3AK2A

Superoxide dismutase from aeropyrum pernix k1, mn-bound form
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
211
structure length
211
Chain Sequence
MVSFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAVMRDFSFNYAGHIMHTIFWPNMAPPGKGGGTPGGRVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDPLTEELRILQVEKHNVLMTAGLVPILVIDVWEHAYYLQYKNDRGSYVENWWNVVNWDDVEKRLEQALNNAKPLYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn/Fe]
publication title Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 - insights into the enzyme mechanism and stability
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 72
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ak2A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ak2A02
4E4EA 3BFRA 1AVMA 4C7UA 3C3SA 1AP6A 1IX9A 2AW9A 1JA8A 1WB7A 3OT7A 1I08A 1XUQA 4GUNA 4YIOA 3DC5A 3LSUA 1LUWA 1QNMA 4X9QA 1SZXA 2RCVA 1AR5A 1ZTEA 1LUVA 2QKAA 1BT8A 2GDSA 4YIPA 5AG2A 3AK3A 4F6EA 1GN3A 1MMMA 1EM1A 1ZUQA 2QKCA 1I0HA 1B06A 1MSDA 3TJTA 1N0NA 1VARA 2P4KA 1PM9A 4BR6A 3AK2A 3IC9A 1MNGA 1GN2A 1XREA 1JR9A 1D5NA 3C3TA 3AK1A 1ZLZA 1GN6A 2CDYA 1EN5A 3K9SA 3RN4A 1P7GA 1GN4A 3DC6A 1AR4A 1IXBA 1MA1A 3MDSA 1IDSA 3CEIA 4JZ2A 3KKYA 4FFKA 1N0JA 2ADPA 2ADQB 3EVKA 1BS3A 1EN4A 1EN6A 3QVNA 4JYYA 5A9GA 1XILA 4JZGA 1ZSPA 1BSMA 1KKCA 1VEWA 1XDCA 1AP5A 1PL4A 1WB8A 1Y67A 2CE4A
chains in the Genus database with same CATH superfamily
4JI4B 5KAFZ 4IGGA 3PJSK 3ZRVA 2Q4PA 2DJVA 4YJ2A 2XAFA 3H1IH 5LOVB 4UVBA 4LF7O 3F5WC 1NZ6A 3OT7A 3OFNG 1N33B 2DE0X 4IT5A 4RWUA 2CTQA 2JJ1G 1S5HC 4J7ZA 2EJ7A 2BSKB 2X6AA 3ABMC 5B66Z 1FFTB 3G80A 4PHZA 2UUCO 2QJ1A 1V55C 4MVSA 2FTKA 4CC6A 4LCUC 4GYCB 4Q6GA 3WB1A 1VF6C 1SETA 3FD9A 1KBHA 1EFRG 2RDCA 4OPAA 1T5EA 5LMNO 1PPJH 2Q7HA 3L74H 1EM1A 1U96A 4WCEV 4UCVA 4PV1B 4PA4A 1GKFA 2JGUA 1R6NA 4CS3A 1S3JA 3LSSA 5HFLA 3J80N 1PL0A 2QTOA 4ZHQA 2CUGA 4FPPA 1TUBB 3L9DA 4JI7O 3K0DA 2HLDG 5LGNA 2ZM6O 1AI7A 2YIBA 4DR2O 4CBCA 1KB9F 3RYCB 1US6A 2LJ2A 3OR7C 1P7GA 3E22B 3K03A 1AR4A 5IJ9A 1IXBA 2Y69C 4X62B 1Y74B 3T1HB 5LP6A 4LFAO 5FPOA 3JAKB 4HNAB 5A2QN 1HNWO 4H0LB 4WFGA 4WF9V 2N74A 4DR7B 3S3XA 2PY5A 2ZE6A 3ABTA 3ZMUA 3TCUA 2GUZB 1Q43A 4X1YB 2E76B 3B8MA 1VQKV 2ARHA 4O4HB 2MK3A 4K0KB 4O2AA 3WFVA 4JAAA 4WFHA 1KU9A 2VWKA 4YY3O 2OWOA 4FVMA 1RPRA 2Y48A 3K5OA 5IJ0B 4DV6B 1K34A 1ZTEA 2ETNA 1A32A 3HPLC 4J42A 3JALA 3JARA 1YXBA 2ODMA 2X6CA 3G4SV 1Z2GA 2CTPA 4EEQA 3L75H 2JIZG 1Y76B 3GWKC 4X1IB 5B3SB 1O9HA 4DR1O 1MSDA 4TQDA 1VQ9V 4I50A 3G71V 3K0GA 2WLIB 4BR6A 2QKSA 4GCZA 4LF6B 3VBBA 4LWSB 3N2GB 3ETQA 5JJEB 5B1OA 2ZE7A 1H8HG 3K3WA 2A06H 3B40A 4DV0B 3HKDA 4J7JA 1NR7A 2KQXA 4TUYA 2QM4A 3CHXA 3CX5F 2E5LO 2HR3A 4YJ3B 5C8YA 2ZD9A 5L3BA 4DV5O 3CCSV 2PI4A 4MVRA 1BS3A 3JAWA 4MTOA 1EN4A 1EN6A 5L3FA 3LDDA 1AI5A 4O4JB 2FMLA 1YZBA 2F23A 4YHHO 1XILA 2QTSA 4LP8A 4DW0A 2VQFB 2EIMC 2IJHA 2UUAO 4X65B 1M93A 4NB5A 1KUQA 2QWOB 4PD4F 2JGDB 1Q7YW 1IX9A 4DR5B 2AW9A 3JASA 3KCXA 4U3FH 3G6EV 5KMGB 3LSQA 4DYLA 4JTCB 1NKDA 3LSUA 2IU3A 4JYAO 3T4ZA 4MVQA 1B3QA 1VF7A 2EILB 2QKAA 2V7QG 2FKXA 3J81N 4DO2A 2CGNA 4UUJC 3AG4B 4WFEA 1N4CA 4CS2A 5GTHZ 1QR8A 3MD0A 4EB6A 4NXNO 1JJOA 3ZHQA 2VQEB 5FNVA 4D7SA 1PM9A 1I94O 4J9YB 1B04A 1M9NA 3THOA 2GHYA 2GTAA 1VQLV 3OAAG 2EIKB 1AI6A 2QA4V 4WFBV 1R6TA 2KG7A 4K35A 3BHPA 1LNQA 1ZL8A 4GZRB 4JI1O 4PI2A 4LFCB 2B1GA 1IBMB 2G38A 3CEIA 1XMOB 1NTZH 1XNQO 1BGYH 2D2CB 1H2KA 1Q5OA 3A0RA 4DK1A 5KX5A 2CK3G 1TGOA 3ZEDA 5B3SC 3SJCC 4KUMA 1PL4A 4LH6A 5D5PA 3D36C 5IE9A 2ZXWB 4DV3O 1FPOA 1IXMA 5LGUA 2F4VO 5IT9N 1YTFB 4PA9A 5CA0A 3D3QA 2ZE8A 1MG1A 1NH2B 3CXCU 4KHPO 4MT8A 3LNNA 5H6RA 4GT1A 3K5LA 1NVPD 4I7ZB 1DF5A 4WBNB 1PNLA 1VQ5V 1IBKO 3L70H 3ASNC 4BIOA 3U11A 1YF2A 3TXSA 4UB8Z 5AG2A 1URFA 3K5MA 3BABA 4LF5B 2H94A 1YHQV 4JF3A 3ZMTA 4KFMA 3I56V 4PDRA 1B06A 3ICXA 3ABLB 4FLWA 1JCHA 1OZ0A 3VOUA 4CH6A 1GN2A 1G6UA 2Z0AA 4XBFA 1KD1W 5DN6G 2OT5A 2Q69A 2HFEC 4O2BB 4CS4A 3FB6C 1W0JG 3SYAA 5J2TB 3CC4V 4N21A 1AI4A 5B1AB 3K57A 2PTMA 3DSQA 3E35A 4F4LA 1YVWA 5IYZB 5DECA 4A5UB 1YJ9V 1IVSA 3O9OA 2FB5A 1OCCC 4D7TA 3JATB 4HYOA 3FX7A 1SRYA 3AG4C 3ZHRA 4X64B 2X6BA 5H6QA 4DR4O 4NXMO 5A9GA 2RJZA 1BSMA 2QWPB 3DTUB 4X66B 4GKJB 2ATKC 2UU9B 3CPWU 3OEEG 2YEVB 2RQ6A 3BFRA 1V55B 2OTLV 1FYJA 1GRJA 3FB7C 2UUBO 3LNMB 1S5LZ 3E8GA 2EIKC 1RFYA 3W7WA 5J2UB 1N34O 1I08A 2R9AA 2XNDG 3SYQA 4GUNA 4MW3A 4W4LA 2B1IA 1KP2A 4ZI7B 2PYLA 4LNUB 4TOIA 4JI6B 1QNMA 5IWAO 1IZ3A 3VQVA 2RCVA 3DXRB 1Q6UA 1WA8A 4LR3A 4OX9O 2Q8VA 5KHKA 3ZRWA 4EFEA 4Q20A 1YI2V 4KL1A 3ZRXA 1NT2B 1QLEC 2LW7A 1FXKA 1R3JC 1J5EB 5JJJB 1RSOA 2ZXWC 3W7XA 5JQGA 4TWKA 2DWDC 3RBZA 5EBMC 1HNXB 5JJNB 1XNRB 2UXDB 4P9PA 5D5QA 1XEQA 4DR3B 1TVKA 3H01A 3CCJV 3BAAA 1K4CC 4XDLA 5KHIA 2CH7B 3QO8A 4B7EA 4I4TB 4U7NA 3MHSC 2YUAA 3CCUV 5EIBD 2W0XA 2P06A 4L8JA 3CJHA 5GONB 2XOKG 2IU0A 1VQNV 3FAVB 4NTWA 2GSMB 5KUKA 2DYSC 3Q4HB 1V9PA 1QBZA 3OUSA 5LOVA 3CC2V 1ZSPA 5C93A 4FLVA 3G67A 1G8MA 2F43G 4OPHA 1BHAA 4UB6Z 5HFMA 2ZKOA 1WN7A 1Q82W 2IJKA 4QGPA 2BSKA 4JPRA 3C3SA 2K1EA 5GW7A 4BAYA 1DGSA 1OHHG 5EYPB 3E2EA 3EHBB 4DRXB 1V54B 3HKCB 1JNBA 1R6KA 5B1AC 2OCHA 2NLJC 4IL6Z 4IIJA 1NJIW 2QR4A 2QDOA 4IHJB 4I55A 3GVMA 4K3AA 4JI3B 1I5YA 4RQEA 1LR1A 5CA1B 3UO3A 3CWBH 4OGQB 4MS2A 4JI0O 4JI5B 2WLNA 1ZUQA 3HR0A 3M7MX 4IYIA 2DOSA 1AB3A 2YXLA 4B3RB 4LFBO 4O4LB 2ZR3A 3RYIB 1L8DA 1YEWA 4OXSA 5LHHA 4DV7O 1D5NA 4KXRA 4U3JB 3OR6C 4QE7A 4B3SO 3E22A 1WP8A 1FKAO 5FPRA 1Y74A 2BTQA 1Z5VA 3K5NA 3JAKA 3B4SA 4HNAA 3ZIAG 1PV0A 2HEPA 3L71H 3C90A 4HAMA 5IDJA 3K9SA 4LF4B 3QG5A 1K5SA 5CB4A 4PJ0Z 4AILC 2EIMB 2Y0IA 5CBHA 1G1XB 3N2KB 3HKBB 4TT3G 4FLXA 2WA4A 2ZIOA 3AG2B 2GUZA 1GM8A 2ZCEA 4X1YA 4DUYB 4TV8A 4O4HA 1XBLA 4YJ2B 1KKDA 2A79B 1VEWA 1GH6A 3A0BZ 1H38A 1Y67A 4PELA 2CE4A 5DEDA 3STLC 2A3QA 3IFXA 1R1BA 4L87A 3ZJZA 1S0VA 1HDJA 5L3DA 4UVAA 3ZMSA 3BPZA 5K1PA 4FLTA 2WLJA 2N04A 5KA5A 4KP4A 5EBWC 4JV5O 1SS3A 2YXYA 3UCSC 3CCLV 5IJ0A 3IC7A 3F7YC 3JD2A 4DV1B 2Q5ZA 2ZDIC 3OMNB 3JCZA 3FB5C 5LHIA 5IYBO 3OTOO 1M90W 2XT9A 2A9HA 1Y76A 1QQCA 2P7TC 5EBLC 2PF4E 1SC5B 2AXTZ 2ITDC 4O4IA 1K7DA 1RP3B 1JFFB 3DGEA 5JH7A 4LF7B 4QPKA 1SQPH 3UT5B 4LWSA 4FZ1A 3APQA 4DV4B 2EJRA 5LXTA 2UUCB 1PNMA 4N23A 1JX9A 3APOA 3FFQA 3JSNA 2OYQA 3RFRA 4FMTA 2JS5A 4X1KB 1V54C 4CH5A 4LF9O 2NN4A 4BW5A 5LMNB 2F93B 4YJ3A 2EINB 1BCCH 2EZPA 1PD3A 4FJCC 3CS5A 2JRIA 3BA9A 4O4JA 2WLHA 1UFIA 4UV8A 4GKKO 2LO1A 4JZ2A 3TXQA 3KKYA 5LMUO 2DW4A 3ZX6A 5BXZA 3EVKA 5FLXN 4JI7B 4YXWG 2FL4A 2KSDA 4UV9A 4D6TH 1EBOA 3RGBA 3QVNA 2HVJC 4JYYA 1NVPB 2JGDA 1DK1A 2ZM6B 4DR2B 4IYHA 3JAMN 2Q0AA 1D2DA 3NXSA 4ZKIA 2R70A 5CN0A 2JVDA 1KMIZ 3B8NA 5KMGA 1HW7A 1AVMA 3ASNB 3LDCA 1BL8A 3B77A 3QTCA 3TGUH 4LFAB 1N32O 1L1FA 4PI0A 1AROP 3ZMZA 1HNWB 1AJQA 5JVDB 2HKOA 3QO7A 4NTYA 2X0LA 1XMQO 1BHBA 3JALB 4DV2O 4JTDB 1TA8A 2PUSA 4X9QA 3EXAA 4BIUA 1VMGA 1PP9H 3AG2C 3B2EE 5L3CA 3ZHSA 3RWRD 1HR0O 4FIPC 1Z5WA 1MMMA 4TSFG 5LA6B 3SYCA 2P4VA 1K4DC 4YY3B 4K8ZA 1VARA 3ZHVA 4UCRA 4FM0A 3E89A 3RW0A 4H33A 5CBFA 3AK2A 4GX0A 1OCCB 2PYJA 4ABMA 2PZSA 1MABG 2NR5A 1HWYA 3ZRSA 1Q6IA 1YSCA 2BOBC 4E2LA 4X8AA 1L0NH 5C8YB 3A0HZ 3ABKC 3SPJA 1F7YA 4RAIA 3K58A 4DR1B 3BRCA 2F95B 3JAWB 3CP1A 1WPXA 5EZYB 5K1XA 3W7TA 4X20A 1HP8A 1WLEA 5H5NA 2E3CA 1JVMA 1NR1A 5KHHA 2IJJA 4XDJA 3F5TA 3UQ8A 2OCCB 2QM7A 4FM1A 2CTRA 1IBLO 1F4MA 4TV9B 3CCQV 1X4TA 2E5LB 2YIBD 1M56B 5H2FZ 1K73W 4DR6B 4DV5B 4J41A 4FFBB 5LP6C 2EINC 1SQGA 1JMKC 4ZBMA 4YHHB 4PDVA 3NR7A 3ZN1A 1QLEB 1FJGO 3SR2C 1SZXA 1EZJA 1GM7A 1XL4A 5B1NA 2WPDG 2UUAB 1JOYA 2GDSA 3D3IA 3OMAB 4AQYO 1RPOA 3P32A 4JAVA 1SA0A 4F6EA 1KC8W 4PA6A 1Y4MA 3J7AU 1DLBA 3CRQA 3WB0A 3TJTA 2BCCH 4GLXA 2K9PA 3SYPA 2YI8A 4J10A 3CYOA 4JYAB 4UFZA 2LGQA 2UXBB 5IYZA 3CD6V 3L73H 3WB2A 1VQ8V 4JI2O 3E8BA 1ZL8B 1XHXA 4Z1VA 1VQMV 4FLYA 4MSWC 2RN9A 2DYSB 2Y4TA 2E75B 3K79A 4JI6O 4NXNB 2DYRB 4LBEC 3T1YO 3RN4A 4R50A 1H5WA 2XHBA 3T2MA 4FK5C 2ILMA 4H44B 2JEUA 5KX5B 1AR1B 1IDSA 2ZNJA 5F2VO 1I94B 5L3GA 4QIWF 1QU7A 4J9ZB 4R8CA 3UM7A 1NI8A 2XAHA 2YEVA 5L3EA 4GX1A 3MAQA 3X2QC 2WWWA 2XUMA 4F6RB 1VF6A 1QR9A 1HNZO 2UXCB 1AP5A 1SF9A 2M6YA 5J2UA 1M57B 4JAUA 3IGAC 4ZI7A 3ZS8C 2EZOA 4LNUA 2XAQA 3KG2A 3JD1A 5BR8O 1K3EA 3BVOA 4FLUA 1THZA 2LFSA 4UXNA 3K59A 4X89A 3JD3A 1OV9A 3M8AA 2WLLB 2HHHO 1J95A 3L72H 4RO2A 3HKEA 5LYJB 4LC1A 1R3LC 4HZ3A 1AJPA 1GAXA 4J7KA 2YSUB 5KAIZ 2JS3A 1ZWIC 1S76D 4DUZO 4DV3B 2F4VB 2GV9A 1GN3A 2OCCC 2HG5C 3SJAC 1I0HA 5JCOC 1H2MA 3SDLA 1W59A 4KHPB 1H2GA 2P4KA 4U7OA 3FKSG 3ABUA 1FOUA 3SGIA 1KP3A 1IBKB 2CH7A 5EC2C 5CA3A 3I5DA 1H8EG 4I4TA 1JR9A 1ENVA 2RMKB 3W7SA 4NVPA 5BMVB 1M56C 3AK1A 4MW8A 1NQTA 1QHTA 1QCEA 3RT3C 3H1LH 2DWEC 4LF8O 3SJQC 1N36O 3ZHTA 3FAVA 1F4NA 3KZIZ 4ICGA 4JI8O 4JI4O 3DC6A 1I7FA 1SZTA 3RYHB 1VF5B 3IJ4A 3K9AA 2OTJV 4NYKA 1MZFA 1WAZA 1IJGA 3RYFA 1N0JA 1SESA 2ADQB 4ZOLA 3FYEB 1N33O 5CBGA 4CC5A 2LGWA 3CB2A 4PDMA 3HB3B 1SQFA 3S3WA 1P7BA 3AG1C 5EYPA 3ZCCA 3D8CA 5E1AC 1XDCA 4DRXA 5EIBC 1WB8A 3HKCA 2ZR2A 1DTOA 2Z5UA 4DXWA 3O65A 3WU2Z 3IAYA 1XQ8A 2P90A 2AHZA 1FFXA 3CCMV 2YS8A 3SJBC 1M1KW 4BIZA 1Q86W 4QPJA 1BQ0A 1XUQA 2DMXA 1FAFA 2AGAA 1WA8B 2DYRC 4I9QA 4EKWA 4DR4B 4NXMB 4G2KA 2QWNB 1F23A 3K06A 3ZRWB 1GK9A 2WSSG 1Q6HA 1P49A 5B1BC 3TK1A 4PA7A 5E79Z 5KA6A 3RYIA 1MSWD 3SPIA 1N34B 4B3MB 3VQYA 5ITZB 4X62O 3T1HO 1OCRB 5B5EZ 5IWAB 3AG7A 1M57C 5DM6V 1U97A 1YDXA 4HBNA 4DR7O 2YC0A 4OX9B 3HKBA 1AJNA 3ZBHA 1AILA 1TUBA 2P5OA 2H8PC 3FB8C 1K9MW 1FXHA 2EX3A 3OD4A 1MA1A 2HP8A 4FZ0A 1KQSU 3BEHA 3SYOA 3RYCA 4GX5A 4K0KO 3I55V 4PA3A 1H2NA 1E1QG 2B9ZA 3JSLA 4GX2A 3SPGA 1DF4A 1WJZA 3CCEV 4QE9A 1W2BU 2Y4UA 2F1MA 4J80A 4DV4O 3MHHC 1BQZA 4I0XB 1BMFG 4DV6O 1B6QA 1Q8IA 2EBOA 1N8RW 2EIJC 2WAMA 4IIJB 4R7CA 1JPXA 3UO2A 3ASOB 1JA8A 3OTFA 5KUMA 2YDEA 4CH4A 2Q7GA 4YIOA 1TUEB 4I55B 1QVFU 3CRRA 3QNEA 1JFFA 4B08A 3OEHG 1AR5A 3UT5A 4LF6O 2LFRA 1JQ0A 2Z3YA 4NTXA 1UPGA 4B3TB 4DV0O 2HVKC 2ZIMA 3CRAA 3BCCH 2QKCA 1ZAUA 1GMGA 3E83A 4FM2A 1H2SB 3A8TA 3ABKB 4X1KA 3OW2U 3KDRA 2BTQB 3IC9A 3F7VC 4P9OA 4X1IA 2KB1A 1YITV 1RM1B 4ZIBA 5KHGA 4QJFB 1M5IA 5CB4B 2CAZC 2WLIA 3CXHF 3D36A 1K8AW 3LUTB 3AEIA 4ZHQB 4JI0B 2VQFO 1EN5A 1E79G 3N2GA 1S77D 2DN9A 4X65O 2LP7A 2QWRB 1Q3EA 1M4UA 4TV8B 4LFBB 2AHYA 3WG7B 1YIJV 4DR5O 3CCVV 4MVOA 2LQTA 4DV7B 5KHJA 2IM9A 4B3SB 1Q90D 1FXKC 3ZHUA 5IJ9B 1EZVH 5LP6B 1SQVH 1P4RA 2ZT9B 2L35A 2ZNIA 1OCRC 3K04A 5JVDA 2Q68A 4E4EA 3R65A 1CP9A 1AP6A 4EFBA 4G27B 5TISZ 2VQEO 3E8HA 2Q73A 2BE3A 2HJDA 1L0LH 3CRCA 3DC5A 5CMUA 1I5XA 2QGNA 4O2AB 1YCIA 5LA6A 4O4IB 2O57A 2YXHA 5JH7B 3P30A 2WLMA 2YIAA 4UCOA 3P3PA 4YIPA 2P6JA 2DQ3A 1VQPV 4RUEA 4JV5B 3KCYA 3M99B 4RQFA 5LXTB 4LFCO 1IBMO 3JARB 4BW9A 1PNKA 3OTOB 1XMOO 2XAGA 1NTKH 1Y66A 1XREA 3T4DA 4DR6O 4UCTA 1E1RG 1ZLZA 4I5SA 3ASOC 1WP7A 4I50B 5EZYA 2IBZH 4XDKA 2QWQB 2D3OW 1R3KC 3OGCC 3X2QB 2Q67A 3OMIB 4W4KA 1XL6A 4P30A 2JJ2G 1JJ2U 1VQOV 4MTXA 5JCOA 1GM9A 2UXXA 3E86A 1VQ7V 1NU1H 1MZEA 3STZC 4WFAV 3HKDB 4TV9A 4TUYB 2ITCC 3VQWA 2JK5C 2LW1A 3JD0A 4LF9B 2WLKA 3VQXA 5LL6Y 2NNUA 1X59A 2P22C 4FFBA 1NS1A 5J9PC 2UXBO 4JYBA 5FL7G 2Q0OC 2BOCC 4C7UA 4LF5O 1OCOB 1RM1C 1OCZB 4GKKB 1R73A 3QF7A 5LMUB 4CZZA 1WB7A 2IH1C 5IYDO 2PGGA 3BA8A 2XASA 1TAEA 3FYIB 4P2ZA 1ORQC 2IJIA 2VS0A 2KKWA 4JYCA 1LUWA 3JASB 3GB7C 2YI9A 3WG7C 2WA3A 4NKGB 3H1HH 1VIBA 3G6BA 4WBNA 3AK3A 2YICA 1WNSA 5BY1A 4JTAB 1N32B 1MOFA 2GBOA 4DK0A 2UXCO 4MVZA 2ZE5A 1FS0G 1K97A 1N0NA 2GTSA 1UJWB 1H2LA 2IH3C 1XMQB 2Y0PA 4H37A 4DV2B 2L6LA 3EFFK 4EB6B 3LDEA 1MNGA 1SKVA 2QE7G 3C3TA 4X64O 1CEZA 2VRZA 1SQQH 1K5QA 4CH3A 1GN6A 5FNVB 5H9CA 2E74B 1HR0B 1XI1A 2B5UA 2C2AA 1VP7A 4X20B 3ZMVA 4O2BA 3AG3B 4X66O 4GKJO 2QSAA 3AG1B 2UU9O 2FYUH 2QM8A 1GN4A 4Z1MG 2XTAA 5J2TA 2V4DA 4QNHB 3CMEV 3R66A 1XOUA 4F6RA 2KG7B 1Q81W 2W0FC 4JASA 4JGSA 2H3OA 3JCUZ 3CRMA 3U0ZA 1GTOA 3JATA 2MW2B 3H9VA 1W0KG 4BWAA 4JZGA 5IY5B 2OIEA 5EC1C 1YJNV 3W7UA 3RVZA 2WLLA 4G28B 3OUFA 3ZN0A 5LYJA 5B1BB 4FLZA 3B09A 1K92A 3N27A 5KLVH 2R9IA 2DQ0A 5GTIZ 1J5EO 1K33A 1SA0B 2A0LA 4J11A 3H1JH 1CXZB 1IBLB 4UCSA 1HNXO 1SQXH 4JI1B 3SPHA 5CA0B 1XNRO 4AHCA 1BT8A 2UXDO 1KECA 4DR3O 1NBMG 4PDLA 4NR1A 1XNQB 2IW5A 2XAJA 3ETEA 3DXRA 5JWPA 4UCUA 5BMVA 1R3IC 2W6IG 3H1KH 3CE2A 1XHZA 2EILC 1FJGB 1OCOC 2V1DA 1OCZC 2OIGA 2Q7EA 4ASUG 2JEXA 1P84F 2EULA 3RYHA 4AQYB 3SPCA 2CGOA 4LH7A 1CPYA 4K8XA 2HJFC 2YIDA 1OJHA 2AZ0A 4B7KA 3ABMB 1VQ4V 3A2FA 1GO3F 1PKXA 5IYCO 5EK0A 3OE7G 4TQFA 3MDSA 2ZDIA 3JYCA 4FFKA 2EIJB 4JI2B 2PI5A 1SQBH 4B3MO 4MTFA 5BZBA 2BTOA 5GONA 2N05A 3RVYA 1FD9A 3T1YB 4R6ZA 2F66C 3CSXA 3Q4HA 2W6JG 4WFFA 4JI3O 3BY6A 1ROPA 1S72V 3PN1A 3HKEB 4MVUA 4JI5O 1QLNA 3GWOA 1QVGU 2VWJA 1IURA 4MTGA 1F51A 4B3RO 3AG3C 1G4YB 2M7WA 3K08A 3P3NA 4X88A 1HNZB 1D5AA 1WPBA 1S5JA 2Y69B 1KYOF 1LUVA 1O9GA 2X7RB 3CMAV 4MVMA 2UXNA 5ITZA 2AZ2A 5LGTA 4IHJA 1VQ6V 5BR8B 5LHGA 3QO5A 1YTFD 4H13B 4LF4O 1COWG 3CCRV 2P67A 1YJWV 2JDIG 4I9WA 2HHHB 5IY5C 5CA1A 1NH2D 5LBQA 2CTWA 1Y6XA 1SERA 4Z2WA 1BE3H 3E8FA 3TETA 3ETGA 4DUYO 3UKMA 4DUZB 2Q9LA 4O4LA 2UUBB 2ZINA 3T1CA 1FXKB 2CDYA 1RSOB 4U3JA 5JQGB 3RYFB 3ABLC 1FXVA 4ZOLB 3OGIB 2Q6AA 3OM3B 3CC7V 3JD4A 1TVKB 2R72A 2RNBA 4B3TO 1NTMH 1ZX3A 2A7WA 4I0XA 2ADPA 4DW1A 4DV1O 3ML0A 1BZKA 3N2KA 4AI8A 3ETDA 4LF8B 4UVCA 2ZQMA 3CJHB 1KKCA 1FFXB 1N36B 2QEXV 4JI8B 4RUFA 2R9RB 3U10A
chains in the Genus database with same CATH topology
4E4EA 3BFRA 1AVMA 4C7UA 3C3SA 1AP6A 1IX9A 2AW9A 1JA8A 1WB7A 3OT7A 1I08A 1XUQA 4GUNA 4YIOA 3DC5A 3LSUA 1LUWA 1QNMA 4X9QA 1SZXA 2RCVA 1AR5A 1ZTEA 1LUVA 2QKAA 1BT8A 2GDSA 4YIPA 5AG2A 3AK3A 4F6EA 1GN3A 1MMMA 1EM1A 1ZUQA 2QKCA 1I0HA 1B06A 1MSDA 3TJTA 1N0NA 1VARA 2P4KA 1PM9A 4BR6A 3KDRA 3AK2A 3IC9A 1MNGA 1GN2A 1XREA 1JR9A 1D5NA 3C3TA 3AK1A 1ZLZA 1GN6A 2CDYA 1EN5A 3K9SA 3RN4A 1P7GA 1GN4A 3DC6A 1AR4A 1IXBA 1MA1A 3MDSA 1IDSA 3CEIA 4JZ2A 3KKYA 4FFKA 1N0JA 2ADPA 2ADQB 3EVKA 1BS3A 1EN4A 1EN6A 3QVNA 4JYYA 5A9GA 1XILA 4JZGA 1ZSPA 1BSMA 1KKCA 1VEWA 1XDCA 1AP5A 1PL4A 1WB8A 1Y67A 2CE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E4E A;  3BFR A;  1AVM A;  4C7U A;  3C3S A;  1AP6 A;  1IX9 A;  2AW9 A;  1JA8 A;  1WB7 A;  3OT7 A;  1I08 A;  1XUQ A;  4GUN A;  4YIO A;  3DC5 A;  3LSU A;  1LUW A;  1QNM A;  4X9Q A;  1SZX A;  2RCV A;  1AR5 A;  1ZTE A;  1LUV A;  2QKA A;  1BT8 A;  2GDS A;  4YIP A;  5AG2 A;  3AK3 A;  4F6E A;  1GN3 A;  1MMM A;  1EM1 A;  1ZUQ A;  2QKC A;  1I0H A;  1B06 A;  1MSD A;  3TJT A;  1N0N A;  1VAR A;  2P4K A;  1PM9 A;  4BR6 A;  3AK2 A;  3IC9 A;  1MNG A;  1GN2 A;  1XRE A;  1JR9 A;  1D5N A;  3C3T A;  3AK1 A;  1ZLZ A;  1GN6 A;  2CDY A;  1EN5 A;  3K9S A;  3RN4 A;  1P7G A;  1GN4 A;  3DC6 A;  1AR4 A;  1IXB A;  1MA1 A;  3MDS A;  1IDS A;  3CEI A;  4JZ2 A;  3KKY A;  4FFK A;  1N0J A;  2ADP A;  2ADQ B;  3EVK A;  1BS3 A;  1EN4 A;  1EN6 A;  3QVN A;  4JYY A;  5A9G A;  1XIL A;  4JZG A;  1ZSP A;  1BSM A;  1KKC A;  1VEW A;  1XDC A;  1AP5 A;  1PL4 A;  1WB8 A;  1Y67 A;  2CE4 A; 
#chains in the Genus database with same CATH topology
 4JI4 B;  5KAF Z;  4IGG A;  3PJS K;  3ZRV A;  2Q4P A;  2DJV A;  4YJ2 A;  2XAF A;  3H1I H;  5LOV B;  4UVB A;  4LF7 O;  3F5W C;  1NZ6 A;  3OT7 A;  3OFN G;  1N33 B;  2DE0 X;  4IT5 A;  4RWU A;  2CTQ A;  2JJ1 G;  1S5H C;  4J7Z A;  2EJ7 A;  2BSK B;  2X6A A;  3ABM C;  5B66 Z;  1FFT B;  3G80 A;  4PHZ A;  2UUC O;  2QJ1 A;  1V55 C;  4MVS A;  2FTK A;  4CC6 A;  4LCU C;  4GYC B;  4Q6G A;  3WB1 A;  1VF6 C;  1SET A;  3FD9 A;  1KBH A;  1EFR G;  2RDC A;  4OPA A;  1T5E A;  5LMN O;  1PPJ H;  2Q7H A;  3L74 H;  1EM1 A;  1U96 A;  4WCE V;  4UCV A;  4PV1 B;  4PA4 A;  1GKF A;  2JGU A;  1R6N A;  4CS3 A;  1S3J A;  3LSS A;  5HFL A;  3J80 N;  1PL0 A;  2QTO A;  4ZHQ A;  2CUG A;  4FPP A;  1TUB B;  3L9D A;  4JI7 O;  3K0D A;  2HLD G;  5LGN A;  2ZM6 O;  1AI7 A;  2YIB A;  4DR2 O;  4CBC A;  1KB9 F;  3RYC B;  1US6 A;  2LJ2 A;  3OR7 C;  1P7G A;  3E22 B;  3K03 A;  1AR4 A;  5IJ9 A;  1IXB A;  2Y69 C;  4X62 B;  1Y74 B;  3T1H B;  5LP6 A;  4LFA O;  5FPO A;  3JAK B;  4HNA B;  5A2Q N;  1HNW O;  4H0L B;  4WFG A;  4WF9 V;  2N74 A;  4DR7 B;  3S3X A;  2PY5 A;  2ZE6 A;  3ABT A;  3ZMU A;  3TCU A;  2GUZ B;  1Q43 A;  4X1Y B;  2E76 B;  3B8M A;  1VQK V;  2ARH A;  4O4H B;  2MK3 A;  4K0K B;  4O2A A;  3WFV A;  4JAA A;  4WFH A;  1KU9 A;  2VWK A;  4YY3 O;  2OWO A;  4FVM A;  1RPR A;  2Y48 A;  3K5O A;  5IJ0 B;  4DV6 B;  1K34 A;  1ZTE A;  2ETN A;  1A32 A;  3HPL C;  4J42 A;  3JAL A;  3JAR A;  1YXB A;  2ODM A;  2X6C A;  3G4S V;  1Z2G A;  2CTP A;  4EEQ A;  3L75 H;  2JIZ G;  1Y76 B;  3GWK C;  4X1I B;  5B3S B;  1O9H A;  4DR1 O;  1MSD A;  4TQD A;  1VQ9 V;  4I50 A;  3G71 V;  3K0G A;  2WLI B;  4BR6 A;  2QKS A;  4GCZ A;  4LF6 B;  3VBB A;  4LWS B;  3N2G B;  3ETQ A;  5JJE B;  5B1O A;  2ZE7 A;  1H8H G;  3K3W A;  2A06 H;  3B40 A;  4DV0 B;  3HKD A;  4J7J A;  1NR7 A;  2KQX A;  4TUY A;  2QM4 A;  3CHX A;  3CX5 F;  2E5L O;  2HR3 A;  4YJ3 B;  5C8Y A;  2ZD9 A;  5L3B A;  4DV5 O;  3CCS V;  2PI4 A;  4MVR A;  1BS3 A;  3JAW A;  4MTO A;  1EN4 A;  1EN6 A;  5L3F A;  3LDD A;  1AI5 A;  4O4J B;  2FML A;  1YZB A;  2F23 A;  4YHH O;  1XIL A;  2QTS A;  4LP8 A;  4DW0 A;  2VQF B;  2EIM C;  2IJH A;  2UUA O;  4X65 B;  1M93 A;  4NB5 A;  1KUQ A;  2QWO B;  4PD4 F;  2JGD B;  1Q7Y W;  1IX9 A;  4DR5 B;  2AW9 A;  3JAS A;  3KCX A;  4U3F H;  3G6E V;  5KMG B;  3LSQ A;  4DYL A;  4JTC B;  1NKD A;  3LSU A;  2IU3 A;  4JYA O;  3T4Z A;  4MVQ A;  1B3Q A;  1VF7 A;  2EIL B;  2QKA A;  2V7Q G;  2FKX A;  3J81 N;  4DO2 A;  2CGN A;  4UUJ C;  3AG4 B;  4WFE A;  1N4C A;  4CS2 A;  5GTH Z;  1QR8 A;  3MD0 A;  4EB6 A;  4NXN O;  1JJO A;  3ZHQ A;  2VQE B;  5FNV A;  4D7S A;  1PM9 A;  1I94 O;  4J9Y B;  1B04 A;  1M9N A;  3THO A;  2GHY A;  2GTA A;  1VQL V;  3OAA G;  2EIK B;  1AI6 A;  2QA4 V;  4WFB V;  1R6T A;  2KG7 A;  4K35 A;  3BHP A;  1LNQ A;  1ZL8 A;  4GZR B;  4JI1 O;  4PI2 A;  4LFC B;  2B1G A;  1IBM B;  2G38 A;  3CEI A;  1XMO B;  1NTZ H;  1XNQ O;  1BGY H;  2D2C B;  1H2K A;  1Q5O A;  3A0R A;  4DK1 A;  5KX5 A;  2CK3 G;  1TGO A;  3ZED A;  5B3S C;  3SJC C;  4KUM A;  1PL4 A;  4LH6 A;  5D5P A;  3D36 C;  5IE9 A;  2ZXW B;  4DV3 O;  1FPO A;  1IXM A;  5LGU A;  2F4V O;  5IT9 N;  1YTF B;  4PA9 A;  5CA0 A;  3D3Q A;  2ZE8 A;  1MG1 A;  1NH2 B;  3CXC U;  4KHP O;  4MT8 A;  3LNN A;  5H6R A;  4GT1 A;  3K5L A;  1NVP D;  4I7Z B;  1DF5 A;  4WBN B;  1PNL A;  1VQ5 V;  1IBK O;  3L70 H;  3ASN C;  4BIO A;  3U11 A;  1YF2 A;  3TXS A;  4UB8 Z;  5AG2 A;  1URF A;  3K5M A;  3BAB A;  4LF5 B;  2H94 A;  1YHQ V;  4JF3 A;  3ZMT A;  4KFM A;  3I56 V;  4PDR A;  1B06 A;  3ICX A;  3ABL B;  4FLW A;  1JCH A;  1OZ0 A;  3VOU A;  4CH6 A;  1GN2 A;  1G6U A;  2Z0A A;  4XBF A;  1KD1 W;  5DN6 G;  2OT5 A;  2Q69 A;  2HFE C;  4O2B B;  4CS4 A;  3FB6 C;  1W0J G;  3SYA A;  5J2T B;  3CC4 V;  4N21 A;  1AI4 A;  5B1A B;  3K57 A;  2PTM A;  3DSQ A;  3E35 A;  4F4L A;  1YVW A;  5IYZ B;  5DEC A;  4A5U B;  1YJ9 V;  1IVS A;  3O9O A;  2FB5 A;  1OCC C;  4D7T A;  3JAT B;  4HYO A;  3FX7 A;  1SRY A;  3AG4 C;  3ZHR A;  4X64 B;  2X6B A;  5H6Q A;  4DR4 O;  4NXM O;  5A9G A;  2RJZ A;  1BSM A;  2QWP B;  3DTU B;  4X66 B;  4GKJ B;  2ATK C;  2UU9 B;  3CPW U;  3OEE G;  2YEV B;  2RQ6 A;  3BFR A;  1V55 B;  2OTL V;  1FYJ A;  1GRJ A;  3FB7 C;  2UUB O;  3LNM B;  1S5L Z;  3E8G A;  2EIK C;  1RFY A;  3W7W A;  5J2U B;  1N34 O;  1I08 A;  2R9A A;  2XND G;  3SYQ A;  4GUN A;  4MW3 A;  4W4L A;  2B1I A;  1KP2 A;  4ZI7 B;  2PYL A;  4LNU B;  4TOI A;  4JI6 B;  1QNM A;  5IWA O;  1IZ3 A;  3VQV A;  2RCV A;  3DXR B;  1Q6U A;  1WA8 A;  4LR3 A;  4OX9 O;  2Q8V A;  5KHK A;  3ZRW A;  4EFE A;  4Q20 A;  1YI2 V;  4KL1 A;  3ZRX A;  1NT2 B;  1QLE C;  2LW7 A;  1FXK A;  1R3J C;  1J5E B;  5JJJ B;  1RSO A;  2ZXW C;  3W7X A;  5JQG A;  4TWK A;  2DWD C;  3RBZ A;  5EBM C;  1HNX B;  5JJN B;  1XNR B;  2UXD B;  4P9P A;  5D5Q A;  1XEQ A;  4DR3 B;  1TVK A;  3H01 A;  3CCJ V;  3BAA A;  1K4C C;  4XDL A;  5KHI A;  2CH7 B;  3QO8 A;  4B7E A;  4I4T B;  4U7N A;  3MHS C;  2YUA A;  3CCU V;  5EIB D;  2W0X A;  2P06 A;  4L8J A;  3CJH A;  5GON B;  2XOK G;  2IU0 A;  1VQN V;  3FAV B;  4NTW A;  2GSM B;  5KUK A;  2DYS C;  3Q4H B;  1V9P A;  1QBZ A;  3OUS A;  5LOV A;  3CC2 V;  1ZSP A;  5C93 A;  4FLV A;  3G67 A;  1G8M A;  2F43 G;  4OPH A;  1BHA A;  4UB6 Z;  5HFM A;  2ZKO A;  1WN7 A;  1Q82 W;  2IJK A;  4QGP A;  2BSK A;  4JPR A;  3C3S A;  2K1E A;  5GW7 A;  4BAY A;  1DGS A;  1OHH G;  5EYP B;  3E2E A;  3EHB B;  4DRX B;  1V54 B;  3HKC B;  1JNB A;  1R6K A;  5B1A C;  2OCH A;  2NLJ C;  4IL6 Z;  4IIJ A;  1NJI W;  2QR4 A;  2QDO A;  4IHJ B;  4I55 A;  3GVM A;  4K3A A;  4JI3 B;  1I5Y A;  4RQE A;  1LR1 A;  5CA1 B;  3UO3 A;  3CWB H;  4OGQ B;  4MS2 A;  4JI0 O;  4JI5 B;  2WLN A;  1ZUQ A;  3HR0 A;  3M7M X;  4IYI A;  2DOS A;  1AB3 A;  2YXL A;  4B3R B;  4LFB O;  4O4L B;  2ZR3 A;  3RYI B;  1L8D A;  1YEW A;  4OXS A;  5LHH A;  4DV7 O;  1D5N A;  4KXR A;  4U3J B;  3OR6 C;  4QE7 A;  4B3S O;  3E22 A;  1WP8 A;  1FKA O;  5FPR A;  1Y74 A;  2BTQ A;  1Z5V A;  3K5N A;  3JAK A;  3B4S A;  4HNA A;  3ZIA G;  1PV0 A;  2HEP A;  3L71 H;  3C90 A;  4HAM A;  5IDJ A;  3K9S A;  4LF4 B;  3QG5 A;  1K5S A;  5CB4 A;  4PJ0 Z;  4AIL C;  2EIM B;  2Y0I A;  5CBH A;  1G1X B;  3N2K B;  3HKB B;  4TT3 G;  4FLX A;  2WA4 A;  2ZIO A;  3AG2 B;  2GUZ A;  1GM8 A;  2ZCE A;  4X1Y A;  4DUY B;  4TV8 A;  4O4H A;  1XBL A;  4YJ2 B;  1KKD A;  2A79 B;  1VEW A;  1GH6 A;  3A0B Z;  1H38 A;  1Y67 A;  4PEL A;  2CE4 A;  5DED A;  3STL C;  2A3Q A;  3IFX A;  1R1B A;  4L87 A;  3ZJZ A;  1S0V A;  1HDJ A;  5L3D A;  4UVA A;  3ZMS A;  3BPZ A;  5K1P A;  4FLT A;  2WLJ A;  2N04 A;  5KA5 A;  4KP4 A;  5EBW C;  4JV5 O;  1SS3 A;  2YXY A;  3UCS C;  3CCL V;  5IJ0 A;  3IC7 A;  3F7Y C;  3JD2 A;  4DV1 B;  2Q5Z A;  2ZDI C;  3OMN B;  3JCZ A;  3FB5 C;  5LHI A;  5IYB O;  3OTO O;  1M90 W;  2XT9 A;  2A9H A;  1Y76 A;  1QQC A;  2P7T C;  5EBL C;  2PF4 E;  1SC5 B;  2AXT Z;  2ITD C;  4O4I A;  1K7D A;  1RP3 B;  1JFF B;  3DGE A;  5JH7 A;  4LF7 B;  4QPK A;  1SQP H;  3UT5 B;  4LWS A;  4FZ1 A;  3APQ A;  4DV4 B;  2EJR A;  5LXT A;  2UUC B;  1PNM A;  4N23 A;  1JX9 A;  3APO A;  3FFQ A;  3JSN A;  2OYQ A;  3RFR A;  4FMT A;  2JS5 A;  4X1K B;  1V54 C;  4CH5 A;  4LF9 O;  2NN4 A;  4BW5 A;  5LMN B;  2F93 B;  4YJ3 A;  2EIN B;  1BCC H;  2EZP A;  1PD3 A;  4FJC C;  3CS5 A;  2JRI A;  3BA9 A;  4O4J A;  2WLH A;  1UFI A;  4UV8 A;  4GKK O;  2LO1 A;  4JZ2 A;  3TXQ A;  3KKY A;  5LMU O;  2DW4 A;  3ZX6 A;  5BXZ A;  3EVK A;  5FLX N;  4JI7 B;  4YXW G;  2FL4 A;  2KSD A;  4UV9 A;  4D6T H;  1EBO A;  3RGB A;  3QVN A;  2HVJ C;  4JYY A;  1NVP B;  2JGD A;  1DK1 A;  2ZM6 B;  4DR2 B;  4IYH A;  3JAM N;  2Q0A A;  1D2D A;  3NXS A;  4ZKI A;  2R70 A;  5CN0 A;  2JVD A;  1KMI Z;  3B8N A;  5KMG A;  1HW7 A;  1AVM A;  3ASN B;  3LDC A;  1BL8 A;  3B77 A;  3QTC A;  3TGU H;  4LFA B;  1N32 O;  1L1F A;  4PI0 A;  1ARO P;  3ZMZ A;  1HNW B;  1AJQ A;  5JVD B;  2HKO A;  3QO7 A;  4NTY A;  2X0L A;  1XMQ O;  1BHB A;  3JAL B;  4DV2 O;  4JTD B;  1TA8 A;  2PUS A;  4X9Q A;  3EXA A;  4BIU A;  1VMG A;  1PP9 H;  3AG2 C;  3B2E E;  5L3C A;  3ZHS A;  3RWR D;  1HR0 O;  4FIP C;  1Z5W A;  1MMM A;  4TSF G;  5LA6 B;  3SYC A;  2P4V A;  1K4D C;  4YY3 B;  4K8Z A;  1VAR A;  3ZHV A;  4UCR A;  4FM0 A;  3E89 A;  3RW0 A;  4H33 A;  5CBF A;  3AK2 A;  4GX0 A;  1OCC B;  2PYJ A;  4ABM A;  2PZS A;  1MAB G;  2NR5 A;  1HWY A;  3ZRS A;  1Q6I A;  1YSC A;  2BOB C;  4E2L A;  4X8A A;  1L0N H;  5C8Y B;  3A0H Z;  3ABK C;  3SPJ A;  1F7Y A;  4RAI A;  3K58 A;  4DR1 B;  3BRC A;  2F95 B;  3JAW B;  3CP1 A;  1WPX A;  5EZY B;  5K1X A;  3W7T A;  4X20 A;  1HP8 A;  1WLE A;  5H5N A;  2E3C A;  1JVM A;  1NR1 A;  5KHH A;  2IJJ A;  4XDJ A;  3F5T A;  3UQ8 A;  2OCC B;  2QM7 A;  4FM1 A;  2CTR A;  1IBL O;  1F4M A;  4TV9 B;  3CCQ V;  1X4T A;  2E5L B;  2YIB D;  1M56 B;  5H2F Z;  1K73 W;  4DR6 B;  4DV5 B;  4J41 A;  4FFB B;  5LP6 C;  2EIN C;  1SQG A;  1JMK C;  4ZBM A;  4YHH B;  4PDV A;  3NR7 A;  3ZN1 A;  1QLE B;  1FJG O;  3SR2 C;  1SZX A;  1EZJ A;  1GM7 A;  1XL4 A;  5B1N A;  2WPD G;  2UUA B;  1JOY A;  2GDS A;  3D3I A;  3OMA B;  4AQY O;  1RPO A;  3P32 A;  4JAV A;  1SA0 A;  4F6E A;  1KC8 W;  4PA6 A;  1Y4M A;  3J7A U;  1DLB A;  3CRQ A;  3WB0 A;  3TJT A;  2BCC H;  4GLX A;  2K9P A;  3SYP A;  2YI8 A;  4J10 A;  3CYO A;  4JYA B;  4UFZ A;  2LGQ A;  2UXB B;  5IYZ A;  3CD6 V;  3L73 H;  3WB2 A;  1VQ8 V;  4JI2 O;  3E8B A;  1ZL8 B;  1XHX A;  4Z1V A;  1VQM V;  4FLY A;  4MSW C;  2RN9 A;  2DYS B;  2Y4T A;  2E75 B;  3K79 A;  4JI6 O;  4NXN B;  2DYR B;  4LBE C;  3T1Y O;  3RN4 A;  4R50 A;  1H5W A;  2XHB A;  3T2M A;  4FK5 C;  2ILM A;  4H44 B;  2JEU A;  5KX5 B;  1AR1 B;  1IDS A;  2ZNJ A;  5F2V O;  1I94 B;  5L3G A;  4QIW F;  1QU7 A;  4J9Z B;  4R8C A;  3UM7 A;  1NI8 A;  2XAH A;  2YEV A;  5L3E A;  4GX1 A;  3MAQ A;  3X2Q C;  2WWW A;  2XUM A;  4F6R B;  1VF6 A;  1QR9 A;  1HNZ O;  2UXC B;  1AP5 A;  1SF9 A;  2M6Y A;  5J2U A;  1M57 B;  4JAU A;  3IGA C;  4ZI7 A;  3ZS8 C;  2EZO A;  4LNU A;  2XAQ A;  3KG2 A;  3JD1 A;  5BR8 O;  1K3E A;  3BVO A;  4FLU A;  1THZ A;  2LFS A;  4UXN A;  3K59 A;  4X89 A;  3JD3 A;  1OV9 A;  3M8A A;  2WLL B;  2HHH O;  1J95 A;  3L72 H;  4RO2 A;  3HKE A;  5LYJ B;  4LC1 A;  1R3L C;  4HZ3 A;  1AJP A;  1GAX A;  4J7K A;  2YSU B;  5KAI Z;  2JS3 A;  1ZWI C;  1S76 D;  4DUZ O;  4DV3 B;  2F4V B;  2GV9 A;  1GN3 A;  2OCC C;  2HG5 C;  3SJA C;  1I0H A;  5JCO C;  1H2M A;  3SDL A;  1W59 A;  4KHP B;  1H2G A;  2P4K A;  4U7O A;  3FKS G;  3ABU A;  1FOU A;  3SGI A;  1KP3 A;  1IBK B;  2CH7 A;  5EC2 C;  5CA3 A;  3I5D A;  1H8E G;  4I4T A;  1JR9 A;  1ENV A;  2RMK B;  3W7S A;  4NVP A;  5BMV B;  1M56 C;  3AK1 A;  4MW8 A;  1NQT A;  1QHT A;  1QCE A;  3RT3 C;  3H1L H;  2DWE C;  4LF8 O;  3SJQ C;  1N36 O;  3ZHT A;  3FAV A;  1F4N A;  3KZI Z;  4ICG A;  4JI8 O;  4JI4 O;  3DC6 A;  1I7F A;  1SZT A;  3RYH B;  1VF5 B;  3IJ4 A;  3K9A A;  2OTJ V;  4NYK A;  1MZF A;  1WAZ A;  1IJG A;  3RYF A;  1N0J A;  1SES A;  2ADQ B;  4ZOL A;  3FYE B;  1N33 O;  5CBG A;  4CC5 A;  2LGW A;  3CB2 A;  4PDM A;  3HB3 B;  1SQF A;  3S3W A;  1P7B A;  3AG1 C;  5EYP A;  3ZCC A;  3D8C A;  5E1A C;  1XDC A;  4DRX A;  5EIB C;  1WB8 A;  3HKC A;  2ZR2 A;  1DTO A;  2Z5U A;  4DXW A;  3O65 A;  3WU2 Z;  3IAY A;  1XQ8 A;  2P90 A;  2AHZ A;  1FFX A;  3CCM V;  2YS8 A;  3SJB C;  1M1K W;  4BIZ A;  1Q86 W;  4QPJ A;  1BQ0 A;  1XUQ A;  2DMX A;  1FAF A;  2AGA A;  1WA8 B;  2DYR C;  4I9Q A;  4EKW A;  4DR4 B;  4NXM B;  4G2K A;  2QWN B;  1F23 A;  3K06 A;  3ZRW B;  1GK9 A;  2WSS G;  1Q6H A;  1P49 A;  5B1B C;  3TK1 A;  4PA7 A;  5E79 Z;  5KA6 A;  3RYI A;  1MSW D;  3SPI A;  1N34 B;  4B3M B;  3VQY A;  5ITZ B;  4X62 O;  3T1H O;  1OCR B;  5B5E Z;  5IWA B;  3AG7 A;  1M57 C;  5DM6 V;  1U97 A;  1YDX A;  4HBN A;  4DR7 O;  2YC0 A;  4OX9 B;  3HKB A;  1AJN A;  3ZBH A;  1AIL A;  1TUB A;  2P5O A;  2H8P C;  3FB8 C;  1K9M W;  1FXH A;  2EX3 A;  3OD4 A;  1MA1 A;  2HP8 A;  4FZ0 A;  1KQS U;  3BEH A;  3SYO A;  3RYC A;  4GX5 A;  4K0K O;  3I55 V;  4PA3 A;  1H2N A;  1E1Q G;  2B9Z A;  3JSL A;  4GX2 A;  3SPG A;  1DF4 A;  1WJZ A;  3CCE V;  4QE9 A;  1W2B U;  2Y4U A;  2F1M A;  4J80 A;  4DV4 O;  3MHH C;  1BQZ A;  4I0X B;  1BMF G;  4DV6 O;  1B6Q A;  1Q8I A;  2EBO A;  1N8R W;  2EIJ C;  2WAM A;  4IIJ B;  4R7C A;  1JPX A;  3UO2 A;  3ASO B;  1JA8 A;  3OTF A;  5KUM A;  2YDE A;  4CH4 A;  2Q7G A;  4YIO A;  1TUE B;  4I55 B;  1QVF U;  3CRR A;  3QNE A;  1JFF A;  4B08 A;  3OEH G;  1AR5 A;  3UT5 A;  4LF6 O;  2LFR A;  1JQ0 A;  2Z3Y A;  4NTX A;  1UPG A;  4B3T B;  4DV0 O;  2HVK C;  2ZIM A;  3CRA A;  3BCC H;  2QKC A;  1ZAU A;  1GMG A;  3E83 A;  4FM2 A;  1H2S B;  3A8T A;  3ABK B;  4X1K A;  3OW2 U;  3KDR A;  2BTQ B;  3IC9 A;  3F7V C;  4P9O A;  4X1I A;  2KB1 A;  1YIT V;  1RM1 B;  4ZIB A;  5KHG A;  4QJF B;  1M5I A;  5CB4 B;  2CAZ C;  2WLI A;  3CXH F;  3D36 A;  1K8A W;  3LUT B;  3AEI A;  4ZHQ B;  4JI0 B;  2VQF O;  1EN5 A;  1E79 G;  3N2G A;  1S77 D;  2DN9 A;  4X65 O;  2LP7 A;  2QWR B;  1Q3E A;  1M4U A;  4TV8 B;  4LFB B;  2AHY A;  3WG7 B;  1YIJ V;  4DR5 O;  3CCV V;  4MVO A;  2LQT A;  4DV7 B;  5KHJ A;  2IM9 A;  4B3S B;  1Q90 D;  1FXK C;  3ZHU A;  5IJ9 B;  1EZV H;  5LP6 B;  1SQV H;  1P4R A;  2ZT9 B;  2L35 A;  2ZNI A;  1OCR C;  3K04 A;  5JVD A;  2Q68 A;  4E4E A;  3R65 A;  1CP9 A;  1AP6 A;  4EFB A;  4G27 B;  5TIS Z;  2VQE O;  3E8H A;  2Q73 A;  2BE3 A;  2HJD A;  1L0L H;  3CRC A;  3DC5 A;  5CMU A;  1I5X A;  2QGN A;  4O2A B;  1YCI A;  5LA6 A;  4O4I B;  2O57 A;  2YXH A;  5JH7 B;  3P30 A;  2WLM A;  2YIA A;  4UCO A;  3P3P A;  4YIP A;  2P6J A;  2DQ3 A;  1VQP V;  4RUE A;  4JV5 B;  3KCY A;  3M99 B;  4RQF A;  5LXT B;  4LFC O;  1IBM O;  3JAR B;  4BW9 A;  1PNK A;  3OTO B;  1XMO O;  2XAG A;  1NTK H;  1Y66 A;  1XRE A;  3T4D A;  4DR6 O;  4UCT A;  1E1R G;  1ZLZ A;  4I5S A;  3ASO C;  1WP7 A;  4I50 B;  5EZY A;  2IBZ H;  4XDK A;  2QWQ B;  2D3O W;  1R3K C;  3OGC C;  3X2Q B;  2Q67 A;  3OMI B;  4W4K A;  1XL6 A;  4P30 A;  2JJ2 G;  1JJ2 U;  1VQO V;  4MTX A;  5JCO A;  1GM9 A;  2UXX A;  3E86 A;  1VQ7 V;  1NU1 H;  1MZE A;  3STZ C;  4WFA V;  3HKD B;  4TV9 A;  4TUY B;  2ITC C;  3VQW A;  2JK5 C;  2LW1 A;  3JD0 A;  4LF9 B;  2WLK A;  3VQX A;  5LL6 Y;  2NNU A;  1X59 A;  2P22 C;  4FFB A;  1NS1 A;  5J9P C;  2UXB O;  4JYB A;  5FL7 G;  2Q0O C;  2BOC C;  4C7U A;  4LF5 O;  1OCO B;  1RM1 C;  1OCZ B;  4GKK B;  1R73 A;  3QF7 A;  5LMU B;  4CZZ A;  1WB7 A;  2IH1 C;  5IYD O;  2PGG A;  3BA8 A;  2XAS A;  1TAE A;  3FYI B;  4P2Z A;  1ORQ C;  2IJI A;  2VS0 A;  2KKW A;  4JYC A;  1LUW A;  3JAS B;  3GB7 C;  2YI9 A;  3WG7 C;  2WA3 A;  4NKG B;  3H1H H;  1VIB A;  3G6B A;  4WBN A;  3AK3 A;  2YIC A;  1WNS A;  5BY1 A;  4JTA B;  1N32 B;  1MOF A;  2GBO A;  4DK0 A;  2UXC O;  4MVZ A;  2ZE5 A;  1FS0 G;  1K97 A;  1N0N A;  2GTS A;  1UJW B;  1H2L A;  2IH3 C;  1XMQ B;  2Y0P A;  4H37 A;  4DV2 B;  2L6L A;  3EFF K;  4EB6 B;  3LDE A;  1MNG A;  1SKV A;  2QE7 G;  3C3T A;  4X64 O;  1CEZ A;  2VRZ A;  1SQQ H;  1K5Q A;  4CH3 A;  1GN6 A;  5FNV B;  5H9C A;  2E74 B;  1HR0 B;  1XI1 A;  2B5U A;  2C2A A;  1VP7 A;  4X20 B;  3ZMV A;  4O2B A;  3AG3 B;  4X66 O;  4GKJ O;  2QSA A;  3AG1 B;  2UU9 O;  2FYU H;  2QM8 A;  1GN4 A;  4Z1M G;  2XTA A;  5J2T A;  2V4D A;  4QNH B;  3CME V;  3R66 A;  1XOU A;  4F6R A;  2KG7 B;  1Q81 W;  2W0F C;  4JAS A;  4JGS A;  2H3O A;  3JCU Z;  3CRM A;  3U0Z A;  1GTO A;  3JAT A;  2MW2 B;  3H9V A;  1W0K G;  4BWA A;  4JZG A;  5IY5 B;  2OIE A;  5EC1 C;  1YJN V;  3W7U A;  3RVZ A;  2WLL A;  4G28 B;  3OUF A;  3ZN0 A;  5LYJ A;  5B1B B;  4FLZ A;  3B09 A;  1K92 A;  3N27 A;  5KLV H;  2R9I A;  2DQ0 A;  5GTI Z;  1J5E O;  1K33 A;  1SA0 B;  2A0L A;  4J11 A;  3H1J H;  1CXZ B;  1IBL B;  4UCS A;  1HNX O;  1SQX H;  4JI1 B;  3SPH A;  5CA0 B;  1XNR O;  4AHC A;  1BT8 A;  2UXD O;  1KEC A;  4DR3 O;  1NBM G;  4PDL A;  4NR1 A;  1XNQ B;  2IW5 A;  2XAJ A;  3ETE A;  3DXR A;  5JWP A;  4UCU A;  5BMV A;  1R3I C;  2W6I G;  3H1K H;  3CE2 A;  1XHZ A;  2EIL C;  1FJG B;  1OCO C;  2V1D A;  1OCZ C;  2OIG A;  2Q7E A;  4ASU G;  2JEX A;  1P84 F;  2EUL A;  3RYH A;  4AQY B;  3SPC A;  2CGO A;  4LH7 A;  1CPY A;  4K8X A;  2HJF C;  2YID A;  1OJH A;  2AZ0 A;  4B7K A;  3ABM B;  1VQ4 V;  3A2F A;  1GO3 F;  1PKX A;  5IYC O;  5EK0 A;  3OE7 G;  4TQF A;  3MDS A;  2ZDI A;  3JYC A;  4FFK A;  2EIJ B;  4JI2 B;  2PI5 A;  1SQB H;  4B3M O;  4MTF A;  5BZB A;  2BTO A;  5GON A;  2N05 A;  3RVY A;  1FD9 A;  3T1Y B;  4R6Z A;  2F66 C;  3CSX A;  3Q4H A;  2W6J G;  4WFF A;  4JI3 O;  3BY6 A;  1ROP A;  1S72 V;  3PN1 A;  3HKE B;  4MVU A;  4JI5 O;  1QLN A;  3GWO A;  1QVG U;  2VWJ A;  1IUR A;  4MTG A;  1F51 A;  4B3R O;  3AG3 C;  1G4Y B;  2M7W A;  3K08 A;  3P3N A;  4X88 A;  1HNZ B;  1D5A A;  1WPB A;  1S5J A;  2Y69 B;  1KYO F;  1LUV A;  1O9G A;  2X7R B;  3CMA V;  4MVM A;  2UXN A;  5ITZ A;  2AZ2 A;  5LGT A;  4IHJ A;  1VQ6 V;  5BR8 B;  5LHG A;  3QO5 A;  1YTF D;  4H13 B;  4LF4 O;  1COW G;  3CCR V;  2P67 A;  1YJW V;  2JDI G;  4I9W A;  2HHH B;  5IY5 C;  5CA1 A;  1NH2 D;  5LBQ A;  2CTW A;  1Y6X A;  1SER A;  4Z2W A;  1BE3 H;  3E8F A;  3TET A;  3ETG A;  4DUY O;  3UKM A;  4DUZ B;  2Q9L A;  4O4L A;  2UUB B;  2ZIN A;  3T1C A;  1FXK B;  2CDY A;  1RSO B;  4U3J A;  5JQG B;  3RYF B;  3ABL C;  1FXV A;  4ZOL B;  3OGI B;  2Q6A A;  3OM3 B;  3CC7 V;  3JD4 A;  1TVK B;  2R72 A;  2RNB A;  4B3T O;  1NTM H;  1ZX3 A;  2A7W A;  4I0X A;  2ADP A;  4DW1 A;  4DV1 O;  3ML0 A;  1BZK A;  3N2K A;  4AI8 A;  3ETD A;  4LF8 B;  4UVC A;  2ZQM A;  3CJH B;  1KKC A;  1FFX B;  1N36 B;  2QEX V;  4JI8 B;  4RUF A;  2R9R B;  3U10 A; 
#chains in the Genus database with same CATH homology
 4E4E A;  3BFR A;  1AVM A;  4C7U A;  3C3S A;  1AP6 A;  1IX9 A;  2AW9 A;  1JA8 A;  1WB7 A;  3OT7 A;  1I08 A;  1XUQ A;  4GUN A;  4YIO A;  3DC5 A;  3LSU A;  1LUW A;  1QNM A;  4X9Q A;  1SZX A;  2RCV A;  1AR5 A;  1ZTE A;  1LUV A;  2QKA A;  1BT8 A;  2GDS A;  4YIP A;  5AG2 A;  3AK3 A;  4F6E A;  1GN3 A;  1MMM A;  1EM1 A;  1ZUQ A;  2QKC A;  1I0H A;  1B06 A;  1MSD A;  3TJT A;  1N0N A;  1VAR A;  2P4K A;  1PM9 A;  4BR6 A;  3KDR A;  3AK2 A;  3IC9 A;  1MNG A;  1GN2 A;  1XRE A;  1JR9 A;  1D5N A;  3C3T A;  3AK1 A;  1ZLZ A;  1GN6 A;  2CDY A;  1EN5 A;  3K9S A;  3RN4 A;  1P7G A;  1GN4 A;  3DC6 A;  1AR4 A;  1IXB A;  1MA1 A;  3MDS A;  1IDS A;  3CEI A;  4JZ2 A;  3KKY A;  4FFK A;  1N0J A;  2ADP A;  2ADQ B;  3EVK A;  1BS3 A;  1EN4 A;  1EN6 A;  3QVN A;  4JYY A;  5A9G A;  1XIL A;  4JZG A;  1ZSP A;  1BSM A;  1KKC A;  1VEW A;  1XDC A;  1AP5 A;  1PL4 A;  1WB8 A;  1Y67 A;  2CE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...