1N0JA

The structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Human Mitochondrial Mn3+ Superoxide Dismutase Reveals a Novel Tetrameric Interface of Two 4-Helix Bundles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1n0jA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1n0jA02
1ZTEA 1D5NA 4JZ2A 1QNMA 1ZUQA 1N0NA 1AP6A 1AR5A 3IC9A 3KKYA 3C3SA 1EN5A 4JZGA 3TJTA 1GN4A 1XDCA 4E4EA 1B06A 4C7UA 1ZSPA 3DC5A 1GN3A 1VEWA 1N0JA 1MA1A 1EM1A 1BS3A 1SZXA 3OT7A 1GN2A 5AG2A 4JYYA 1P7GA 1I0HA 4GUNA 1XILA 1BT8A 1JR9A 2ADQB 1LUVA 1WB8A 3QVNA 5A9GA 2QKAA 2RCVA 1KKCA 3AK2A 3BFRA 1AR4A 3RN4A 3C3TA 2CE4A 4X9QA 1BSMA 1PM9A 3K9SA 1MSDA 3DC6A 1XREA 4YIOA 4YIPA 3CEIA 1AP5A 1IDSA 1AVMA 3AK1A 1PL4A 1I08A 3LSUA 1XUQA 1Y67A 2GDSA 4F6EA 4BR6A 2P4KA 1VARA 3AK3A 2CDYA 1EN4A 1WB7A 2ADPA 1ZLZA 1IX9A 1MNGA 1EN6A 2QKCA 1LUWA 3MDSA 1GN6A 1JA8A 4FFKA 1IXBA 1MMMA 3EVKA 2AW9A
chains in the Genus database with same CATH superfamily
2DW4A 3VQWA 4QE9A 4DYLA 3UT5A 1YITV 2WLKA 3U10A 1R6TA 1O9GA 3C3SA 2KSDA 1NR7A 2BSKB 1VIBA 1V55C 3STZC 4LF7O 4WBNB 1SETA 1M56C 1VEWA 4IHJB 2E3CA 1ZAUA 4I4TA 1HNXB 3JALB 1EM1A 3K79A 4Z2WA 1SZXA 1K4CC 5CBFA 4TQFA 5LA6A 3OTFA 1P7GA 5LP6B 4QPKA 1XILA 1N33O 5LOVA 2A0LA 3QG5A 2KG7A 3HKDA 4R8CA 2Q5ZA 2Q4PA 4RUEA 1KKCA 1OHHG 4B3RB 2B1IA 4PA7A 3I5DA 1RFYA 2N05A 3HKEB 2R9RB 1IBKO 1EBOA 2DYSB 3RYCA 1PKXA 2H94A 4LF9O 2EILB 3GVMA 1ZWIC 2QE7G 1SESA 2X6BA 5BR8O 2KQXA 1URFA 4EEQA 1Z2GA 1AVMA 3OEEG 3APOA 2YIAA 4ZI7A 1HP8A 3OGCC 4DUYO 2B5UA 2Y0PA 4D7SA 2D3OW 2R70A 5FLXN 5KLVH 3RYHA 2YXYA 3BA8A 1W2BU 2UUAB 5EYPA 1V55B 3ZMVA 2H3OA 5EBLC 4LWSA 3K0GA 1FYJA 4AQYB 1Z5WA 3CCRV 1QNMA 4DV0O 1YTFD 3L73H 2YS8A 1AP6A 2QTSA 3U11A 2ZCEA 2FMLA 2ZD9A 3H1JH 4H13B 2F4VO 5JVDB 4IIJB 1N34B 3WG7B 2JS5A 3DC5A 3ZMUA 4FK5C 2MW2B 4O4HA 2ZNIA 1FXKA 1F4NA 2GV9A 5BR8B 4LR3A 3JSNA 1XL4A 1F51A 1Y66A 3AG2B 1R3JC 5BZBA 2P90A 2OTJV 2CTWA 3QVNA 1HW7A 1SQVH 5L3DA 1KP3A 5LBQA 4DR1O 4JAUA 4Z1MG 5DECA 5LP6C 4DRXB 2UUBB 2RMKB 4X89A 1QLEB 4GZRB 1YCIA 4WFAV 3LDDA 3JCUZ 5TISZ 3SGIA 4FLVA 1TUBA 1PM9A 1H2KA 3SJBC 1BZKA 1XREA 3ABLC 4MVQA 5KHJA 2PY5A 3UO3A 1SQXH 2NR5A 2LGWA 3T4ZA 4X88A 5JQGB 1WA8A 5JJEB 3CSXA 4FLTA 1UJWB 2GDSA 2DQ3A 1N36B 1HNZB 4FM1A 2Y69C 4U3JB 4NB5A 4N23A 5KHKA 3P30A 4FM0A 4LF8B 1TVKB 4EKWA 4JYBA 3A8TA 2AXTZ 1GN6A 1CXZB 3RN4A 1RSOA 1VQ6V 4KXRA 4X20B 1IJGA 4XDKA 2OCCC 1Q82W 4YXWG 4B08A 5B1NA 4LF7B 3RT3C 1N8RW 2YI9A 2WSSG 3LNNA 4QIWF 3QF7A 3ZRXA 4FPPA 3AG3C 3H9VA 5B1AB 1XOUA 1FFTB 4KHPB 3O65A 4JPRA 3LDCA 1QHTA 5IYZA 5CN0A 3BRCA 5EC2C 4E2LA 2C2AA 2WLIB 4B3RO 2IH3C 3CC2V 3JD0A 1NU1H 2QR4A 2ODMA 1XI1A 2P67A 4B3SO 3RGBA 3AG4B 4JI3O 4LF5B 2PYLA 5E79Z 3CJHA 3T2MA 4J11A 3ASOB 1VF5B 2KG7B 3ZRWB 1D2DA 2XAQA 2EIMC 4DRXA 2PYJA 4UV8A 1OJHA 1XBLA 2EBOA 3L70H 4P2ZA 3N2GB 1AB3A 2XAFA 2Q73A 3AK1A 4L8JA 3ABKC 4O4IA 4NXMB 1HNWO 3IAYA 4YJ2A 1IBLO 4UVAA 3RBZA 2CGOA 1SS3A 4TV8A 3SYPA 4BR6A 2P4KA 1QU7A 4TUYA 3CCEV 3G67A 1ZL8B 4D7TA 3AG3B 3SJCC 1Q6UA 3B40A 4UFZA 4FFBB 4QE7A 3ZX6A 1RM1B 3DGEA 5EC1C 3WB1A 3D3IA 1XNQB 2OCCB 2ZXWB 5JJJB 1SQQH 3HKDB 1KC8W 5L3EA 4LF9B 4XDJA 1QQCA 1H2MA 3VOUA 4JZGA 3JAWA 2DOSA 3CCJV 1NH2B 5B66Z 2LP7A 3UO2A 3ZJZA 3A0BZ 4J10A 3CRAA 2PI5A 3RYCB 4JI2B 1B6QA 1G6UA 4JAAA 3OT7A 2Z0AA 3HKEA 2EULA 4CH3A 1SQFA 2Q67A 4O2AA 4O4JB 1YXBA 2F95B 3B8NA 3BPZA 2CTPA 2X0LA 4DR1B 1AILA 2A3QA 5EIBD 4X62B 1PNMA 4U7NA 1NTMH 1UPGA 1J95A 4WFEA 4LNUA 1VQMV 5EBMC 1BHAA 1AR4A 1FAFA 4EFEA 3CCVV 4JI5O 1VQ8V 2M6YA 3CWBH 1CEZA 2GHYA 3ZMTA 3LSSA 1PNKA 1U97A 4IHJA 3CE2A 2X7RB 4O4IB 4DV4O 4O2AB 3A0RA 2EIKB 3SYOA 1MSDA 3RWRD 5DM6V 5J9PC 5F2VO 1FKAO 4OX9O 4W4LA 3E22A 1R6NA 3OM3B 3ZHRA 4TQDA 3LSUA 4WFBV 2P22C 4EB6A 1YZBA 4F6EA 2UXBO 1RPOA 5JVDA 4UB8Z 3K58A 1VARA 3BY6A 1O9HA 1BCCH 4JI2O 1S3JA 3TXQA 1HWYA 3KCXA 4GCZA 5KMGA 5KA5A 3HKCA 3Q4HA 5LHGA 2GTSA 1KB9F 2R72A 4XDLA 2VQEO 2AW9A 1MG1A 1DF5A 1FXKB 1FFXB 2O57A 2CAZC 1M56B 4XBFA 4DR6O 4KHPO 5LMUB 2ZNJA 2ZE7A 5KX5A 4PI0A 5HFLA 4TV8B 4LF6O 3G80A 1K5QA 1K97A 4TV9A 5B3SC 3UKMA 2V7QG 4ZKIA 1YF2A 4WBNA 4FJCC 1IBKB 3JAMN 2BSKA 2JRIA 4A5UB 4GYCB 1JX9A 2VWJA 4X65B 4R50A 2XAGA 2YICA 4LF5O 1BT8A 1FJGB 5JCOA 2ADQB 3F5WC 3K5LA 5IWAO 1JNBA 1V54C 4H44B 4CS3A 4DK0A 1SZTA 3ZN0A 2ZM6B 3RFRA 4LP8A 3TGUH 3SR2C 2KKWA 1HNXO 1W0KG 3CRMA 1AJPA 1QBZA 1DK1A 4QJFB 4LFAO 3ETDA 5IJ9B 4DV3B 5KUMA 4DR5B 5LXTB 2G38A 2YIBD 1Y6XA 4Q20A 1EFRG 2RJZA 1XUQA 1S77D 4DV7O 2HHHO 4I5SA 4ZI7B 1QVGU 1GMGA 2UXDO 1XMOB 1EZVH 4P9PA 3WU2Z 1VQPV 4DV5B 4J9YB 1SKVA 2QTOA 4ZOLB 2JEXA 4GX1A 1SQBH 1X59A 4JI7B 4J7KA 3RVZA 3K57A 2Y4TA 2XOKG 3BABA 3E2EA 1Q7YW 1WA8B 4HYOA 2WLIA 3QO5A 3IJ4A 4I55A 4B3MB 3U0ZA 2AHYA 2KB1A 3A2FA 4B7EA 2HVJC 2UXNA 3KG2A 1Q5OA 3RYIA 2HR3A 5FNVA 4AILC 2OYQA 1YSCA 5GW7A 2ZR3A 1VQ9V 4YHHB 5AG2A 5BXZA 5B1BC 4GUNA 2DWEC 4X1YB 1PV0A 1N32O 4CC5A 2ZKOA 4JI5B 2XAHA 4U3FH 5LHIA 2RCVA 2WLHA 1RSOB 1R3IC 3M8AA 1Q3EA 4IL6Z 1I94B 4UV9A 3R66A 1HNZO 1FS0G 3BVOA 4O2BA 2GSMB 4KUMA 2ZQMA 4QPJA 4F6RB 1JJ2U 3MHSC 3OAAG 5L3GA 4NXNB 3ASNB 2Q0AA 4U3JA 1PL0A 2OIGA 2R9IA 4MVZA 2IM9A 3ZHUA 1GM7A 2YXLA 2UXBB 3OE7G 2EX3A 2HLDG 3FB8C 2HFEC 1T5EA 1M90W 2ZIMA 1G1XB 1VP7A 5KX5B 3K0DA 3ASOC 1K33A 4MTXA 3S3XA 4ABMA 1B3QA 3I56V 2X6AA 1EN4A 2ZDIA 3FB6C 4J9ZB 1YI2V 3ZRWA 3ZHQA 3ZEDA 2L35A 1K9MW 1OCCC 3W7TA 3EVKA 4LWSB 2VWKA 2XNDG 4X20A 1R73A 4IGGA 3K04A 1N0NA 5EBWC 3T1HB 4MVMA 3CMAV 4X64B 5K1XA 1NVPD 1BE3H 4FMTA 3A0HZ 3AEIA 4CBCA 1VQNV 3C90A 5LHHA 2EIKC 1YJNV 2LO1A 1KUQA 4J42A 2XT9A 5JJNB 4CH5A 4UCUA 1S5LZ 1XQ8A 3EXAA 3WFVA 4JYYA 2OCHA 3SYCA 2F43G 3G6EV 1OCOC 4OPHA 2ZM6O 5LXTA 4ICGA 3CCSV 4WFFA 2XTAA 5BMVA 2P06A 2UUCB 4NXMO 1AJNA 3G4SV 3BFRA 4RO2A 2ARHA 1HDJA 4LH7A 2EIMB 4JI1O 5H9CA 1NH2D 3OMAB 2DWDC 1BHBA 3CRCA 2DN9A 1Q8IA 3W7WA 1M1KW 1N4CA 3NR7A 1K4DC 1HR0B 2UU9O 3H1IH 3ZCCA 3ABLB 5C8YB 4LFBB 1R1BA 4K0KB 4I9WA 1ZL8A 2ZE8A 2W6IG 5LGTA 4B3SB 1DTOA 2Q68A 3IFXA 2W6JG 2ATKC 4LFCO 2WLLA 1KQSU 3CPWU 1AI5A 1WB7A 3CHXA 4LNUB 2CH7A 3FAVB 1ZLZA 2QWOB 2CK3G 2HVKC 3TK1A 1XMQO 2BE3A 3T1CA 3AG2C 4TSFG 4UXNA 4TWKA 4WFHA 1JA8A 4GX5A 4DR7B 3OD4A 1HNWB 3DSQA 4F4LA 1IBLB 5CA3A 4DV6O 1SA0A 2ZE6A 3CJHB 2A7WA 2ZDIC 3WG7C 3FYIB 1VF6A 5ITZB 5LGNA 4DV0B 4BIZA 2BOBC 2GUZB 1XDCA 2EZOA 4LC1A 5IYCO 2GBOA 4J7JA 3L72H 2DMXA 4HAMA 5IY5B 1WP8A 2Q0OC 4JI4O 3JAWB 4PA4A 1S5JA 2PF4E 1OV9A 5J2TB 2UU9B 4DR4B 3JD1A 4DV4B 4PI2A 3LSQA 4BAYA 4KL1A 3SJAC 3T4DA 1DF4A 1JR9A 5FPRA 2HKOA 2V1DA 3HKBA 2Y0IA 1LUVA 2WA3A 3SPCA 4K8XA 3E8HA 2YIBA 4PA6A 3MHHC 3L75H 4UCSA 3OGIB 3BHPA 3GWOA 1J5EB 3ETEA 3ASNC 2EINC 4JI7O 2XASA 3VQXA 2OWOA 4O4LB 3IGAC 1Y76A 3F5TA 4I0XB 4X9QA 2VQFB 2H8PC 2ETNA 1WP7A 2E75B 3J81N 1WAZA 5LYJA 1YJ9V 3RYFB 4YIPA 1GKFA 2CH7B 4X62O 2WLLB 4W4KA 2QKSA 3CXHF 2NLJC 1M57B 4YHHO 3ABMC 1K5SA 2JIZG 2CGNA 3OMNB 4LH6A 1WJZA 4OPAA 4HNAB 3D8CA 1JOYA 2FL4A 2QGNA 2JJ1G 1R6KA 4DW0A 2ADPA 3VQVA 4ASUG 4LF6B 4MS2A 2CUGA 2LJ2A 4DR3B 3QNEA 1H2GA 2IJIA 4OX9B 1SQPH 4YY3O 4Q6GA 1IXBA 2Y69B 1LR1A 4FLZA 4X65O 4P30A 2JGDB 2EIJB 1Z5VA 3OFNG 4NYKA 3JAKA 3EHBB 4NXNO 5IWAB 3E83A 4TT3G 1GM9A 4PELA 2P7TC 4ZIBA 2IU0A 1VQ7V 4L87A 5CB4A 5L3CA 4PA9A 4TUYB 3K5MA 4UCOA 1K73W 1KU9A 1GTOA 3ICXA 3JCZA 1FXKC 1OCZC 4CH6A 4PDMA 4F6RA 3FD9A 3H1KH 4JGSA 2XAJA 5EYPB 3J80N 2WA4A 2DYRB 5KAIZ 4X1KA 4FZ0A 4PDVA 2IH1C 2DYSC 5LGUA 1YDXA 1WLEA 3ABMB 4J80A 2ZXWC 1I7FA 2LQTA 4K0KO 5KHHA 4K35A 4X1YA 5GONB 1OCRC 3JATB 4RQFA 3APQA 2IJJA 1ROPA 1FXHA 3ZHTA 5CA1A 5GTHZ 1YTFB 2ZR2A 4K3AA 1Q90D 4YJ2B 4LFCB 3F7YC 1PP9H 4MTFA 5J2UB 2LW1A 2B1GA 2ILMA 3AK3A 4HBNA 2W0XA 1EZJA 3CS5A 2QKCA 4O2BB 4FIPC 4LCUC 3OUFA 4JF3A 1ORQC 3TETA 5IDJA 4UVBA 3H1HH 5GTIZ 1ZTEA 1D5NA 3HKBB 3ABTA 1XNRB 1DLBA 2EJ7A 3L71H 1RP3B 1IBMO 2Z3YA 1QCEA 3AG1B 4JI8B 3TJTA 3ZRSA 3CRRA 1XMOO 4B7KA 1MA1A 1XHZA 4I9QA 5ITZA 3HB3B 3VQYA 5D5PA 4NKGB 4GX0A 1AROP 3PJSK 2A06H 5B1AC 3ZN1A 3ABUA 2FB5A 1WB8A 3P32A 4JASA 2QKAA 5JH7B 3OR6C 2Y48A 1WPBA 4Z1VA 4JV5O 4DV6B 4BIUA 3ZHSA 3OUSA 4ZHQB 1OCCB 3E22B 3ABKB 2WLNA 3M99B 3ETGA 1XEQA 1M5IA 4X66O 3ZS8C 2IBZH 1N32B 3WB2A 4AQYO 3RW0A 4FLYA 2EZPA 1NTZH 3UCSC 2E5LB 2NNUA 1KYOF 3GB7C 3JD4A 2WLMA 5CB4B 2D2CB 1Y67A 4JI3B 1NJIW 5IY5C 1N34O 2DQ0A 1JQ0A 5IE9A 1GRJA 2PTMA 3RYIB 4DV2B 2NN4A 1SC5B 1R3KC 4UCRA 1IX9A 1MZFA 2Y4UA 2Q6AA 3RVYA 3JD3A 3Q4HB 3MDSA 1P7BA 4JZ2A 1UFIA 2BTOA 4BWAA 4LBEC 3KCYA 2UXXA 2B9ZA 3ETQA 4JAVA 3N2KA 2YEVA 2UUCO 2F93B 1R3LC 4LFAB 5LMNO 3FFQA 4DR6B 3B4SA 4P9OA 1PPJH 3JARB 4JI1B 4IYIA 2JDIG 1GN2A 1KECA 1U96A 2N04A 3JASA 3QO7A 3N2GA 4I55B 1H2SB 4GKJO 1I5XA 3T1HO 2AZ2A 1IZ3A 4PA3A 1MOFA 3FYEB 3AG1C 4DR3O 3FAVA 5FL7G 4CH4A 3IC7A 5KHIA 1ENVA 4DV5O 4HNAA 3L74H 1JCHA 1VF6C 4G27B 1NZ6A 3C3TA 2YC0A 2OIEA 1TAEA 2XHBA 3JALA 4PJ0Z 5H5NA 3AG7A 4MVSA 3OR7C 3SPGA 2DE0X 4LF4O 4YIOA 2M7WA 1AP5A 4I50A 1H5WA 4MVOA 4DR7O 3GWKC 1BGYH 1V9PA 3HR0A 1K34A 3KZIZ 1QLEC 5C93A 3HPLC 3E8GA 2QM7A 1VQLV 1FXVA 2PI4A 3LUTB 1SA0B 5BY1A 1Y76B 2UXCO 1MNGA 1EN6A 3FX7A 2F23A 4MSWC 2IU3A 1CP9A 5D5QA 4RUFA 2RQ6A 2Q7EA 5JH7A 4GKJB 1NQTA 4DR2B 3CC7V 4H0LB 2LFRA 2BTQB 1K8AW 3JARA 5LP6A 4U7OA 1Y74B 1V54B 2IJHA 3K3WA 3CP1A 2QDOA 2YEVB 1VQKV 5IJ0B 3SDLA 3K03A 2AHZA 1BQZA 5H6RA 3B77A 1I5YA 1L8DA 4IIJA 1BS3A 3CRQA 5C8YA 2YIDA 4TOIA 3L9DA 4RAIA 4B3TB 4GLXA 2UUAO 5B3SB 2QWPB 3AG4C 4DUZB 1TVKA 4I0XA 4FFBA 3DTUB 2HJFC 2CTRA 3TCUA 1SQGA 5LMUO 4ZOLA 4MW8A 4YJ3A 3N27A 4JI6O 4DK1A 1P84F 2ITDC 4I7ZB 1NS1A 2VS0A 2QWNB 3CCQV 1KBHA 2X6CA 3JASB 5KAFZ 1NKDA 2GTAA 1YHQV 1GAXA 4DR2O 5EK0A 1L1FA 1XL6A 1I08A 5B1BB 4D6TH 4ZHQA 2GUZA 4MT8A 4MVRA 3RYFA 4J41A 1WNSA 2JJ2G 3D3QA 4DXWA 2CDYA 2YUAA 1KD1W 1D5AA 3OTOO 1Y74A 3DXRB 1H2LA 3B2EE 3WB0A 1MMMA 5LL6Y 5L3BA 1H8EG 1CPYA 3CMEV 4O4HB 1X4TA 3HKCB 3BAAA 2PUSA 2Q9LA 1YVWA 4GX2A 4BW5A 3F7VC 4DV7B 2HHHB 3LDEA 4CS2A 4JI6B 1B06A 3MAQA 2UXDB 4RQEA 1B04A 1GN3A 4KP4A 1MABG 5B1OA 4JTDB 2VRZA 3QO8A 2EIJC 3CD6V 4N21A 5IYDO 3THOA 1F4MA 5IJ9A 5DEDA 5FNVB 3S3WA 3ZIAG 1Q6IA 3STLC 1FFXA 5BMVB 2RDCA 4G28B 4CC6A 2WAMA 2FTKA 3AK2A 2EILC 2Q69A 1PD3A 4B3MO 1OCRB 2HG5C 1BQ0A 2N74A 4DUYB 1FOUA 5J2TA 3SJQC 1M57C 1COWG 1VQOV 1JFFA 2QA4V 1RM1C 3I55V 1AR1B 4HZ3A 2Q8VA 1VQ4V 3KDRA 1IDSA 4FLXA 4PD4F 4H37A 2DJVA 4JI0B 3JYCA 2WLJA 4LFBO 1Q43A 1I94O 1GH6A 4AHCA 2JK5C 1MZEA 2Q7HA 1IBMB 4ZBMA 4DR4O 3E89A 4X1IB 1NTKH 4JI8O 1L0NH 5CBHA 2F66C 2WWWA 5E1AC 1LUWA 3K5OA 1YEWA 5KA6A 5H6QA 5L3FA 4NTWA 3FKSG 5CA0B 4MVUA 3X2QB 1W0JG 2YDEA 1K3EA 1LNQA 3DXRA 3LNMB 3ML0A 5EZYA 1NVPB 3FB5C 2P4VA 1M93A 4RWUA 1S72V 3T1YB 3OEHG 2A79B 4TV9B 3JD2A 4FM2A 3IC9A 3CC4V 1DGSA 1GN4A 4E4EA 1MSWD 1BMFG 4DV1B 4GKKO 2UUBO 4OXSA 4PDLA 4IYHA 1OCOB 2ZE5A 1NR1A 1FPOA 3UM7A 4PHZA 2QEXV 5EIBC 3SYQA 3BA9A 2BCCH 4MTGA 5LYJB 1I0HA 3OW2U 3E8FA 3R65A 4EFBA 4NTYA 1G8MA 1ZX3A 4G2KA 4BW9A 5KMGB 2JVDA 2UXCB 2HEPA 4QGPA 4MTOA 2V4DA 5A9GA 1NT2B 4FVMA 3O9OA 2BOCC 2L6LA 1US6A 1K7DA 3FB7C 1FD9A 3JAKB 2YXHA 4UUJC 4R7CA 4DV2O 3E86A 4QNHB 4WCEV 2EINB 3ZMSA 5CBGA 1TUEB 4NTXA 3RYHB 1JMKC 3DC6A 3CEIA 2HP8A 1VQ5V 2YSUB 1K92A 3VBBA 1E1QG 1NBMG 3T1YO 4JYAB 1YIJV 5B5EZ 4DW1A 3CCLV 3OTOB 1VMGA 1QVFU 2FYUH 3JATA 2YI8A 2BTQA 3CB2A 4DV1O 4WF9V 4GKKB 5K1PA 5CA1B 1H8HG 2E74B 3UT5B 2JGDA 5EZYB 4CS4A 4X66B 1HR0O 1JFFB 3P3NA 5FPOA 1P49A 2F1MA 1IXMA 2QSAA 1ZUQA 1PNLA 3ZMZA 2QM4A 2QWQB 4I4TB 5CA0A 1AJQA 2OTLV 3M7MX 3MD0A 4YY3B 1AR5A 4J7ZA 3PN1A 1Q6HA 1AI7A 1BL8A 1NI8A 1GO3F 2LFSA 4UB6Z 2JS3A 1EN5A 4WFGA 2WPDG 3ZBHA 2QWRB 2E76B 3EFFK 3SYAA 3D36C 1GM8A 4KFMA 3W7XA 5KHGA 4NR1A 4X1IA 4C7UA 1TUBB 3OMIB 1YJWV 2IJKA 3G71V 1SRYA 3H1LH 2K9PA 3K08A 3QTCA 1F7YA 2A9HA 5JCOC 1P4RA 3B8MA 5KUKA 2P6JA 4JYAO 4AI8A 3B09A 2ZIOA 4X1KB 1N33B 5GONA 4UCVA 2VQEB 1XHXA 1L0LH 2CE4A 2OT5A 3E8BA 4DV3O 4EB6B 1Q81W 3J7AU 1GK9A 1QR9A 4MW3A 2ZT9B 1XNRO 4JI4B 1M4UA 4JYCA 2RNBA 1WPXA 1AI6A 1G4YB 5J2UA 5IYBO 4UCTA 4PDRA 1M9NA 2W0FC 5LOVB 5IYZB 1Y4MA 2Z5UA 1E79G 1QR8A 1S0VA 1VF7A 1J5EO 2EJRA 2ZINA 1S76D 5HFMA 2Q7GA 3UQ8A 1W59A 3JSLA 5IT9N 1FJGO 1RPRA 2HJDA 1IVSA 3W7SA 2P5OA 4JTAB 1KP2A 2VQFO 3K9AA 3SPJA 3BCCH 2FKXA 3CYOA 4LF4B 2MK3A 1KKDA 1SF9A 3G6BA 4IT5A 4R6ZA 4B3TO 4DUZO 5JWPA 1H2NA 3SPIA 1Q86W 2DYRC 2LW7A 2ITCC 3KKYA 4DR5O 4JTCB 4FLWA 2PZSA 4NVPA 3CCMV 4JI0O 3N2KB 3NXSA 4OGQB 1ZSPA 5CMUA 1N0JA 3CXCU 2F4VB 1OCZB 4I50B 1JVMA 2K1EA 1XNQO 4H33A 2RN9A 1N36O 3X2QC 2CTQA 2JGUA 3K06A 1H38A 4K8ZA 1QLNA 1A32A 4UVCA 2IW5A 2R9AA 2QM8A 4LF8O 3SPHA 3BEHA 4CZZA 1F23A 3ZHVA 4O4JA 5H2FZ 5LA6B 1TA8A 4FZ1A 3E35A 3CCUV 1SERA 1BSMA 4BIOA 3K59A 5JQGA 4YJ3B 3CX5F 3K9SA 4FLUA 2XUMA 1XMQB 3H01A 4JV5B 3P3PA 3W7UA 2AZ0A 1TGOA 2PGGA 1AI4A 3TXSA 5LMNB 1PL4A 4X8AA 1WN7A 2LGQA 4GT1A 2AGAA 1OZ0A 2E5LO 1S5HC 5IJ0A 1JJOA 2JEUA 1KMIZ 2QJ1A 5DN6G 3ZRVA 4DO2A 4PV1B 5A2QN 1JPXA 1E1RG 4O4LA 3D36A 1IURA 3K5NA 4X64O 4FFKA 1THZA
chains in the Genus database with same CATH topology
1ZTEA 1D5NA 4JZ2A 1QNMA 1ZUQA 1N0NA 1AP6A 1AR5A 3IC9A 3KKYA 3C3SA 1EN5A 4JZGA 3TJTA 1GN4A 1XDCA 4E4EA 1B06A 4C7UA 1ZSPA 3DC5A 1GN3A 1VEWA 1N0JA 1MA1A 1EM1A 1BS3A 1SZXA 3OT7A 1GN2A 5AG2A 4JYYA 1P7GA 1I0HA 4GUNA 1XILA 1BT8A 1JR9A 2ADQB 1LUVA 1WB8A 3QVNA 5A9GA 2QKAA 2RCVA 1KKCA 3AK2A 3BFRA 1AR4A 3RN4A 3C3TA 2CE4A 4X9QA 1BSMA 1PM9A 3K9SA 1MSDA 3DC6A 1XREA 4YIOA 4YIPA 3CEIA 3KDRA 1AP5A 1IDSA 1AVMA 3AK1A 1PL4A 1I08A 3LSUA 1XUQA 1Y67A 2GDSA 4F6EA 4BR6A 2P4KA 1VARA 3AK3A 2CDYA 1EN4A 1WB7A 2ADPA 1ZLZA 1IX9A 1MNGA 1EN6A 2QKCA 1LUWA 3MDSA 1GN6A 1JA8A 4FFKA 1IXBA 1MMMA 3EVKA 2AW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZTE A;  1D5N A;  4JZ2 A;  1QNM A;  1ZUQ A;  1N0N A;  1AP6 A;  1AR5 A;  3IC9 A;  3KKY A;  3C3S A;  1EN5 A;  4JZG A;  3TJT A;  1GN4 A;  1XDC A;  4E4E A;  1B06 A;  4C7U A;  1ZSP A;  3DC5 A;  1GN3 A;  1VEW A;  1N0J A;  1MA1 A;  1EM1 A;  1BS3 A;  1SZX A;  3OT7 A;  1GN2 A;  5AG2 A;  4JYY A;  1P7G A;  1I0H A;  4GUN A;  1XIL A;  1BT8 A;  1JR9 A;  2ADQ B;  1LUV A;  1WB8 A;  3QVN A;  5A9G A;  2QKA A;  2RCV A;  1KKC A;  3AK2 A;  3BFR A;  1AR4 A;  3RN4 A;  3C3T A;  2CE4 A;  4X9Q A;  1BSM A;  1PM9 A;  3K9S A;  1MSD A;  3DC6 A;  1XRE A;  4YIO A;  4YIP A;  3CEI A;  1AP5 A;  1IDS A;  1AVM A;  3AK1 A;  1PL4 A;  1I08 A;  3LSU A;  1XUQ A;  1Y67 A;  2GDS A;  4F6E A;  4BR6 A;  2P4K A;  1VAR A;  3AK3 A;  2CDY A;  1EN4 A;  1WB7 A;  2ADP A;  1ZLZ A;  1IX9 A;  1MNG A;  1EN6 A;  2QKC A;  1LUW A;  3MDS A;  1GN6 A;  1JA8 A;  4FFK A;  1IXB A;  1MMM A;  3EVK A;  2AW9 A; 
#chains in the Genus database with same CATH topology
 2DW4 A;  3VQW A;  4QE9 A;  4DYL A;  3UT5 A;  1YIT V;  2WLK A;  3U10 A;  1R6T A;  1O9G A;  3C3S A;  2KSD A;  1NR7 A;  2BSK B;  1VIB A;  1V55 C;  3STZ C;  4LF7 O;  4WBN B;  1SET A;  1M56 C;  1VEW A;  4IHJ B;  2E3C A;  1ZAU A;  4I4T A;  1HNX B;  3JAL B;  1EM1 A;  3K79 A;  4Z2W A;  1SZX A;  1K4C C;  5CBF A;  4TQF A;  5LA6 A;  3OTF A;  1P7G A;  5LP6 B;  4QPK A;  1XIL A;  1N33 O;  5LOV A;  2A0L A;  3QG5 A;  2KG7 A;  3HKD A;  4R8C A;  2Q5Z A;  2Q4P A;  4RUE A;  1KKC A;  1OHH G;  4B3R B;  2B1I A;  4PA7 A;  3I5D A;  1RFY A;  2N05 A;  3HKE B;  2R9R B;  1IBK O;  1EBO A;  2DYS B;  3RYC A;  1PKX A;  2H94 A;  4LF9 O;  2EIL B;  3GVM A;  1ZWI C;  2QE7 G;  1SES A;  2X6B A;  5BR8 O;  2KQX A;  1URF A;  4EEQ A;  1Z2G A;  1AVM A;  3OEE G;  3APO A;  2YIA A;  4ZI7 A;  1HP8 A;  3OGC C;  4DUY O;  2B5U A;  2Y0P A;  4D7S A;  2D3O W;  2R70 A;  5FLX N;  5KLV H;  3RYH A;  2YXY A;  3BA8 A;  1W2B U;  2UUA B;  5EYP A;  1V55 B;  3ZMV A;  2H3O A;  5EBL C;  4LWS A;  3K0G A;  1FYJ A;  4AQY B;  1Z5W A;  3CCR V;  1QNM A;  4DV0 O;  1YTF D;  3L73 H;  2YS8 A;  1AP6 A;  2QTS A;  3U11 A;  2ZCE A;  2FML A;  2ZD9 A;  3H1J H;  4H13 B;  2F4V O;  5JVD B;  4IIJ B;  1N34 B;  3WG7 B;  2JS5 A;  3DC5 A;  3ZMU A;  4FK5 C;  2MW2 B;  4O4H A;  2ZNI A;  1FXK A;  1F4N A;  2GV9 A;  5BR8 B;  4LR3 A;  3JSN A;  1XL4 A;  1F51 A;  1Y66 A;  3AG2 B;  1R3J C;  5BZB A;  2P90 A;  2OTJ V;  2CTW A;  3QVN A;  1HW7 A;  1SQV H;  5L3D A;  1KP3 A;  5LBQ A;  4DR1 O;  4JAU A;  4Z1M G;  5DEC A;  5LP6 C;  4DRX B;  2UUB B;  2RMK B;  4X89 A;  1QLE B;  4GZR B;  1YCI A;  4WFA V;  3LDD A;  3JCU Z;  5TIS Z;  3SGI A;  4FLV A;  1TUB A;  1PM9 A;  1H2K A;  3SJB C;  1BZK A;  1XRE A;  3ABL C;  4MVQ A;  5KHJ A;  2PY5 A;  3UO3 A;  1SQX H;  2NR5 A;  2LGW A;  3T4Z A;  4X88 A;  5JQG B;  1WA8 A;  5JJE B;  3CSX A;  4FLT A;  1UJW B;  2GDS A;  2DQ3 A;  1N36 B;  1HNZ B;  4FM1 A;  2Y69 C;  4U3J B;  4NB5 A;  4N23 A;  5KHK A;  3P30 A;  4FM0 A;  4LF8 B;  1TVK B;  4EKW A;  4JYB A;  3A8T A;  2AXT Z;  1GN6 A;  1CXZ B;  3RN4 A;  1RSO A;  1VQ6 V;  4KXR A;  4X20 B;  1IJG A;  4XDK A;  2OCC C;  1Q82 W;  4YXW G;  4B08 A;  5B1N A;  4LF7 B;  3RT3 C;  1N8R W;  2YI9 A;  2WSS G;  3LNN A;  4QIW F;  3QF7 A;  3ZRX A;  4FPP A;  3AG3 C;  3H9V A;  5B1A B;  1XOU A;  1FFT B;  4KHP B;  3O65 A;  4JPR A;  3LDC A;  1QHT A;  5IYZ A;  5CN0 A;  3BRC A;  5EC2 C;  4E2L A;  2C2A A;  2WLI B;  4B3R O;  2IH3 C;  3CC2 V;  3JD0 A;  1NU1 H;  2QR4 A;  2ODM A;  1XI1 A;  2P67 A;  4B3S O;  3RGB A;  3AG4 B;  4JI3 O;  4LF5 B;  2PYL A;  5E79 Z;  3CJH A;  3T2M A;  4J11 A;  3ASO B;  1VF5 B;  2KG7 B;  3ZRW B;  1D2D A;  2XAQ A;  2EIM C;  4DRX A;  2PYJ A;  4UV8 A;  1OJH A;  1XBL A;  2EBO A;  3L70 H;  4P2Z A;  3N2G B;  1AB3 A;  2XAF A;  2Q73 A;  3AK1 A;  4L8J A;  3ABK C;  4O4I A;  4NXM B;  1HNW O;  3IAY A;  4YJ2 A;  1IBL O;  4UVA A;  3RBZ A;  2CGO A;  1SS3 A;  4TV8 A;  3SYP A;  4BR6 A;  2P4K A;  1QU7 A;  4TUY A;  3CCE V;  3G67 A;  1ZL8 B;  4D7T A;  3AG3 B;  3SJC C;  1Q6U A;  3B40 A;  4UFZ A;  4FFB B;  4QE7 A;  3ZX6 A;  1RM1 B;  3DGE A;  5EC1 C;  3WB1 A;  3D3I A;  1XNQ B;  2OCC B;  2ZXW B;  5JJJ B;  1SQQ H;  3HKD B;  1KC8 W;  5L3E A;  4LF9 B;  4XDJ A;  1QQC A;  1H2M A;  3VOU A;  4JZG A;  3JAW A;  2DOS A;  3CCJ V;  1NH2 B;  5B66 Z;  2LP7 A;  3UO2 A;  3ZJZ A;  3A0B Z;  4J10 A;  3CRA A;  2PI5 A;  3RYC B;  4JI2 B;  1B6Q A;  1G6U A;  4JAA A;  3OT7 A;  2Z0A A;  3HKE A;  2EUL A;  4CH3 A;  1SQF A;  2Q67 A;  4O2A A;  4O4J B;  1YXB A;  2F95 B;  3B8N A;  3BPZ A;  2CTP A;  2X0L A;  4DR1 B;  1AIL A;  2A3Q A;  5EIB D;  4X62 B;  1PNM A;  4U7N A;  1NTM H;  1UPG A;  1J95 A;  4WFE A;  4LNU A;  1VQM V;  5EBM C;  1BHA A;  1AR4 A;  1FAF A;  4EFE A;  3CCV V;  4JI5 O;  1VQ8 V;  2M6Y A;  3CWB H;  1CEZ A;  2GHY A;  3ZMT A;  3LSS A;  1PNK A;  1U97 A;  4IHJ A;  3CE2 A;  2X7R B;  4O4I B;  4DV4 O;  4O2A B;  3A0R A;  2EIK B;  3SYO A;  1MSD A;  3RWR D;  5DM6 V;  5J9P C;  5F2V O;  1FKA O;  4OX9 O;  4W4L A;  3E22 A;  1R6N A;  3OM3 B;  3ZHR A;  4TQD A;  3LSU A;  4WFB V;  2P22 C;  4EB6 A;  1YZB A;  4F6E A;  2UXB O;  1RPO A;  5JVD A;  4UB8 Z;  3K58 A;  1VAR A;  3BY6 A;  1O9H A;  1BCC H;  4JI2 O;  1S3J A;  3TXQ A;  1HWY A;  3KCX A;  4GCZ A;  5KMG A;  5KA5 A;  3HKC A;  3Q4H A;  5LHG A;  2GTS A;  1KB9 F;  2R72 A;  4XDL A;  2VQE O;  2AW9 A;  1MG1 A;  1DF5 A;  1FXK B;  1FFX B;  2O57 A;  2CAZ C;  1M56 B;  4XBF A;  4DR6 O;  4KHP O;  5LMU B;  2ZNJ A;  2ZE7 A;  5KX5 A;  4PI0 A;  5HFL A;  4TV8 B;  4LF6 O;  3G80 A;  1K5Q A;  1K97 A;  4TV9 A;  5B3S C;  3UKM A;  2V7Q G;  4ZKI A;  1YF2 A;  4WBN A;  4FJC C;  1IBK B;  3JAM N;  2BSK A;  2JRI A;  4A5U B;  4GYC B;  1JX9 A;  2VWJ A;  4X65 B;  4R50 A;  2XAG A;  2YIC A;  4LF5 O;  1BT8 A;  1FJG B;  5JCO A;  2ADQ B;  3F5W C;  3K5L A;  5IWA O;  1JNB A;  1V54 C;  4H44 B;  4CS3 A;  4DK0 A;  1SZT A;  3ZN0 A;  2ZM6 B;  3RFR A;  4LP8 A;  3TGU H;  3SR2 C;  2KKW A;  1HNX O;  1W0K G;  3CRM A;  1AJP A;  1QBZ A;  1DK1 A;  4QJF B;  4LFA O;  3ETD A;  5IJ9 B;  4DV3 B;  5KUM A;  4DR5 B;  5LXT B;  2G38 A;  2YIB D;  1Y6X A;  4Q20 A;  1EFR G;  2RJZ A;  1XUQ A;  1S77 D;  4DV7 O;  2HHH O;  4I5S A;  4ZI7 B;  1QVG U;  1GMG A;  2UXD O;  1XMO B;  1EZV H;  4P9P A;  3WU2 Z;  1VQP V;  4DV5 B;  4J9Y B;  1SKV A;  2QTO A;  4ZOL B;  2JEX A;  4GX1 A;  1SQB H;  1X59 A;  4JI7 B;  4J7K A;  3RVZ A;  3K57 A;  2Y4T A;  2XOK G;  3BAB A;  3E2E A;  1Q7Y W;  1WA8 B;  4HYO A;  2WLI A;  3QO5 A;  3IJ4 A;  4I55 A;  4B3M B;  3U0Z A;  2AHY A;  2KB1 A;  3A2F A;  4B7E A;  2HVJ C;  2UXN A;  3KG2 A;  1Q5O A;  3RYI A;  2HR3 A;  5FNV A;  4AIL C;  2OYQ A;  1YSC A;  5GW7 A;  2ZR3 A;  1VQ9 V;  4YHH B;  5AG2 A;  5BXZ A;  5B1B C;  4GUN A;  2DWE C;  4X1Y B;  1PV0 A;  1N32 O;  4CC5 A;  2ZKO A;  4JI5 B;  2XAH A;  4U3F H;  5LHI A;  2RCV A;  2WLH A;  1RSO B;  1R3I C;  3M8A A;  1Q3E A;  4IL6 Z;  1I94 B;  4UV9 A;  3R66 A;  1HNZ O;  1FS0 G;  3BVO A;  4O2B A;  2GSM B;  4KUM A;  2ZQM A;  4QPJ A;  4F6R B;  1JJ2 U;  3MHS C;  3OAA G;  5L3G A;  4NXN B;  3ASN B;  2Q0A A;  4U3J A;  1PL0 A;  2OIG A;  2R9I A;  4MVZ A;  2IM9 A;  3ZHU A;  1GM7 A;  2YXL A;  2UXB B;  3OE7 G;  2EX3 A;  2HLD G;  3FB8 C;  2HFE C;  1T5E A;  1M90 W;  2ZIM A;  1G1X B;  1VP7 A;  5KX5 B;  3K0D A;  3ASO C;  1K33 A;  4MTX A;  3S3X A;  4ABM A;  1B3Q A;  3I56 V;  2X6A A;  1EN4 A;  2ZDI A;  3FB6 C;  4J9Z B;  1YI2 V;  3ZRW A;  3ZHQ A;  3ZED A;  2L35 A;  1K9M W;  1OCC C;  3W7T A;  3EVK A;  4LWS B;  2VWK A;  2XND G;  4X20 A;  1R73 A;  4IGG A;  3K04 A;  1N0N A;  5EBW C;  3T1H B;  4MVM A;  3CMA V;  4X64 B;  5K1X A;  1NVP D;  1BE3 H;  4FMT A;  3A0H Z;  3AEI A;  4CBC A;  1VQN V;  3C90 A;  5LHH A;  2EIK C;  1YJN V;  2LO1 A;  1KUQ A;  4J42 A;  2XT9 A;  5JJN B;  4CH5 A;  4UCU A;  1S5L Z;  1XQ8 A;  3EXA A;  3WFV A;  4JYY A;  2OCH A;  3SYC A;  2F43 G;  3G6E V;  1OCO C;  4OPH A;  2ZM6 O;  5LXT A;  4ICG A;  3CCS V;  4WFF A;  2XTA A;  5BMV A;  2P06 A;  2UUC B;  4NXM O;  1AJN A;  3G4S V;  3BFR A;  4RO2 A;  2ARH A;  1HDJ A;  4LH7 A;  2EIM B;  4JI1 O;  5H9C A;  1NH2 D;  3OMA B;  2DWD C;  1BHB A;  3CRC A;  2DN9 A;  1Q8I A;  3W7W A;  1M1K W;  1N4C A;  3NR7 A;  1K4D C;  1HR0 B;  2UU9 O;  3H1I H;  3ZCC A;  3ABL B;  5C8Y B;  4LFB B;  1R1B A;  4K0K B;  4I9W A;  1ZL8 A;  2ZE8 A;  2W6I G;  5LGT A;  4B3S B;  1DTO A;  2Q68 A;  3IFX A;  2W6J G;  2ATK C;  4LFC O;  2WLL A;  1KQS U;  3CPW U;  1AI5 A;  1WB7 A;  3CHX A;  4LNU B;  2CH7 A;  3FAV B;  1ZLZ A;  2QWO B;  2CK3 G;  2HVK C;  3TK1 A;  1XMQ O;  2BE3 A;  3T1C A;  3AG2 C;  4TSF G;  4UXN A;  4TWK A;  4WFH A;  1JA8 A;  4GX5 A;  4DR7 B;  3OD4 A;  1HNW B;  3DSQ A;  4F4L A;  1IBL B;  5CA3 A;  4DV6 O;  1SA0 A;  2ZE6 A;  3CJH B;  2A7W A;  2ZDI C;  3WG7 C;  3FYI B;  1VF6 A;  5ITZ B;  5LGN A;  4DV0 B;  4BIZ A;  2BOB C;  2GUZ B;  1XDC A;  2EZO A;  4LC1 A;  5IYC O;  2GBO A;  4J7J A;  3L72 H;  2DMX A;  4HAM A;  5IY5 B;  1WP8 A;  2Q0O C;  4JI4 O;  3JAW B;  4PA4 A;  1S5J A;  2PF4 E;  1OV9 A;  5J2T B;  2UU9 B;  4DR4 B;  3JD1 A;  4DV4 B;  4PI2 A;  3LSQ A;  4BAY A;  4KL1 A;  3SJA C;  3T4D A;  1DF4 A;  1JR9 A;  5FPR A;  2HKO A;  2V1D A;  3HKB A;  2Y0I A;  1LUV A;  2WA3 A;  3SPC A;  4K8X A;  3E8H A;  2YIB A;  4PA6 A;  3MHH C;  3L75 H;  4UCS A;  3OGI B;  3BHP A;  3GWO A;  1J5E B;  3ETE A;  3ASN C;  2EIN C;  4JI7 O;  2XAS A;  3VQX A;  2OWO A;  4O4L B;  3IGA C;  1Y76 A;  3F5T A;  4I0X B;  4X9Q A;  2VQF B;  2H8P C;  2ETN A;  1WP7 A;  2E75 B;  3J81 N;  1WAZ A;  5LYJ A;  1YJ9 V;  3RYF B;  4YIP A;  1GKF A;  2CH7 B;  4X62 O;  2WLL B;  4W4K A;  2QKS A;  3CXH F;  2NLJ C;  1M57 B;  4YHH O;  3ABM C;  1K5S A;  2JIZ G;  2CGN A;  3OMN B;  4LH6 A;  1WJZ A;  4OPA A;  4HNA B;  3D8C A;  1JOY A;  2FL4 A;  2QGN A;  2JJ1 G;  1R6K A;  4DW0 A;  2ADP A;  3VQV A;  4ASU G;  4LF6 B;  4MS2 A;  2CUG A;  2LJ2 A;  4DR3 B;  3QNE A;  1H2G A;  2IJI A;  4OX9 B;  1SQP H;  4YY3 O;  4Q6G A;  1IXB A;  2Y69 B;  1LR1 A;  4FLZ A;  4X65 O;  4P30 A;  2JGD B;  2EIJ B;  1Z5V A;  3OFN G;  4NYK A;  3JAK A;  3EHB B;  4NXN O;  5IWA B;  3E83 A;  4TT3 G;  1GM9 A;  4PEL A;  2P7T C;  4ZIB A;  2IU0 A;  1VQ7 V;  4L87 A;  5CB4 A;  5L3C A;  4PA9 A;  4TUY B;  3K5M A;  4UCO A;  1K73 W;  1KU9 A;  1GTO A;  3ICX A;  3JCZ A;  1FXK C;  1OCZ C;  4CH6 A;  4PDM A;  4F6R A;  3FD9 A;  3H1K H;  4JGS A;  2XAJ A;  5EYP B;  3J80 N;  2WA4 A;  2DYR B;  5KAI Z;  4X1K A;  4FZ0 A;  4PDV A;  2IH1 C;  2DYS C;  5LGU A;  1YDX A;  1WLE A;  3ABM B;  4J80 A;  2ZXW C;  1I7F A;  2LQT A;  4K0K O;  5KHH A;  4K35 A;  4X1Y A;  5GON B;  1OCR C;  3JAT B;  4RQF A;  3APQ A;  2IJJ A;  1ROP A;  1FXH A;  3ZHT A;  5CA1 A;  5GTH Z;  1YTF B;  2ZR2 A;  4K3A A;  1Q90 D;  4YJ2 B;  4LFC B;  3F7Y C;  1PP9 H;  4MTF A;  5J2U B;  2LW1 A;  2B1G A;  2ILM A;  3AK3 A;  4HBN A;  2W0X A;  1EZJ A;  3CS5 A;  2QKC A;  4O2B B;  4FIP C;  4LCU C;  3OUF A;  4JF3 A;  1ORQ C;  3TET A;  5IDJ A;  4UVB A;  3H1H H;  5GTI Z;  1ZTE A;  1D5N A;  3HKB B;  3ABT A;  1XNR B;  1DLB A;  2EJ7 A;  3L71 H;  1RP3 B;  1IBM O;  2Z3Y A;  1QCE A;  3AG1 B;  4JI8 B;  3TJT A;  3ZRS A;  3CRR A;  1XMO O;  4B7K A;  1MA1 A;  1XHZ A;  4I9Q A;  5ITZ A;  3HB3 B;  3VQY A;  5D5P A;  4NKG B;  4GX0 A;  1ARO P;  3PJS K;  2A06 H;  5B1A C;  3ZN1 A;  3ABU A;  2FB5 A;  1WB8 A;  3P32 A;  4JAS A;  2QKA A;  5JH7 B;  3OR6 C;  2Y48 A;  1WPB A;  4Z1V A;  4JV5 O;  4DV6 B;  4BIU A;  3ZHS A;  3OUS A;  4ZHQ B;  1OCC B;  3E22 B;  3ABK B;  2WLN A;  3M99 B;  3ETG A;  1XEQ A;  1M5I A;  4X66 O;  3ZS8 C;  2IBZ H;  1N32 B;  3WB2 A;  4AQY O;  3RW0 A;  4FLY A;  2EZP A;  1NTZ H;  3UCS C;  2E5L B;  2NNU A;  1KYO F;  3GB7 C;  3JD4 A;  2WLM A;  5CB4 B;  2D2C B;  1Y67 A;  4JI3 B;  1NJI W;  5IY5 C;  1N34 O;  2DQ0 A;  1JQ0 A;  5IE9 A;  1GRJ A;  2PTM A;  3RYI B;  4DV2 B;  2NN4 A;  1SC5 B;  1R3K C;  4UCR A;  1IX9 A;  1MZF A;  2Y4U A;  2Q6A A;  3RVY A;  3JD3 A;  3Q4H B;  3MDS A;  1P7B A;  4JZ2 A;  1UFI A;  2BTO A;  4BWA A;  4LBE C;  3KCY A;  2UXX A;  2B9Z A;  3ETQ A;  4JAV A;  3N2K A;  2YEV A;  2UUC O;  2F93 B;  1R3L C;  4LFA B;  5LMN O;  3FFQ A;  4DR6 B;  3B4S A;  4P9O A;  1PPJ H;  3JAR B;  4JI1 B;  4IYI A;  2JDI G;  1GN2 A;  1KEC A;  1U96 A;  2N04 A;  3JAS A;  3QO7 A;  3N2G A;  4I55 B;  1H2S B;  4GKJ O;  1I5X A;  3T1H O;  2AZ2 A;  1IZ3 A;  4PA3 A;  1MOF A;  3FYE B;  3AG1 C;  4DR3 O;  3FAV A;  5FL7 G;  4CH4 A;  3IC7 A;  5KHI A;  1ENV A;  4DV5 O;  4HNA A;  3L74 H;  1JCH A;  1VF6 C;  4G27 B;  1NZ6 A;  3C3T A;  2YC0 A;  2OIE A;  1TAE A;  2XHB A;  3JAL A;  4PJ0 Z;  5H5N A;  3AG7 A;  4MVS A;  3OR7 C;  3SPG A;  2DE0 X;  4LF4 O;  4YIO A;  2M7W A;  1AP5 A;  4I50 A;  1H5W A;  4MVO A;  4DR7 O;  3GWK C;  1BGY H;  1V9P A;  3HR0 A;  1K34 A;  3KZI Z;  1QLE C;  5C93 A;  3HPL C;  3E8G A;  2QM7 A;  1VQL V;  1FXV A;  2PI4 A;  3LUT B;  1SA0 B;  5BY1 A;  1Y76 B;  2UXC O;  1MNG A;  1EN6 A;  3FX7 A;  2F23 A;  4MSW C;  2IU3 A;  1CP9 A;  5D5Q A;  4RUF A;  2RQ6 A;  2Q7E A;  5JH7 A;  4GKJ B;  1NQT A;  4DR2 B;  3CC7 V;  4H0L B;  2LFR A;  2BTQ B;  1K8A W;  3JAR A;  5LP6 A;  4U7O A;  1Y74 B;  1V54 B;  2IJH A;  3K3W A;  3CP1 A;  2QDO A;  2YEV B;  1VQK V;  5IJ0 B;  3SDL A;  3K03 A;  2AHZ A;  1BQZ A;  5H6R A;  3B77 A;  1I5Y A;  1L8D A;  4IIJ A;  1BS3 A;  3CRQ A;  5C8Y A;  2YID A;  4TOI A;  3L9D A;  4RAI A;  4B3T B;  4GLX A;  2UUA O;  5B3S B;  2QWP B;  3AG4 C;  4DUZ B;  1TVK A;  4I0X A;  4FFB A;  3DTU B;  2HJF C;  2CTR A;  3TCU A;  1SQG A;  5LMU O;  4ZOL A;  4MW8 A;  4YJ3 A;  3N27 A;  4JI6 O;  4DK1 A;  1P84 F;  2ITD C;  4I7Z B;  1NS1 A;  2VS0 A;  2QWN B;  3CCQ V;  1KBH A;  2X6C A;  3JAS B;  5KAF Z;  1NKD A;  2GTA A;  1YHQ V;  1GAX A;  4DR2 O;  5EK0 A;  1L1F A;  1XL6 A;  1I08 A;  5B1B B;  4D6T H;  4ZHQ A;  2GUZ A;  4MT8 A;  4MVR A;  3RYF A;  4J41 A;  1WNS A;  2JJ2 G;  3D3Q A;  4DXW A;  2CDY A;  2YUA A;  1KD1 W;  1D5A A;  3OTO O;  1Y74 A;  3DXR B;  1H2L A;  3B2E E;  3WB0 A;  1MMM A;  5LL6 Y;  5L3B A;  1H8E G;  1CPY A;  3CME V;  4O4H B;  1X4T A;  3HKC B;  3BAA A;  2PUS A;  2Q9L A;  1YVW A;  4GX2 A;  4BW5 A;  3F7V C;  4DV7 B;  2HHH B;  3LDE A;  4CS2 A;  4JI6 B;  1B06 A;  3MAQ A;  2UXD B;  4RQE A;  1B04 A;  1GN3 A;  4KP4 A;  1MAB G;  5B1O A;  4JTD B;  2VRZ A;  3QO8 A;  2EIJ C;  3CD6 V;  4N21 A;  5IYD O;  3THO A;  1F4M A;  5IJ9 A;  5DED A;  5FNV B;  3S3W A;  3ZIA G;  1Q6I A;  3STL C;  1FFX A;  5BMV B;  2RDC A;  4G28 B;  4CC6 A;  2WAM A;  2FTK A;  3AK2 A;  2EIL C;  2Q69 A;  1PD3 A;  4B3M O;  1OCR B;  2HG5 C;  1BQ0 A;  2N74 A;  4DUY B;  1FOU A;  5J2T A;  3SJQ C;  1M57 C;  1COW G;  1VQO V;  1JFF A;  2QA4 V;  1RM1 C;  3I55 V;  1AR1 B;  4HZ3 A;  2Q8V A;  1VQ4 V;  3KDR A;  1IDS A;  4FLX A;  4PD4 F;  4H37 A;  2DJV A;  4JI0 B;  3JYC A;  2WLJ A;  4LFB O;  1Q43 A;  1I94 O;  1GH6 A;  4AHC A;  2JK5 C;  1MZE A;  2Q7H A;  1IBM B;  4ZBM A;  4DR4 O;  3E89 A;  4X1I B;  1NTK H;  4JI8 O;  1L0N H;  5CBH A;  2F66 C;  2WWW A;  5E1A C;  1LUW A;  3K5O A;  1YEW A;  5KA6 A;  5H6Q A;  5L3F A;  4NTW A;  3FKS G;  5CA0 B;  4MVU A;  3X2Q B;  1W0J G;  2YDE A;  1K3E A;  1LNQ A;  3DXR A;  3LNM B;  3ML0 A;  5EZY A;  1NVP B;  3FB5 C;  2P4V A;  1M93 A;  4RWU A;  1S72 V;  3T1Y B;  3OEH G;  2A79 B;  4TV9 B;  3JD2 A;  4FM2 A;  3IC9 A;  3CC4 V;  1DGS A;  1GN4 A;  4E4E A;  1MSW D;  1BMF G;  4DV1 B;  4GKK O;  2UUB O;  4OXS A;  4PDL A;  4IYH A;  1OCO B;  2ZE5 A;  1NR1 A;  1FPO A;  3UM7 A;  4PHZ A;  2QEX V;  5EIB C;  3SYQ A;  3BA9 A;  2BCC H;  4MTG A;  5LYJ B;  1I0H A;  3OW2 U;  3E8F A;  3R65 A;  4EFB A;  4NTY A;  1G8M A;  1ZX3 A;  4G2K A;  4BW9 A;  5KMG B;  2JVD A;  2UXC B;  2HEP A;  4QGP A;  4MTO A;  2V4D A;  5A9G A;  1NT2 B;  4FVM A;  3O9O A;  2BOC C;  2L6L A;  1US6 A;  1K7D A;  3FB7 C;  1FD9 A;  3JAK B;  2YXH A;  4UUJ C;  4R7C A;  4DV2 O;  3E86 A;  4QNH B;  4WCE V;  2EIN B;  3ZMS A;  5CBG A;  1TUE B;  4NTX A;  3RYH B;  1JMK C;  3DC6 A;  3CEI A;  2HP8 A;  1VQ5 V;  2YSU B;  1K92 A;  3VBB A;  1E1Q G;  1NBM G;  3T1Y O;  4JYA B;  1YIJ V;  5B5E Z;  4DW1 A;  3CCL V;  3OTO B;  1VMG A;  1QVF U;  2FYU H;  3JAT A;  2YI8 A;  2BTQ A;  3CB2 A;  4DV1 O;  4WF9 V;  4GKK B;  5K1P A;  5CA1 B;  1H8H G;  2E74 B;  3UT5 B;  2JGD A;  5EZY B;  4CS4 A;  4X66 B;  1HR0 O;  1JFF B;  3P3N A;  5FPO A;  1P49 A;  2F1M A;  1IXM A;  2QSA A;  1ZUQ A;  1PNL A;  3ZMZ A;  2QM4 A;  2QWQ B;  4I4T B;  5CA0 A;  1AJQ A;  2OTL V;  3M7M X;  3MD0 A;  4YY3 B;  1AR5 A;  4J7Z A;  3PN1 A;  1Q6H A;  1AI7 A;  1BL8 A;  1NI8 A;  1GO3 F;  2LFS A;  4UB6 Z;  2JS3 A;  1EN5 A;  4WFG A;  2WPD G;  3ZBH A;  2QWR B;  2E76 B;  3EFF K;  3SYA A;  3D36 C;  1GM8 A;  4KFM A;  3W7X A;  5KHG A;  4NR1 A;  4X1I A;  4C7U A;  1TUB B;  3OMI B;  1YJW V;  2IJK A;  3G71 V;  1SRY A;  3H1L H;  2K9P A;  3K08 A;  3QTC A;  1F7Y A;  2A9H A;  5JCO C;  1P4R A;  3B8M A;  5KUK A;  2P6J A;  4JYA O;  4AI8 A;  3B09 A;  2ZIO A;  4X1K B;  1N33 B;  5GON A;  4UCV A;  2VQE B;  1XHX A;  1L0L H;  2CE4 A;  2OT5 A;  3E8B A;  4DV3 O;  4EB6 B;  1Q81 W;  3J7A U;  1GK9 A;  1QR9 A;  4MW3 A;  2ZT9 B;  1XNR O;  4JI4 B;  1M4U A;  4JYC A;  2RNB A;  1WPX A;  1AI6 A;  1G4Y B;  5J2U A;  5IYB O;  4UCT A;  4PDR A;  1M9N A;  2W0F C;  5LOV B;  5IYZ B;  1Y4M A;  2Z5U A;  1E79 G;  1QR8 A;  1S0V A;  1VF7 A;  1J5E O;  2EJR A;  2ZIN A;  1S76 D;  5HFM A;  2Q7G A;  3UQ8 A;  1W59 A;  3JSL A;  5IT9 N;  1FJG O;  1RPR A;  2HJD A;  1IVS A;  3W7S A;  2P5O A;  4JTA B;  1KP2 A;  2VQF O;  3K9A A;  3SPJ A;  3BCC H;  2FKX A;  3CYO A;  4LF4 B;  2MK3 A;  1KKD A;  1SF9 A;  3G6B A;  4IT5 A;  4R6Z A;  4B3T O;  4DUZ O;  5JWP A;  1H2N A;  3SPI A;  1Q86 W;  2DYR C;  2LW7 A;  2ITC C;  3KKY A;  4DR5 O;  4JTC B;  4FLW A;  2PZS A;  4NVP A;  3CCM V;  4JI0 O;  3N2K B;  3NXS A;  4OGQ B;  1ZSP A;  5CMU A;  1N0J A;  3CXC U;  2F4V B;  1OCZ B;  4I50 B;  1JVM A;  2K1E A;  1XNQ O;  4H33 A;  2RN9 A;  1N36 O;  3X2Q C;  2CTQ A;  2JGU A;  3K06 A;  1H38 A;  4K8Z A;  1QLN A;  1A32 A;  4UVC A;  2IW5 A;  2R9A A;  2QM8 A;  4LF8 O;  3SPH A;  3BEH A;  4CZZ A;  1F23 A;  3ZHV A;  4O4J A;  5H2F Z;  5LA6 B;  1TA8 A;  4FZ1 A;  3E35 A;  3CCU V;  1SER A;  1BSM A;  4BIO A;  3K59 A;  5JQG A;  4YJ3 B;  3CX5 F;  3K9S A;  4FLU A;  2XUM A;  1XMQ B;  3H01 A;  4JV5 B;  3P3P A;  3W7U A;  2AZ0 A;  1TGO A;  2PGG A;  1AI4 A;  3TXS A;  5LMN B;  1PL4 A;  4X8A A;  1WN7 A;  2LGQ A;  4GT1 A;  2AGA A;  1OZ0 A;  2E5L O;  1S5H C;  5IJ0 A;  1JJO A;  2JEU A;  1KMI Z;  2QJ1 A;  5DN6 G;  3ZRV A;  4DO2 A;  4PV1 B;  5A2Q N;  1JPX A;  1E1R G;  4O4L A;  3D36 A;  1IUR A;  3K5N A;  4X64 O;  4FFK A;  1THZ A; 
#chains in the Genus database with same CATH homology
 1ZTE A;  1D5N A;  4JZ2 A;  1QNM A;  1ZUQ A;  1N0N A;  1AP6 A;  1AR5 A;  3IC9 A;  3KKY A;  3C3S A;  1EN5 A;  4JZG A;  3TJT A;  1GN4 A;  1XDC A;  4E4E A;  1B06 A;  4C7U A;  1ZSP A;  3DC5 A;  1GN3 A;  1VEW A;  1N0J A;  1MA1 A;  1EM1 A;  1BS3 A;  1SZX A;  3OT7 A;  1GN2 A;  5AG2 A;  4JYY A;  1P7G A;  1I0H A;  4GUN A;  1XIL A;  1BT8 A;  1JR9 A;  2ADQ B;  1LUV A;  1WB8 A;  3QVN A;  5A9G A;  2QKA A;  2RCV A;  1KKC A;  3AK2 A;  3BFR A;  1AR4 A;  3RN4 A;  3C3T A;  2CE4 A;  4X9Q A;  1BSM A;  1PM9 A;  3K9S A;  1MSD A;  3DC6 A;  1XRE A;  4YIO A;  4YIP A;  3CEI A;  3KDR A;  1AP5 A;  1IDS A;  1AVM A;  3AK1 A;  1PL4 A;  1I08 A;  3LSU A;  1XUQ A;  1Y67 A;  2GDS A;  4F6E A;  4BR6 A;  2P4K A;  1VAR A;  3AK3 A;  2CDY A;  1EN4 A;  1WB7 A;  2ADP A;  1ZLZ A;  1IX9 A;  1MNG A;  1EN6 A;  2QKC A;  1LUW A;  3MDS A;  1GN6 A;  1JA8 A;  4FFK A;  1IXB A;  1MMM A;  3EVK A;  2AW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...