  5H9C A;  5KX5 A;  3H01 A;  4JI6 B;  1HNZ O;  3OTO O;  5A2Q N;  3SJB C;  4GT1 A;  1F23 A;  2GSM B;  2QEX V;  1WP8 A;  4GX5 A;  2XHB A;  4FPP A;  4EFB A;  4FLY A;  2UU9 O;  3UQ8 A;  1EZJ A;  1ZX3 A;  3UO3 A;  2CGO A;  4UCR A;  4I5S A;  1IBK B;  2ADP A;  2QWQ B;  4F6E A;  4JI8 B;  3CCM V;  4JI2 O;  2OCC B;  2EIK B;  1MNG A;  3FYE B;  2EJR A;  4LCU C;  3ZS8 C;  3F5T A;  3CXC U;  3FB6 C;  5KMG A;  1S76 D;  5KA6 A;  3CCJ V;  1Q82 W;  3K06 A;  2DWD C;  4GKJ O;  1KQS U;  1ZL8 A;  3LDE A;  1YZB A;  1QLE C;  2VS0 A;  2UUA B;  5IJ0 A;  2Z0A A;  3CRQ A;  2A79 B;  1Z5W A;  2Q73 A;  1WP7 A;  5B66 Z;  4LF6 O;  3U0Z A;  1URF A;  3E22 A;  3P3P A;  2IJH A;  3EVK A;  4I50 B;  1I08 A;  1GM8 A;  4JI3 O;  1NVP D;  3ASO B;  4TQD A;  5KHJ A;  2H8P C;  4HZ3 A;  1MSD A;  1K97 A;  2W6J G;  4WBN A;  4FVM A;  3X2Q C;  2XND G;  2WLM A;  5B1A C;  1EN4 A;  4PDR A;  4MVU A;  4EKW A;  1G1X B;  4WFG A;  3LSS A;  1Y67 A;  3C3T A;  1N32 O;  4ZOL A;  4LC1 A;  4RO2 A;  1GN6 A;  4YJ3 B;  2KB1 A;  4YHH O;  4FFB B;  2YIB D;  4PI2 A;  2WSS G;  1WJZ A;  4GKJ B;  3K5L A;  3BEH A;  3WB0 A;  1H2K A;  2BTQ A;  1Y76 B;  1QLE B;  2YC0 A;  1WN7 A;  3RYI A;  4ZBM A;  3SGI A;  4F6R B;  4ZIB A;  3I56 V;  5IDJ A;  2QTS A;  4U7O A;  3D3Q A;  2QWP B;  2ILM A;  1YIT V;  2AW9 A;  5EZY A;  5JQG A;  3N2G A;  3H1K H;  4B3R B;  1SZT A;  5CBH A;  1FJG B;  1NJI W;  3HKB A;  3T1H B;  1VQN V;  4GUN A;  1P4R A;  2R72 A;  3A8T A;  4LF9 B;  5IT9 N;  4NXN B;  5GW7 A;  3RGB A;  2VWK A;  4YJ2 A;  5LXT A;  1HW7 A;  3SPI A;  4LH6 A;  3ABL B;  4QE7 A;  1Y76 A;  4FIP C;  4JYA B;  4JF3 A;  1GK9 A;  3ZN1 A;  2QJ1 A;  1SES A;  5EYP A;  2UUB B;  4FLU A;  3CJH B;  1B3Q A;  3O65 A;  4BWA A;  5LMU B;  4DR5 O;  3JYC A;  3RT3 C;  3CYO A;  4X66 O;  2FML A;  1AI7 A;  3ZRW A;  1IBM B;  1GKF A;  2UXX A;  5K1P A;  4X9Q A;  4WBN B;  1FXV A;  5EC2 C;  4I4T A;  1H2S B;  3JAL A;  1XIL A;  1FFT B;  4LF9 O;  3K0G A;  1K34 A;  1EFR G;  3DC6 A;  3FAV B;  1OCC B;  3L71 H;  3U11 A;  1KUQ A;  1FPO A;  3IGA C;  4D7T A;  4OXS A;  2CTW A;  4NTX A;  3JAT B;  3FB8 C;  3IC9 A;  4WFF A;  2HJD A;  1ENV A;  2GUZ A;  3A0B Z;  3E8H A;  5CBG A;  2XAG A;  4O4H A;  4EEQ A;  2HKO A;  4WFH A;  2YXL A;  1Y74 B;  2LW7 A;  3DGE A;  5DM6 V;  4LF8 B;  5JVD B;  1GH6 A;  2ZR2 A;  3I55 V;  4JGS A;  3JAS A;  3K04 A;  2JEX A;  5IYC O;  2CGN A;  2UXB O;  1NH2 B;  1CEZ A;  3HKD B;  1JFF A;  3AG3 C;  1VF6 C;  3CCU V;  1YJ9 V;  5CB4 A;  4U7N A;  5KHH A;  2JGD B;  1Q3E A;  2XAQ A;  4Z2W A;  1HNX B;  3UO2 A;  1BT8 A;  4ABM A;  2EIL B;  2ZIN A;  1DTO A;  2Y69 C;  3J80 N;  1P7B A;  3RYC A;  2ZXW C;  4AI8 A;  2X6B A;  5EIB D;  4DR1 O;  1XHZ A;  1PP9 H;  1NZ6 A;  4TQF A;  4UCU A;  3ZED A;  5LP6 A;  1W0K G;  4BW5 A;  5KLV H;  2QKC A;  3C3S A;  2L35 A;  2PY5 A;  4B3T O;  4LF8 O;  5CMU A;  5LHG A;  5H2F Z;  2IU3 A;  4GLX A;  1OZ0 A;  3SR2 C;  2DN9 A;  3AK3 A;  2HG5 C;  1ORQ C;  5ITZ B;  3AG4 B;  1SS3 A;  3W7U A;  2N74 A;  1W0J G;  4HAM A;  3RYF A;  1LUV A;  2DQ3 A;  1EM1 A;  1B04 A;  3HKE A;  2RCV A;  1J5E B;  1QCE A;  3MAQ A;  4LF4 B;  1M56 B;  3ETG A;  3GB7 C;  3SYC A;  3MHS C;  1VQ4 V;  3QNE A;  4R7C A;  3N27 A;  2IH3 C;  1XL4 A;  4DUZ B;  4NXM O;  4CH6 A;  5D5P A;  4AQY B;  2Y69 B;  2GV9 A;  4UVB A;  4MVS A;  3ZMT A;  4LWS B;  4DXW A;  3ZN0 A;  3HB3 B;  2XOK G;  2Q68 A;  1LNQ A;  5EBM C;  1KC8 W;  3JAR A;  1GO3 F;  5FL7 G;  4LF7 O;  4J42 A;  1Q6H A;  2XUM A;  5LL6 Y;  1XMQ O;  3ML0 A;  4B3T B;  3ASN C;  3FAV A;  3T4Z A;  4PI0 A;  3M7M X;  3FFQ A;  2JJ1 G;  3AK2 A;  5B1N A;  5L3F A;  3MDS A;  5E79 Z;  3ZX6 A;  2K1E A;  3K57 A;  4UUJ C;  5KHI A;  4WFA V;  2JK5 C;  4P2Z A;  4WFE A;  3T1Y O;  4E4E A;  1WB7 A;  4PA7 A;  3JCZ A;  2Q67 A;  4DUZ O;  4NXM B;  4A5U B;  1R6K A;  3EXA A;  3QVN A;  1V54 C;  1F7Y A;  2RNB A;  4B08 A;  3M99 B;  1XNQ B;  3W7X A;  2JEU A;  1QR9 A;  4J10 A;  3ZHQ A;  4PA4 A;  3RYC B;  4R8C A;  2XAF A;  5GON B;  4PHZ A;  1QU7 A;  4I9W A;  1N34 B;  3TXQ A;  1Q90 D;  4DV6 O;  2BSK B;  4H33 A;  1AR5 A;  1AR4 A;  2EIL C;  5C93 A;  3MHH C;  1TGO A;  3OMA B;  3N2G B;  1HDJ A;  4JI7 O;  4TV8 A;  5IYZ B;  3GWO A;  5E1A C;  2CAZ C;  3BRC A;  1YHQ V;  4JI2 B;  3A0H Z;  5JWP A;  2DYR B;  3D36 C;  3LSQ A;  4X1Y B;  3B77 A;  3NXS A;  4Q20 A;  4CC5 A;  3BAA A;  2QR4 A;  4K35 A;  4NB5 A;  4JI0 O;  2BTQ B;  4NYK A;  3AEI A;  1XL6 A;  3AK1 A;  4X1I B;  4K0K O;  3E83 A;  2UUA O;  2DE0 X;  5LHI A;  3TXS A;  2Z5U A;  4DV6 B;  5AG2 A;  1R6N A;  1LR1 A;  3VOU A;  4PA6 A;  2FL4 A;  2E76 B;  1D2D A;  1YF2 A;  5KAF Z;  1QHT A; 
#chains in the Genus database with same CATH homology
 1IDS A;  3DC5 A;  1MMM A;  5A9G A;  2ADP A;  1MA1 A;  4GUN A;  4F6E A;  3OT7 A;  1MNG A;  4E4E A;  1WB7 A;  1ZUQ A;  2P4K A;  3K9S A;  3TJT A;  1BT8 A;  4JZG A;  1JR9 A;  4YIO A;  4BR6 A;  3QVN A;  4JYY A;  1ZTE A;  1XRE A;  1GN2 A;  1D5N A;  3BFR A;  1AP5 A;  1B06 A;  1GN4 A;  1IXB A;  1BSM A;  1KKC A;  2QKC A;  3C3S A;  1VAR A;  3LSU A;  2ADQ B;  1ZLZ A;  1EN6 A;  2QKA A;  1EN5 A;  1AR5 A;  1AR4 A;  3EVK A;  1I08 A;  1IX9 A;  3AK3 A;  3KDR A;  4X9Q A;  1MSD A;  2GDS A;  3CEI A;  1LUV A;  4FFK A;  1XIL A;  1EM1 A;  4JZ2 A;  4C7U A;  2RCV A;  1PL4 A;  1EN4 A;  4YIP A;  3DC6 A;  1JA8 A;  1Y67 A;  1N0N A;  3C3T A;  1XUQ A;  1PM9 A;  1GN6 A;  2CDY A;  1XDC A;  3AK1 A;  3IC9 A;  1GN3 A;  3RN4 A;  1LUW A;  1QNM A;  1P7G A;  1WB8 A;  1I0H A;  1AVM A;  3KKY A;  5AG2 A;  1AP6 A;  1SZX A;  1N0J A;  1BS3 A;  1VEW A;  2CE4 A;  1ZSP A;  2AW9 A;  3AK2 A;  3MDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...