1N0JA

The structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
publication title The Structure of Human Mitochondrial Mn3+ Superoxide Dismutase Reveals a Novel Tetrameric Interface of Two 4-Helix Bundles
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1n0jA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1n0jA02
1AVMA 1AR4A 4JZGA 1LUVA 1MA1A 3C3TA 3QVNA 3OT7A 1IDSA 2CE4A 1EN6A 1AR5A 1I08A 5A9GA 3TJTA 1WB7A 1N0JA 1XDCA 1BSMA 1JA8A 1EN5A 1VEWA 1GN3A 1XREA 1AP5A 1SZXA 2CDYA 3LSUA 4F6EA 1JR9A 5AG2A 3AK1A 3AK2A 1IXBA 1ZSPA 4JZ2A 1B06A 4GUNA 3KKYA 4E4EA 1I0HA 3BFRA 2QKCA 4YIPA 1ZLZA 2ADQB 1MSDA 4BR6A 1IX9A 1D5NA 1EN4A 1BT8A 2ADPA 1QNMA 1MMMA 3K9SA 3C3SA 1PL4A 1EM1A 3MDSA 1P7GA 1MNGA 1GN6A 3AK3A 1XILA 1KKCA 1PM9A 2P4KA 2QKAA 1AP6A 1WB8A 1GN2A 1N0NA 4X9QA 3DC6A 2AW9A 3RN4A 2RCVA 4YIOA 1XUQA 1BS3A 1Y67A 3DC5A 3IC9A 1ZUQA 4FFKA 2GDSA 4C7UA 1VARA 3EVKA 3CEIA 1ZTEA 1GN4A 4JYYA 1LUWA
chains in the Genus database with same CATH superfamily
2QDOA 4MTGA 3FX7A 3RYHB 4WFFA 3WU2Z 3ZRXA 3R65A 3SPHA 2UXDB 1TUBA 4MTFA 1YTFB 1NVPD 5KLVH 4WFAV 4HBNA 4DV5B 2HP8A 1HWYA 2EILB 1AJPA 1AI7A 2QTOA 2ZDIA 3HKCA 4UV8A 1YJWV 2HKOA 4LC1A 3CC4V 3STLC 2CUGA 2Q0OC 4ICGA 2WLJA 1LNQA 3K0GA 1TUBB 1QLEC 1IURA 2BTQA 5EIBC 4FLYA 3C90A 4QE7A 3UT5A 4KHPO 4X1KB 4J9ZB 4DV1B 3HKCB 5KUMA 1TUEB 1I0HA 1NU1H 5LMNO 2BTQB 3ZN1A 3B77A 2UU9B 1XHZA 3AEIA 1NVPB 3UT5B 1IBKO 1FFTB 1IZ3A 2KG7B 3B40A 4U7OA 2X6CA 3OD4A 2ZCEA 4RUFA 2OTJV 1VQ8V 4LBEC 5LGUA 3ZHTA 3IC7A 1RFYA 4I0XA 2QKAA 1AP6A 2F1MA 4Q20A 4UCSA 5CA0A 3QNEA 4DV3O 4B3RB 2DYSC 4MSWC 1W0JG 4I0XB 4P2ZA 4X62B 2P4VA 3BAAA 2RJZA 4K8XA 2GDSA 1M4UA 1L0LH 3CMEV 3D36A 1SQGA 3K06A 5KUKA 2JS5A 1NJIW 3CXCU 4G27B 2YI8A 1ZTEA 1E1QG 5JH7A 1Q7YW 4JYBA 4QJFB 4I4TB 2VQFO 4DK0A 3LNNA 4KUMA 5E1AC 3ABTA 5DM6V 2HLDG 4GX0A 4DRXA 4HNAA 5E79Z 1H2SB 2E5LB 3ABKC 3B8MA 4FFBB 4MVMA 4FJCC 1AJNA 2HJDA 1XNRB 1PL0A 2PYLA 5GTIZ 2YIAA 4JYAO 4HNAB 4LF7B 5LMUB 3OAAG 4GKJO 3FB7C 2VQEO 2E75B 5CBGA 1YIJV 4GX1A 3P3PA 1MOFA 3BFRA 1KP2A 1AROP 1CP9A 4R8CA 2XASA 3MD0A 1VP7A 4LF4O 3CRQA 5L3EA 2XHBA 3FB6C 1Z2GA 1H2MA 1P7GA 1XMQO 1K73W 2A06H 2WAMA 2Q67A 3AG1B 4DUYB 1Q6UA 1WJZA 3T1YB 2YUAA 2Q68A 4UFZA 1OV9A 4B7KA 2EJRA 2XOKG 3L72H 3MAQA 2CH7A 1XQ8A 4JI1O 1TA8A 4UCVA 4O4IA 1KUQA 1VQNV 1YI2V 3AG2B 4WFGA 3AG3C 1O9HA 4PD4F 2EIKC 4J7ZA 3EFFK 5K1XA 1M9NA 4MW8A 3RGBA 1VQMV 3RYFA 1NZ6A 1GM8A 4YY3B 2CGOA 1JCHA 2ZE6A 4O4IB 2M7WA 3P30A 1AR4A 4LNUA 1IDSA 4X66O 1EN6A 1OJHA 2WLLA 4DR7O 3FB8C 3M8AA 1HNWB 1S76D 1ZL8A 3SYAA 2PGGA 1HDJA 3RYFB 3E2EA 2WLIA 4JI3B 2H8PC 5KHIA 2Y4UA 3ASOB 3RVZA 2BSKA 3G6BA 1S5HC 1OCZC 1AP5A 1YEWA 2Q9LA 4LNUB 4JI6B 3T2MA 1QCEA 1EZVH 5EBMC 1K34A 2MW2B 2UUBB 1BL8A 2WLLB 2ZDIC 1CEZA 1ZL8B 1E1RG 2WLIB 3CSXA 1S5LZ 2BSKB 1GAXA 4H0LB 1WAZA 3SPCA 4HYOA 2FMLA 5IY5B 3OEHG 5LHHA 4O4HA 2RQ6A 3ETQA 2X6BA 3ZHRA 3VBBA 4LP8A 2A9HA 5LP6C 2LFRA 4ZOLA 2BCCH 4DXWA 4H37A 1EM1A 4GKKB 1M5IA 4DUZO 5KHKA 4O4HB 3H1HH 4LWSA 3RFRA 5A2QN 4AQYB 2RN9A 4HAMA 1XOUA 1NH2B 3OGIB 3B09A 4ZOLB 4GZRB 2NNUA 1OHHG 1K33A 1W2BU 1I94O 5FLXN 1BHAA 2AZ2A 4O4LA 1SQVH 4NKGB 1HR0O 1H8EG 4LWSB 3ZMSA 4WF9V 5HFLA 1MG1A 5J9PC 4BIOA 2N74A 3L73H 1FXKA 3IFXA 1VARA 4OX9B 1NTKH 1WP7A 4FZ1A 4O4LB 3TK1A 3J81N 1GN4A 4JYYA 2CTPA 3D36C 5BY1A 5LOVA 1YXBA 4X64B 5C93A 1LUVA 1XBLA 1K3EA 3DXRA 1XMOB 3K5MA 1FXKB 1VF5B 2QJ1A 1S0VA 2ZM6B 3N2GA 5FPOA 1BCCH 1THZA 1BSMA 4PELA 1R3LC 5LOVB 4NXMO 4GT1A 5CBFA 2XAGA 3JAMN 3SYOA 2ITCC 1FFXB 1NKDA 3N2GB 3OTOB 1WPBA 2UUCB 3J80N 4K0KO 4PDMA 4JZ2A 5DECA 3OUFA 4UVAA 1QQCA 1DF4A 2EINB 1AI6A 3ABLB 4BW5A 3ZRWB 3U11A 3K03A 1GKFA 4EB6A 5IYBO 4I5SA 4JAVA 3CMAV 2IJHA 1MSDA 3FAVA 3ABMB 2LGWA 4FLUA 3ZRSA 2ZKOA 5JJEB 3P3NA 4GX5A 4ZI7B 1SZTA 1QNMA 1K92A 3L75H 3T4DA 4GCZA 5C8YA 4EB6B 5LA6B 3FAVB 3HKBA 3CJHA 3U10A 3OUSA 3SGIA 3L71H 2DYRB 3HKEA 3OW2U 4ABMA 2P90A 3T1CA 2HG5C 4OPHA 2ZR2A 1IBLB 3JALB 3HKBB 4LFAO 2FB5A 3CJHB 3RN4A 4J9YB 4LF5B 3K5NA 4B3TB 1RPRA 3HKEB 2UXBB 4D7TA 2YSUB 4LFCO 3M7MX 3OGCC 2YEVA 2HHHB 2IM9A 3E89A 1AVMA 1JX9A 5JQGA 2CE4A 3CX5F 5A9GA 4AI8A 3ZN0A 3ASOC 3WG7C 2OCCC 1T5EA 3CCJV 2UXXA 2YEVB 2EZOA 1JJ2U 1SZXA 4R50A 5LGTA 2A79B 2YIDA 5JQGB 4LF8O 2YDEA 3W7UA 2JRIA 1BGYH 1IXBA 3JAKA 1VQ4V 5FNVA 5LYJA 5IY5C 1YHQV 4MTOA 2Y69B 1S3JA 3OTFA 4X20A 3H1JH 1SC5B 3MHSC 3JAKB 2JVDA 2W0FC 5FL7G 5FNVB 2HFEC 1DLBA 5LHIA 3L70H 2JS3A 2B1GA 2EBOA 2HVKC 4J11A 4DR1O 1F4MA 1JMKC 4H33A 3QF7A 4NR1A 1HNZO 1JQ0A 2XAFA 5H9CA 3OMNB 3ZHUA 1K5QA 2JEUA 4EFBA 1URFA 3H1LH 3JSLA 4YHHB 2WWWA 1KBHA 1ENVA 3QO7A 3H01A 4K3AA 4BWAA 4NXNB 1XL6A 4LR3A 4DW0A 3F5TA 2AW9A 3DGEA 1XNQO 2DOSA 4JPRA 4MVOA 2GUZA 4DV6O 1N34O 4QIWF 3I55V 2GTAA 3E86A 3QTCA 2N05A 5L3DA 2IU3A 2WLMA 4WBNA 3SPJA 4DR4O 3LDCA 1IJGA 1LUWA 2ZR3A 2GUZB 1H2KA 4W4LA 3RBZA 4PA6A 4R6ZA 3I5DA 3U0ZA 3TJTA 2IH3C 3ETGA 3JD4A 2HEPA 3HR0A 5H5NA 2V1DA 4XDJA 4D6TH 1M56C 4RWUA 1PNKA 1TAEA 3CYOA 2Q7HA 1EBOA 4QPJA 4CH4A 3CCVV 2CDYA 3KG2A 4PV1B 4OPAA 5TISZ 4JI7O 1JR9A 1GTOA 1P7BA 3ABLC 4L8JA 4DK1A 1M57B 2AHZA 2GTSA 4JI5B 1FD9A 3E22A 4L87A 2GSMB 3ABMC 3CCUV 4ZKIA 1KB9F 3QO5A 1BQZA 3K59A 2F4VO 4X1KA 3K9AA 3DSQA 4DR6O 5IE9A 4B3MO 2WLNA 1VQLV 3E22B 3A0BZ 4DV4B 4MT8A 1SKVA 1GMGA 3K57A 1VQ9V 3KCYA 1LR1A 1PNMA 4JI8O 2QR4A 2DN9A 1FJGO 1SQFA 2DYRC 2UXCO 3X2QC 5LL6Y 1J5EO 4NTXA 2Q5ZA 2KG7A 1V55B 3DTUB 1PP9H 2UUAO 4QGPA 2Q7GA 4U3FH 1HW7A 2M6YA 4BAYA 1KKCA 4J7KA 1YCIA 1WB8A 1QU7A 4UB6Z 4TV8A 3BEHA 2JEXA 2B9ZA 5BR8B 1RM1B 1XL4A 1SF9A 5IT9N 4DYLA 5L3FA 2Q69A 3DC5A 1N36B 4TV8B 4DO2A 4LF6O 4DV2B 2RNBA 1N32O 3EVKA 2Y48A 2XUMA 3CHXA 4PI2A 1XHXA 5CA1A 1KU9A 3K3WA 2BOBC 4UVBA 1PPJH 3LUTB 4B08A 3ETEA 2RDCA 1WN7A 4I4TA 2R9AA 4FM1A 5B3SB 1VQOV 5CA1B 3N2KB 1O9GA 4FFBA 4TT3G 3S3XA 3CCMV 1DF5A 4FM0A 4PDVA 4JI4O 2F4VB 2PZSA 2Y69C 4GLXA 5B5EZ 3SPGA 1GH6A 3G71V 3CRRA 1QLNA 2AZ0A 3VQXA 2NLJC 4E4EA 1V54C 2B5UA 4RQFA 1FKAO 1FJGB 5B1NA 1IXMA 4KHPB 5B1AB 2JIZG 2ZNIA 2LQTA 1YF2A 1IBMO 5LMNB 1BT8A 2CTRA 2ZXWC 2FKXA 4RQEA 3C3SA 1PL4A 1IBKB 3MDSA 4FPPA 1JNBA 3JAWB 5BZBA 4WFEA 4JASA 4X1YB 1EZJA 4DV0O 3OFNG 1Y76A 3ZMVA 4IGGA 1PKXA 2LO1A 1K9MW 3WB2A 3B2EE 4GYCB 2G38A 5CMUA 5LHGA 2N04A 5JCOA 1F23A 3EXAA 3BHPA 1Y76B 1Y67A 3RYIA 1M90W 1ZUQA 4DV3B 4W4KA 3UCSC 2KQXA 3O65A 2Q73A 4U7NA 4Q6GA 4JV5O 5JJJB 4QPKA 1MA1A 4E2LA 4UUJC 3QVNA 3RYIB 5F2VO 2PF4E 4JI4B 5KMGA 2EIMC 2VQFB 3G6EV 1GK9A 5EK0A 5BXZA 1GN3A 1VF6C 2JDIG 1DTOA 1P84F 3D8CA 2KKWA 4MVZA 5KA6A 1TVKA 3RT3C 1OCOB 1Z5VA 5KMGB 1W59A 1P49A 2PTMA 1WA8B 1WPXA 1V9PA 1Y74A 2EILC 1YVWA 3WFVA 1UFIA 4JYAB 3KKYA 5FPRA 2PI5A 4TOIA 4GKJB 1VIBA 2VQEB 1TVKB 3CRMA 2P67A 1SS3A 4LFBO 2JK5C 3RWRD 1ORQC 3SPIA 1Y6XA 1MABG 1Y74B 1XI1A 4DV0B 2O57A 2WA4A 1RSOA 4EKWA 2ADPA 2EULA 3K9SA 1FXVA 1Q82W 4LF4B 2Z0AA 1RSOB 1JFFA 3OMAB 1DK1A 1XMQB 1PM9A 3HKDB 3AG4B 4MW3A 1RM1C 1B3QA 3CC7V 3K04A 3L74H 1VQ5V 3SYQA 1H2GA 4JTDB 4JAUA 3ZEDA 1J95A 1JFFB 2E3CA 1SQPH 5L3BA 1JJOA 4JI1B 5IYZA 1K4DC 2A3QA 2F43G 3CEIA 3QO8A 3UO2A 1H5WA 2ZT9B 3CCSV 3E8FA 2OIEA 3OT7A 5B3SC 1I08A 4N21A 2PYJA 1E79G 4OXSA 1GM7A 5ITZA 5IYZB 1OCCB 4LF9O 2YS8A 4X66B 4DR7B 1BZKA 4UCOA 4X65O 4H44B 2Q0AA 1QBZA 2XNDG 1F4NA 3SR2C 1R3JC 5ITZB 2WLKA 1SESA 4IHJA 1ZSPA 1W0KG 1NTZH 5B1AC 1F7YA 3ZHSA 1K8AW 1FFXA 3LSSA 4GUNA 1JVMA 3FB5C 2YXLA 5H6RA 1QR9A 4IHJB 1R1BA 1IX9A 4U3JB 3ZRWA 3JSNA 1EN4A 2QWRB 1VQ6V 4RO2A 3ASNB 1P4RA 5GW7A 4J41A 3T1HO 1N33O 2F93B 2F23A 4EEQA 2OWOA 3W7WA 2LFSA 3S3WA 2Y0IA 4F6RA 1FXHA 4ZI7A 1KQSU 3CWBH 4WCEV 4JI0O 5LA6A 2JGDA 4DUZB 1WNSA 3RW0A 5EIBD 4X9QA 4O4JA 4TUYA 1GM9A 4F6RB 3IGAC 4IIJB 2KB1A 3AG1C 2Q6AA 2HVJC 1QVFU 1I94B 3T4ZA 4DR5O 4PHZA 2JGDB 1Q6HA 3JALA 3ML0A 2CGNA 4FFKA 1AB3A 3ZMZA 2R9IA 1HR0B 5IWAO 4O4JB 1RP3B 4TUYB 1YJ9V 2ATKC 1OCRB 3WB0A 4YJ2A 2K9PA 4KXRA 3AG2C 4UCUA 3C3TA 3ZJZA 4WFHA 1NS1A 3FKSG 3LSQA 2DWEC 1QLEB 3BPZA 3JCUZ 1Q86W 1KC8W 1U97A 3BA8A 1OCOC 1VEWA 4CC6A 3G80A 4YJ2B 4FVMA 3ZS8C 2FL4A 1R3IC 4J10A 1HP8A 1G4YB 4NXMB 1G1XB 4O2BA 4DR3O 4K35A 2VWKA 2YC0A 3CCEV 3TXSA 3I56V 1WP8A 2QEXV 3LDEA 4K0KB 4UXNA 1JOYA 4O2BB 3BCCH 4ZIBA 3A0RA 3OE7G 4H13B 2OIGA 5IJ0A 5H2FZ 1FOUA 3CD6V 2MK3A 3B4SA 2QSAA 5EZYB 1GRJA 2EZPA 4CS2A 2LW7A 2DYSB 4DR2O 1XILA 4N23A 2E74B 2NR5A 4LH6A 5EYPA 5JWPA 1D2DA 5IJ0B 4NTYA 4DV7O 2ZE7A 2OTLV 1R73A 2IJJA 4B3SO 1ROPA 1B04A 1YDXA 3OR7C 4FLXA 4MVQA 4TWKA 5EYPB 1BS3A 5KA5A 4EFEA 4FLVA 4LFAB 4JI2O 3CRCA 4CS3A 3PN1A 3G4SV 4KFMA 4C7UA 3BY6A 2D3OW 4G2KA 4UB8Z 3VQVA 1NI8A 4NYKA 2DQ3A 2UXDO 2YXHA 2ZIOA 4LFCB 1OCCC 1BE3H 2QTSA 2YICA 1Q90D 2CTQA 4DV5O 2Q7EA 4ZBMA 5KHGA 3R66A 4UCTA 4CS4A 4LCUC 3CXHF 1CXZB 1YZBA 2YIBD 2PI4A 5K1PA 1Z5WA 3A0HZ 1D5AA 2EX3A 4MS2A 3LNMB 1H8HG 1I5YA 2AGAA 3PJSK 3GVMA 2PY5A 1FXKC 4B7EA 4K8ZA 4DV1O 4LF8B 4FK5C 2YIBA 1G6UA 2V7QG 3UM7A 2IJKA 3F5WC 2WPDG 2UU9O 2QM4A 1NR7A 2QKCA 4MVSA 4O2AB 4I50A 4CH3A 1D5NA 2EJ7A 1SQQH 2LW1A 3ABUA 3JCZA 2EINC 2JJ1G 2ZQMA 2GV9A 1JPXA 1UPGA 2LGQA 2E76B 5J2TA 4I50B 4DR1B 1ZAUA 2IW5A 4D7SA 1HNZB 2WA3A 4JI2B 4B3RO 5GTHZ 3CCQV 1GN2A 2EIKB 3K08A 3GWOA 4JF3A 4UVCA 4X62O 5J2TB 5B1OA 3HB3B 3AG7A 3CPWU 4YIOA 1OCRC 3IC9A 2B1IA 1XNQB 2X7RB 4DV6B 1N34B 4BW9A 1FYJA 3NR7A 1KD1W 2E5LO 1OCZB 4PJ0Z 4DR4B 4X8AA 1IVSA 3SJQC 2UXNA 2R70A 5IDJA 1Y66A 1XNRO 1G8MA 1VF7A 4XDKA 2GBOA 2EIJB 3GWKC 4LF7O 3K0DA 3JASA 1FPOA 2P22C 5LMUO 5LP6A 5LXTA 2LJ2A 5EBLC 3H1KH 4F6EA 4R7CA 3AK2A 3N2KA 3ZX6A 3APQA 2H94A 3L9DA 1M93A 1KKDA 4JI7B 2Z3YA 3JASB 4WFBV 3KZIZ 5LP6B 1WLEA 1Q5OA 5LXTB 4A5UB 1ZLZA 4RAIA 1M1KW 2W6IG 3WB1A 3JD1A 4BR6A 5CA3A 1Q43A 1SQXH 4FLZA 1MSWD 2OYQA 3A8TA 4I9QA 4CH6A 2CAZC 1MMMA 2H3OA 4DR6B 4DUYO 4B3MB 1X4TA 4F4LA 5EBWC 3T1YO 4X1IA 3H9VA 3JD2A 2Q8VA 3KCXA 4JI8B 5GONA 5CA0B 3G67A 2UXCB 4MVUA 5JVDA 2P4KA 1J5EB 1H2LA 3JAWA 2UUAB 4X1YA 2VRZA 4RUEA 1NQTA 4X1IB 1BHBA 1AI5A 1US6A 5GONB 4TV9A 2RCVA 2ITDC 5JVDB 4MVRA 5JH7B 2A7WA 4YY3O 2CK3G 1R3KC 4ZHQA 4Z1MG 4AHCA 4J7JA 4PA9A 4DRXB 1HNWO 4LF6B 4TV9B 1N32B 3K58A 1KECA 1A32A 4JI3O 1FAFA 1NR1A 2R9RB 4JI6O 1N0JA 2X0LA 4ZHQB 4Z1VA 3BVOA 2XAJA 2UUBO 1FS0G 3TXQA 3K5LA 3LSUA 2Y4TA 2DE0X 5AG2A 2BTOA 3FYEB 2QGNA 1SA0A 2ODMA 1XEQA 1B06A 1MZEA 1WA8A 5KAFZ 4KL1A 2JJ2G 4JYCA 1YJNV 1M57C 1PNLA 3TGUH 4G28B 1SA0B 3ZHVA 2ZE8A 1EFRG 1DGSA 4GKKO 4I9WA 1GO3F 1K4CC 1K97A 1L8DA 1SQBH 4FZ0A 1Q6IA 4TQDA 1QVGU 5EC1C 1IBMB 1GN6A 4AQYO 1Y4MA 3APOA 4ASUG 2CTWA 4CZZA 1NT2B 3FFQA 3VQWA 2CH7B 3ZHQA 4P30A 5L3CA 5J2UA 1N0NA 1F51A 3GB7C 3W7XA 3VQYA 1K7DA 5KHJA 3W7SA 1TGOA 2XT9A 3HKDA 1V55C 4I55A 3P32A 4OX9O 4JTAB 1COWG 2KSDA 3RYCA 5B66Z 5J2UB 3OR6C 3OM3B 3UKMA 4X64O 1N8RW 1L1FA 3WG7B 2OCCB 4XDLA 1XMOO 5H6QA 4I55B 5KAIZ 2ZM6O 4JZGA 1Q81W 2P5OA 1AR1B 2K1EA 4OGQB 2EIJC 2WSSG 3RYCB 3CRAA 1NH2D 5LGNA 4JV5B 3W7TA 1WB7A 4X88A 3ETDA 3NXSA 2HJFC 1EN5A 2DWDC 4YXWG 1XREA 3OTOO 3O9OA 2FYUH 2NN4A 2X6AA 3E35A 2VS0A 2UUCO 5D5PA 1SETA 2P6JA 2QWNB 4BIUA 1UJWB 1VQ7V 2IH1C 3ICXA 4JTCB 4XBFA 3K79A 3ZMUA 4FLWA 1ZX3A 3F7YC 4PA7A 3CB2A 2WLHA 4QNHB 2ARHA 4DW1A 2F66C 1RPOA 4YIPA 2DJVA 3ZIAG 2ADQB 3VOUA 1H2NA 2LP7A 2YI9A 3N27A 3TETA 3A2FA 2GHYA 3E8HA 2IU0A 4LFBB 2L35A 4NTWA 4U3JA 4UCRA 1K5SA 5BMVA 2ILMA 2DQ0A 3AK3A 1VQPV 4FMTA 1SERA 5CB4A 5B1BB 1IBLO 2IBZH 5HFMA 3FYIB 2ZIMA 3CS5A 1MZFA 4CH5A 4LF5O 2Y0PA 5BMVB 4AILC 4B3TO 2UXBO 5CB4B 1QR8A 3SJBC 1L0NH 4IIJA 3STZC 2HHHO 1BMFG 2F95B 2OT5A 2QM8A 1I5XA 5EC2C 4UV9A 1M56B 3DXRB 2RMKB 2OCHA 1NTMH 1KMIZ 4KP4A 4P9OA 4J42A 3ZCCA 1S5JA 2AXTZ 3THOA 3ZBHA 3CP1A 2IJIA 4PDLA 5JCOC 5LBQA 4FLTA 2ETNA 3IAYA 4IYHA 5JJNB 4LF9B 5DEDA 2VWJA 2P7TC 1HNXO 2PUSA 3AK1A 4X65B 1NBMG 5L3GA 1AI4A 3F7VC 3SDLA 3UO3A 1X59A 2L6LA 3B8NA 4IT5A 2QM7A 4TSFG 2Q4PA 4PI0A 1KP3A 1BQ0A 3X2QB 2W0XA 4FIPC 2ZINA 5C8YB 3CE2A 4TQFA 1H38A 1I7FA 2D2CB 3CCLV 4LH7A 3SJAC 3D3IA 2QE7G 3RVYA 2QA4V 2BOCC 3JARA 3T1HB 1N33B 2BE3A 3JD3A 4YHHO 3ZRVA 4MTXA 1KYOF 5KHHA 3BA9A 5EZYA 4NXNO 1AILA 1AJQA 5IJ9A 5CN0A 4CC5A 3SYPA 4JI0B 4HZ3A 4PA3A 3JARB 1Q3EA 3DC6A 1S77D 1R6NA 3TCUA 1OZ0A 3JD0A 4GX2A 5KX5A 3AG4C 2ZE5A 2FTKA 5IJ9B 3Q4HA 1ZWIC 4PA4A 3ZMTA 1R6TA 3LDDA 3SYCA 4DR5B 3KDRA 2XAHA 5IWAB 2JGUA 2V4DA 4QE9A 5KX5B 4NVPA 1AR5A 4J80A 3CCRV 3BABA 1HNXB 3Q4HB 1S72V 4JGSA 3OEEG 1XDCA 2XTAA 1JA8A 3OMIB 4NB5A 1U96A 1CPYA 3MHHC 5CBHA 3FD9A 4Z2WA 5LYJB 3ABKB 2XAQA 4JI5O 2QWQB 3SJCC 1V54B 1Q8IA 1PV0A 2C2AA 2AHYA 1N4CA 3K5OA 2W6JG 4X89A 4X20B 2A0LA 4DR3B 3EHBB 4PDRA 2Z5UA 2ZXWB 1YITV 3JATA 3HPLC 4IL6Z 4DV4O 3BRCA 3E83A 1QHTA 3IJ4A 1SRYA 3UQ8A 3CC2V 4I7ZB 4IYIA 2ZD9A 5IYDO 1VQKV 2P06A 4O2AA 3J7AU 5B1BC 3JATB 5D5QA 1MNGA 3H1IH 3JYCA 4YJ3A 2DMXA 3ASNC 1YSCA 3E8BA 1YTFD 4P9PA 5BR8O 3QG5A 4DR2B 2DW4A 4CBCA 1VMGA 4BIZA 4DV7B 2QWPB 1N36O 4YJ3B 2YXYA 4B3SB 3E8GA 5IYCO 4WBNB 1VF6A 4DV2O 5DN6G 3RYHA 1XUQA 2R72A 2HR3A 1PD3A 2EIMB 2QWOB 2ZNJA 2QKSA 3AG3B 4JAAA 3D3QA 1B6QA 3M99B 4FM2A 1R6KA
chains in the Genus database with same CATH topology
1AVMA 1AR4A 4JZGA 1LUVA 1MA1A 3C3TA 3QVNA 3OT7A 1IDSA 2CE4A 1EN6A 1AR5A 1I08A 5A9GA 3TJTA 1WB7A 1N0JA 1XDCA 1BSMA 1JA8A 1EN5A 1VEWA 1GN3A 1XREA 1AP5A 1SZXA 2CDYA 3LSUA 4F6EA 1JR9A 5AG2A 3AK1A 3AK2A 1IXBA 1ZSPA 4JZ2A 1B06A 4GUNA 3KKYA 4E4EA 1I0HA 3BFRA 2QKCA 4YIPA 1ZLZA 2ADQB 1MSDA 4BR6A 1IX9A 1D5NA 1EN4A 1BT8A 2ADPA 1QNMA 1MMMA 3K9SA 3C3SA 1PL4A 1EM1A 3MDSA 1P7GA 1MNGA 1GN6A 3AK3A 1XILA 1KKCA 1PM9A 2P4KA 2QKAA 1AP6A 1WB8A 1GN2A 1N0NA 4X9QA 3DC6A 2AW9A 3RN4A 2RCVA 4YIOA 1XUQA 1BS3A 1Y67A 3DC5A 3IC9A 1ZUQA 4FFKA 2GDSA 4C7UA 1VARA 3EVKA 3CEIA 3KDRA 1ZTEA 1GN4A 4JYYA 1LUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVM A;  1AR4 A;  4JZG A;  1LUV A;  1MA1 A;  3C3T A;  3QVN A;  3OT7 A;  1IDS A;  2CE4 A;  1EN6 A;  1AR5 A;  1I08 A;  5A9G A;  3TJT A;  1WB7 A;  1N0J A;  1XDC A;  1BSM A;  1JA8 A;  1EN5 A;  1VEW A;  1GN3 A;  1XRE A;  1AP5 A;  1SZX A;  2CDY A;  3LSU A;  4F6E A;  1JR9 A;  5AG2 A;  3AK1 A;  3AK2 A;  1IXB A;  1ZSP A;  4JZ2 A;  1B06 A;  4GUN A;  3KKY A;  4E4E A;  1I0H A;  3BFR A;  2QKC A;  4YIP A;  1ZLZ A;  2ADQ B;  1MSD A;  4BR6 A;  1IX9 A;  1D5N A;  1EN4 A;  1BT8 A;  2ADP A;  1QNM A;  1MMM A;  3K9S A;  3C3S A;  1PL4 A;  1EM1 A;  3MDS A;  1P7G A;  1MNG A;  1GN6 A;  3AK3 A;  1XIL A;  1KKC A;  1PM9 A;  2P4K A;  2QKA A;  1AP6 A;  1WB8 A;  1GN2 A;  1N0N A;  4X9Q A;  3DC6 A;  2AW9 A;  3RN4 A;  2RCV A;  4YIO A;  1XUQ A;  1BS3 A;  1Y67 A;  3DC5 A;  3IC9 A;  1ZUQ A;  4FFK A;  2GDS A;  4C7U A;  1VAR A;  3EVK A;  3CEI A;  1ZTE A;  1GN4 A;  4JYY A;  1LUW A; 
#chains in the Genus database with same CATH topology
 2QDO A;  4MTG A;  3FX7 A;  3RYH B;  4WFF A;  3WU2 Z;  3ZRX A;  3R65 A;  3SPH A;  2UXD B;  1TUB A;  4MTF A;  1YTF B;  1NVP D;  5KLV H;  4WFA V;  4HBN A;  4DV5 B;  2HP8 A;  1HWY A;  2EIL B;  1AJP A;  1AI7 A;  2QTO A;  2ZDI A;  3HKC A;  4UV8 A;  1YJW V;  2HKO A;  4LC1 A;  3CC4 V;  3STL C;  2CUG A;  2Q0O C;  4ICG A;  2WLJ A;  1LNQ A;  3K0G A;  1TUB B;  1QLE C;  1IUR A;  2BTQ A;  5EIB C;  4FLY A;  3C90 A;  4QE7 A;  3UT5 A;  4KHP O;  4X1K B;  4J9Z B;  4DV1 B;  3HKC B;  5KUM A;  1TUE B;  1I0H A;  1NU1 H;  5LMN O;  2BTQ B;  3ZN1 A;  3B77 A;  2UU9 B;  1XHZ A;  3AEI A;  1NVP B;  3UT5 B;  1IBK O;  1FFT B;  1IZ3 A;  2KG7 B;  3B40 A;  4U7O A;  2X6C A;  3OD4 A;  2ZCE A;  4RUF A;  2OTJ V;  1VQ8 V;  4LBE C;  5LGU A;  3ZHT A;  3IC7 A;  1RFY A;  4I0X A;  2QKA A;  1AP6 A;  2F1M A;  4Q20 A;  4UCS A;  5CA0 A;  3QNE A;  4DV3 O;  4B3R B;  2DYS C;  4MSW C;  1W0J G;  4I0X B;  4P2Z A;  4X62 B;  2P4V A;  3BAA A;  2RJZ A;  4K8X A;  2GDS A;  1M4U A;  1L0L H;  3CME V;  3D36 A;  1SQG A;  3K06 A;  5KUK A;  2JS5 A;  1NJI W;  3CXC U;  4G27 B;  2YI8 A;  1ZTE A;  1E1Q G;  5JH7 A;  1Q7Y W;  4JYB A;  4QJF B;  4I4T B;  2VQF O;  4DK0 A;  3LNN A;  4KUM A;  5E1A C;  3ABT A;  5DM6 V;  2HLD G;  4GX0 A;  4DRX A;  4HNA A;  5E79 Z;  1H2S B;  2E5L B;  3ABK C;  3B8M A;  4FFB B;  4MVM A;  4FJC C;  1AJN A;  2HJD A;  1XNR B;  1PL0 A;  2PYL A;  5GTI Z;  2YIA A;  4JYA O;  4HNA B;  4LF7 B;  5LMU B;  3OAA G;  4GKJ O;  3FB7 C;  2VQE O;  2E75 B;  5CBG A;  1YIJ V;  4GX1 A;  3P3P A;  1MOF A;  3BFR A;  1KP2 A;  1ARO P;  1CP9 A;  4R8C A;  2XAS A;  3MD0 A;  1VP7 A;  4LF4 O;  3CRQ A;  5L3E A;  2XHB A;  3FB6 C;  1Z2G A;  1H2M A;  1P7G A;  1XMQ O;  1K73 W;  2A06 H;  2WAM A;  2Q67 A;  3AG1 B;  4DUY B;  1Q6U A;  1WJZ A;  3T1Y B;  2YUA A;  2Q68 A;  4UFZ A;  1OV9 A;  4B7K A;  2EJR A;  2XOK G;  3L72 H;  3MAQ A;  2CH7 A;  1XQ8 A;  4JI1 O;  1TA8 A;  4UCV A;  4O4I A;  1KUQ A;  1VQN V;  1YI2 V;  3AG2 B;  4WFG A;  3AG3 C;  1O9H A;  4PD4 F;  2EIK C;  4J7Z A;  3EFF K;  5K1X A;  1M9N A;  4MW8 A;  3RGB A;  1VQM V;  3RYF A;  1NZ6 A;  1GM8 A;  4YY3 B;  2CGO A;  1JCH A;  2ZE6 A;  4O4I B;  2M7W A;  3P30 A;  1AR4 A;  4LNU A;  1IDS A;  4X66 O;  1EN6 A;  1OJH A;  2WLL A;  4DR7 O;  3FB8 C;  3M8A A;  1HNW B;  1S76 D;  1ZL8 A;  3SYA A;  2PGG A;  1HDJ A;  3RYF B;  3E2E A;  2WLI A;  4JI3 B;  2H8P C;  5KHI A;  2Y4U A;  3ASO B;  3RVZ A;  2BSK A;  3G6B A;  1S5H C;  1OCZ C;  1AP5 A;  1YEW A;  2Q9L A;  4LNU B;  4JI6 B;  3T2M A;  1QCE A;  1EZV H;  5EBM C;  1K34 A;  2MW2 B;  2UUB B;  1BL8 A;  2WLL B;  2ZDI C;  1CEZ A;  1ZL8 B;  1E1R G;  2WLI B;  3CSX A;  1S5L Z;  2BSK B;  1GAX A;  4H0L B;  1WAZ A;  3SPC A;  4HYO A;  2FML A;  5IY5 B;  3OEH G;  5LHH A;  4O4H A;  2RQ6 A;  3ETQ A;  2X6B A;  3ZHR A;  3VBB A;  4LP8 A;  2A9H A;  5LP6 C;  2LFR A;  4ZOL A;  2BCC H;  4DXW A;  4H37 A;  1EM1 A;  4GKK B;  1M5I A;  4DUZ O;  5KHK A;  4O4H B;  3H1H H;  4LWS A;  3RFR A;  5A2Q N;  4AQY B;  2RN9 A;  4HAM A;  1XOU A;  1NH2 B;  3OGI B;  3B09 A;  4ZOL B;  4GZR B;  2NNU A;  1OHH G;  1K33 A;  1W2B U;  1I94 O;  5FLX N;  1BHA A;  2AZ2 A;  4O4L A;  1SQV H;  4NKG B;  1HR0 O;  1H8E G;  4LWS B;  3ZMS A;  4WF9 V;  5HFL A;  1MG1 A;  5J9P C;  4BIO A;  2N74 A;  3L73 H;  1FXK A;  3IFX A;  1VAR A;  4OX9 B;  1NTK H;  1WP7 A;  4FZ1 A;  4O4L B;  3TK1 A;  3J81 N;  1GN4 A;  4JYY A;  2CTP A;  3D36 C;  5BY1 A;  5LOV A;  1YXB A;  4X64 B;  5C93 A;  1LUV A;  1XBL A;  1K3E A;  3DXR A;  1XMO B;  3K5M A;  1FXK B;  1VF5 B;  2QJ1 A;  1S0V A;  2ZM6 B;  3N2G A;  5FPO A;  1BCC H;  1THZ A;  1BSM A;  4PEL A;  1R3L C;  5LOV B;  4NXM O;  4GT1 A;  5CBF A;  2XAG A;  3JAM N;  3SYO A;  2ITC C;  1FFX B;  1NKD A;  3N2G B;  3OTO B;  1WPB A;  2UUC B;  3J80 N;  4K0K O;  4PDM A;  4JZ2 A;  5DEC A;  3OUF A;  4UVA A;  1QQC A;  1DF4 A;  2EIN B;  1AI6 A;  3ABL B;  4BW5 A;  3ZRW B;  3U11 A;  3K03 A;  1GKF A;  4EB6 A;  5IYB O;  4I5S A;  4JAV A;  3CMA V;  2IJH A;  1MSD A;  3FAV A;  3ABM B;  2LGW A;  4FLU A;  3ZRS A;  2ZKO A;  5JJE B;  3P3N A;  4GX5 A;  4ZI7 B;  1SZT A;  1QNM A;  1K92 A;  3L75 H;  3T4D A;  4GCZ A;  5C8Y A;  4EB6 B;  5LA6 B;  3FAV B;  3HKB A;  3CJH A;  3U10 A;  3OUS A;  3SGI A;  3L71 H;  2DYR B;  3HKE A;  3OW2 U;  4ABM A;  2P90 A;  3T1C A;  2HG5 C;  4OPH A;  2ZR2 A;  1IBL B;  3JAL B;  3HKB B;  4LFA O;  2FB5 A;  3CJH B;  3RN4 A;  4J9Y B;  4LF5 B;  3K5N A;  4B3T B;  1RPR A;  3HKE B;  2UXB B;  4D7T A;  2YSU B;  4LFC O;  3M7M X;  3OGC C;  2YEV A;  2HHH B;  2IM9 A;  3E89 A;  1AVM A;  1JX9 A;  5JQG A;  2CE4 A;  3CX5 F;  5A9G A;  4AI8 A;  3ZN0 A;  3ASO C;  3WG7 C;  2OCC C;  1T5E A;  3CCJ V;  2UXX A;  2YEV B;  2EZO A;  1JJ2 U;  1SZX A;  4R50 A;  5LGT A;  2A79 B;  2YID A;  5JQG B;  4LF8 O;  2YDE A;  3W7U A;  2JRI A;  1BGY H;  1IXB A;  3JAK A;  1VQ4 V;  5FNV A;  5LYJ A;  5IY5 C;  1YHQ V;  4MTO A;  2Y69 B;  1S3J A;  3OTF A;  4X20 A;  3H1J H;  1SC5 B;  3MHS C;  3JAK B;  2JVD A;  2W0F C;  5FL7 G;  5FNV B;  2HFE C;  1DLB A;  5LHI A;  3L70 H;  2JS3 A;  2B1G A;  2EBO A;  2HVK C;  4J11 A;  4DR1 O;  1F4M A;  1JMK C;  4H33 A;  3QF7 A;  4NR1 A;  1HNZ O;  1JQ0 A;  2XAF A;  5H9C A;  3OMN B;  3ZHU A;  1K5Q A;  2JEU A;  4EFB A;  1URF A;  3H1L H;  3JSL A;  4YHH B;  2WWW A;  1KBH A;  1ENV A;  3QO7 A;  3H01 A;  4K3A A;  4BWA A;  4NXN B;  1XL6 A;  4LR3 A;  4DW0 A;  3F5T A;  2AW9 A;  3DGE A;  1XNQ O;  2DOS A;  4JPR A;  4MVO A;  2GUZ A;  4DV6 O;  1N34 O;  4QIW F;  3I55 V;  2GTA A;  3E86 A;  3QTC A;  2N05 A;  5L3D A;  2IU3 A;  2WLM A;  4WBN A;  3SPJ A;  4DR4 O;  3LDC A;  1IJG A;  1LUW A;  2ZR3 A;  2GUZ B;  1H2K A;  4W4L A;  3RBZ A;  4PA6 A;  4R6Z A;  3I5D A;  3U0Z A;  3TJT A;  2IH3 C;  3ETG A;  3JD4 A;  2HEP A;  3HR0 A;  5H5N A;  2V1D A;  4XDJ A;  4D6T H;  1M56 C;  4RWU A;  1PNK A;  1TAE A;  3CYO A;  2Q7H A;  1EBO A;  4QPJ A;  4CH4 A;  3CCV V;  2CDY A;  3KG2 A;  4PV1 B;  4OPA A;  5TIS Z;  4JI7 O;  1JR9 A;  1GTO A;  1P7B A;  3ABL C;  4L8J A;  4DK1 A;  1M57 B;  2AHZ A;  2GTS A;  4JI5 B;  1FD9 A;  3E22 A;  4L87 A;  2GSM B;  3ABM C;  3CCU V;  4ZKI A;  1KB9 F;  3QO5 A;  1BQZ A;  3K59 A;  2F4V O;  4X1K A;  3K9A A;  3DSQ A;  4DR6 O;  5IE9 A;  4B3M O;  2WLN A;  1VQL V;  3E22 B;  3A0B Z;  4DV4 B;  4MT8 A;  1SKV A;  1GMG A;  3K57 A;  1VQ9 V;  3KCY A;  1LR1 A;  1PNM A;  4JI8 O;  2QR4 A;  2DN9 A;  1FJG O;  1SQF A;  2DYR C;  2UXC O;  3X2Q C;  5LL6 Y;  1J5E O;  4NTX A;  2Q5Z A;  2KG7 A;  1V55 B;  3DTU B;  1PP9 H;  2UUA O;  4QGP A;  2Q7G A;  4U3F H;  1HW7 A;  2M6Y A;  4BAY A;  1KKC A;  4J7K A;  1YCI A;  1WB8 A;  1QU7 A;  4UB6 Z;  4TV8 A;  3BEH A;  2JEX A;  2B9Z A;  5BR8 B;  1RM1 B;  1XL4 A;  1SF9 A;  5IT9 N;  4DYL A;  5L3F A;  2Q69 A;  3DC5 A;  1N36 B;  4TV8 B;  4DO2 A;  4LF6 O;  4DV2 B;  2RNB A;  1N32 O;  3EVK A;  2Y48 A;  2XUM A;  3CHX A;  4PI2 A;  1XHX A;  5CA1 A;  1KU9 A;  3K3W A;  2BOB C;  4UVB A;  1PPJ H;  3LUT B;  4B08 A;  3ETE A;  2RDC A;  1WN7 A;  4I4T A;  2R9A A;  4FM1 A;  5B3S B;  1VQO V;  5CA1 B;  3N2K B;  1O9G A;  4FFB A;  4TT3 G;  3S3X A;  3CCM V;  1DF5 A;  4FM0 A;  4PDV A;  4JI4 O;  2F4V B;  2PZS A;  2Y69 C;  4GLX A;  5B5E Z;  3SPG A;  1GH6 A;  3G71 V;  3CRR A;  1QLN A;  2AZ0 A;  3VQX A;  2NLJ C;  4E4E A;  1V54 C;  2B5U A;  4RQF A;  1FKA O;  1FJG B;  5B1N A;  1IXM A;  4KHP B;  5B1A B;  2JIZ G;  2ZNI A;  2LQT A;  1YF2 A;  1IBM O;  5LMN B;  1BT8 A;  2CTR A;  2ZXW C;  2FKX A;  4RQE A;  3C3S A;  1PL4 A;  1IBK B;  3MDS A;  4FPP A;  1JNB A;  3JAW B;  5BZB A;  4WFE A;  4JAS A;  4X1Y B;  1EZJ A;  4DV0 O;  3OFN G;  1Y76 A;  3ZMV A;  4IGG A;  1PKX A;  2LO1 A;  1K9M W;  3WB2 A;  3B2E E;  4GYC B;  2G38 A;  5CMU A;  5LHG A;  2N04 A;  5JCO A;  1F23 A;  3EXA A;  3BHP A;  1Y76 B;  1Y67 A;  3RYI A;  1M90 W;  1ZUQ A;  4DV3 B;  4W4K A;  3UCS C;  2KQX A;  3O65 A;  2Q73 A;  4U7N A;  4Q6G A;  4JV5 O;  5JJJ B;  4QPK A;  1MA1 A;  4E2L A;  4UUJ C;  3QVN A;  3RYI B;  5F2V O;  2PF4 E;  4JI4 B;  5KMG A;  2EIM C;  2VQF B;  3G6E V;  1GK9 A;  5EK0 A;  5BXZ A;  1GN3 A;  1VF6 C;  2JDI G;  1DTO A;  1P84 F;  3D8C A;  2KKW A;  4MVZ A;  5KA6 A;  1TVK A;  3RT3 C;  1OCO B;  1Z5V A;  5KMG B;  1W59 A;  1P49 A;  2PTM A;  1WA8 B;  1WPX A;  1V9P A;  1Y74 A;  2EIL C;  1YVW A;  3WFV A;  1UFI A;  4JYA B;  3KKY A;  5FPR A;  2PI5 A;  4TOI A;  4GKJ B;  1VIB A;  2VQE B;  1TVK B;  3CRM A;  2P67 A;  1SS3 A;  4LFB O;  2JK5 C;  3RWR D;  1ORQ C;  3SPI A;  1Y6X A;  1MAB G;  1Y74 B;  1XI1 A;  4DV0 B;  2O57 A;  2WA4 A;  1RSO A;  4EKW A;  2ADP A;  2EUL A;  3K9S A;  1FXV A;  1Q82 W;  4LF4 B;  2Z0A A;  1RSO B;  1JFF A;  3OMA B;  1DK1 A;  1XMQ B;  1PM9 A;  3HKD B;  3AG4 B;  4MW3 A;  1RM1 C;  1B3Q A;  3CC7 V;  3K04 A;  3L74 H;  1VQ5 V;  3SYQ A;  1H2G A;  4JTD B;  4JAU A;  3ZED A;  1J95 A;  1JFF B;  2E3C A;  1SQP H;  5L3B A;  1JJO A;  4JI1 B;  5IYZ A;  1K4D C;  2A3Q A;  2F43 G;  3CEI A;  3QO8 A;  3UO2 A;  1H5W A;  2ZT9 B;  3CCS V;  3E8F A;  2OIE A;  3OT7 A;  5B3S C;  1I08 A;  4N21 A;  2PYJ A;  1E79 G;  4OXS A;  1GM7 A;  5ITZ A;  5IYZ B;  1OCC B;  4LF9 O;  2YS8 A;  4X66 B;  4DR7 B;  1BZK A;  4UCO A;  4X65 O;  4H44 B;  2Q0A A;  1QBZ A;  2XND G;  1F4N A;  3SR2 C;  1R3J C;  5ITZ B;  2WLK A;  1SES A;  4IHJ A;  1ZSP A;  1W0K G;  1NTZ H;  5B1A C;  1F7Y A;  3ZHS A;  1K8A W;  1FFX A;  3LSS A;  4GUN A;  1JVM A;  3FB5 C;  2YXL A;  5H6R A;  1QR9 A;  4IHJ B;  1R1B A;  1IX9 A;  4U3J B;  3ZRW A;  3JSN A;  1EN4 A;  2QWR B;  1VQ6 V;  4RO2 A;  3ASN B;  1P4R A;  5GW7 A;  4J41 A;  3T1H O;  1N33 O;  2F93 B;  2F23 A;  4EEQ A;  2OWO A;  3W7W A;  2LFS A;  3S3W A;  2Y0I A;  4F6R A;  1FXH A;  4ZI7 A;  1KQS U;  3CWB H;  4WCE V;  4JI0 O;  5LA6 A;  2JGD A;  4DUZ B;  1WNS A;  3RW0 A;  5EIB D;  4X9Q A;  4O4J A;  4TUY A;  1GM9 A;  4F6R B;  3IGA C;  4IIJ B;  2KB1 A;  3AG1 C;  2Q6A A;  2HVJ C;  1QVF U;  1I94 B;  3T4Z A;  4DR5 O;  4PHZ A;  2JGD B;  1Q6H A;  3JAL A;  3ML0 A;  2CGN A;  4FFK A;  1AB3 A;  3ZMZ A;  2R9I A;  1HR0 B;  5IWA O;  4O4J B;  1RP3 B;  4TUY B;  1YJ9 V;  2ATK C;  1OCR B;  3WB0 A;  4YJ2 A;  2K9P A;  4KXR A;  3AG2 C;  4UCU A;  3C3T A;  3ZJZ A;  4WFH A;  1NS1 A;  3FKS G;  3LSQ A;  2DWE C;  1QLE B;  3BPZ A;  3JCU Z;  1Q86 W;  1KC8 W;  1U97 A;  3BA8 A;  1OCO C;  1VEW A;  4CC6 A;  3G80 A;  4YJ2 B;  4FVM A;  3ZS8 C;  2FL4 A;  1R3I C;  4J10 A;  1HP8 A;  1G4Y B;  4NXM B;  1G1X B;  4O2B A;  4DR3 O;  4K35 A;  2VWK A;  2YC0 A;  3CCE V;  3TXS A;  3I56 V;  1WP8 A;  2QEX V;  3LDE A;  4K0K B;  4UXN A;  1JOY A;  4O2B B;  3BCC H;  4ZIB A;  3A0R A;  3OE7 G;  4H13 B;  2OIG A;  5IJ0 A;  5H2F Z;  1FOU A;  3CD6 V;  2MK3 A;  3B4S A;  2QSA A;  5EZY B;  1GRJ A;  2EZP A;  4CS2 A;  2LW7 A;  2DYS B;  4DR2 O;  1XIL A;  4N23 A;  2E74 B;  2NR5 A;  4LH6 A;  5EYP A;  5JWP A;  1D2D A;  5IJ0 B;  4NTY A;  4DV7 O;  2ZE7 A;  2OTL V;  1R73 A;  2IJJ A;  4B3S O;  1ROP A;  1B04 A;  1YDX A;  3OR7 C;  4FLX A;  4MVQ A;  4TWK A;  5EYP B;  1BS3 A;  5KA5 A;  4EFE A;  4FLV A;  4LFA B;  4JI2 O;  3CRC A;  4CS3 A;  3PN1 A;  3G4S V;  4KFM A;  4C7U A;  3BY6 A;  2D3O W;  4G2K A;  4UB8 Z;  3VQV A;  1NI8 A;  4NYK A;  2DQ3 A;  2UXD O;  2YXH A;  2ZIO A;  4LFC B;  1OCC C;  1BE3 H;  2QTS A;  2YIC A;  1Q90 D;  2CTQ A;  4DV5 O;  2Q7E A;  4ZBM A;  5KHG A;  3R66 A;  4UCT A;  4CS4 A;  4LCU C;  3CXH F;  1CXZ B;  1YZB A;  2YIB D;  2PI4 A;  5K1P A;  1Z5W A;  3A0H Z;  1D5A A;  2EX3 A;  4MS2 A;  3LNM B;  1H8H G;  1I5Y A;  2AGA A;  3PJS K;  3GVM A;  2PY5 A;  1FXK C;  4B7E A;  4K8Z A;  4DV1 O;  4LF8 B;  4FK5 C;  2YIB A;  1G6U A;  2V7Q G;  3UM7 A;  2IJK A;  3F5W C;  2WPD G;  2UU9 O;  2QM4 A;  1NR7 A;  2QKC A;  4MVS A;  4O2A B;  4I50 A;  4CH3 A;  1D5N A;  2EJ7 A;  1SQQ H;  2LW1 A;  3ABU A;  3JCZ A;  2EIN C;  2JJ1 G;  2ZQM A;  2GV9 A;  1JPX A;  1UPG A;  2LGQ A;  2E76 B;  5J2T A;  4I50 B;  4DR1 B;  1ZAU A;  2IW5 A;  4D7S A;  1HNZ B;  2WA3 A;  4JI2 B;  4B3R O;  5GTH Z;  3CCQ V;  1GN2 A;  2EIK B;  3K08 A;  3GWO A;  4JF3 A;  4UVC A;  4X62 O;  5J2T B;  5B1O A;  3HB3 B;  3AG7 A;  3CPW U;  4YIO A;  1OCR C;  3IC9 A;  2B1I A;  1XNQ B;  2X7R B;  4DV6 B;  1N34 B;  4BW9 A;  1FYJ A;  3NR7 A;  1KD1 W;  2E5L O;  1OCZ B;  4PJ0 Z;  4DR4 B;  4X8A A;  1IVS A;  3SJQ C;  2UXN A;  2R70 A;  5IDJ A;  1Y66 A;  1XNR O;  1G8M A;  1VF7 A;  4XDK A;  2GBO A;  2EIJ B;  3GWK C;  4LF7 O;  3K0D A;  3JAS A;  1FPO A;  2P22 C;  5LMU O;  5LP6 A;  5LXT A;  2LJ2 A;  5EBL C;  3H1K H;  4F6E A;  4R7C A;  3AK2 A;  3N2K A;  3ZX6 A;  3APQ A;  2H94 A;  3L9D A;  1M93 A;  1KKD A;  4JI7 B;  2Z3Y A;  3JAS B;  4WFB V;  3KZI Z;  5LP6 B;  1WLE A;  1Q5O A;  5LXT B;  4A5U B;  1ZLZ A;  4RAI A;  1M1K W;  2W6I G;  3WB1 A;  3JD1 A;  4BR6 A;  5CA3 A;  1Q43 A;  1SQX H;  4FLZ A;  1MSW D;  2OYQ A;  3A8T A;  4I9Q A;  4CH6 A;  2CAZ C;  1MMM A;  2H3O A;  4DR6 B;  4DUY O;  4B3M B;  1X4T A;  4F4L A;  5EBW C;  3T1Y O;  4X1I A;  3H9V A;  3JD2 A;  2Q8V A;  3KCX A;  4JI8 B;  5GON A;  5CA0 B;  3G67 A;  2UXC B;  4MVU A;  5JVD A;  2P4K A;  1J5E B;  1H2L A;  3JAW A;  2UUA B;  4X1Y A;  2VRZ A;  4RUE A;  1NQT A;  4X1I B;  1BHB A;  1AI5 A;  1US6 A;  5GON B;  4TV9 A;  2RCV A;  2ITD C;  5JVD B;  4MVR A;  5JH7 B;  2A7W A;  4YY3 O;  2CK3 G;  1R3K C;  4ZHQ A;  4Z1M G;  4AHC A;  4J7J A;  4PA9 A;  4DRX B;  1HNW O;  4LF6 B;  4TV9 B;  1N32 B;  3K58 A;  1KEC A;  1A32 A;  4JI3 O;  1FAF A;  1NR1 A;  2R9R B;  4JI6 O;  1N0J A;  2X0L A;  4ZHQ B;  4Z1V A;  3BVO A;  2XAJ A;  2UUB O;  1FS0 G;  3TXQ A;  3K5L A;  3LSU A;  2Y4T A;  2DE0 X;  5AG2 A;  2BTO A;  3FYE B;  2QGN A;  1SA0 A;  2ODM A;  1XEQ A;  1B06 A;  1MZE A;  1WA8 A;  5KAF Z;  4KL1 A;  2JJ2 G;  4JYC A;  1YJN V;  1M57 C;  1PNL A;  3TGU H;  4G28 B;  1SA0 B;  3ZHV A;  2ZE8 A;  1EFR G;  1DGS A;  4GKK O;  4I9W A;  1GO3 F;  1K4C C;  1K97 A;  1L8D A;  1SQB H;  4FZ0 A;  1Q6I A;  4TQD A;  1QVG U;  5EC1 C;  1IBM B;  1GN6 A;  4AQY O;  1Y4M A;  3APO A;  4ASU G;  2CTW A;  4CZZ A;  1NT2 B;  3FFQ A;  3VQW A;  2CH7 B;  3ZHQ A;  4P30 A;  5L3C A;  5J2U A;  1N0N A;  1F51 A;  3GB7 C;  3W7X A;  3VQY A;  1K7D A;  5KHJ A;  3W7S A;  1TGO A;  2XT9 A;  3HKD A;  1V55 C;  4I55 A;  3P32 A;  4OX9 O;  4JTA B;  1COW G;  2KSD A;  3RYC A;  5B66 Z;  5J2U B;  3OR6 C;  3OM3 B;  3UKM A;  4X64 O;  1N8R W;  1L1F A;  3WG7 B;  2OCC B;  4XDL A;  1XMO O;  5H6Q A;  4I55 B;  5KAI Z;  2ZM6 O;  4JZG A;  1Q81 W;  2P5O A;  1AR1 B;  2K1E A;  4OGQ B;  2EIJ C;  2WSS G;  3RYC B;  3CRA A;  1NH2 D;  5LGN A;  4JV5 B;  3W7T A;  1WB7 A;  4X88 A;  3ETD A;  3NXS A;  2HJF C;  1EN5 A;  2DWD C;  4YXW G;  1XRE A;  3OTO O;  3O9O A;  2FYU H;  2NN4 A;  2X6A A;  3E35 A;  2VS0 A;  2UUC O;  5D5P A;  1SET A;  2P6J A;  2QWN B;  4BIU A;  1UJW B;  1VQ7 V;  2IH1 C;  3ICX A;  4JTC B;  4XBF A;  3K79 A;  3ZMU A;  4FLW A;  1ZX3 A;  3F7Y C;  4PA7 A;  3CB2 A;  2WLH A;  4QNH B;  2ARH A;  4DW1 A;  2F66 C;  1RPO A;  4YIP A;  2DJV A;  3ZIA G;  2ADQ B;  3VOU A;  1H2N A;  2LP7 A;  2YI9 A;  3N27 A;  3TET A;  3A2F A;  2GHY A;  3E8H A;  2IU0 A;  4LFB B;  2L35 A;  4NTW A;  4U3J A;  4UCR A;  1K5S A;  5BMV A;  2ILM A;  2DQ0 A;  3AK3 A;  1VQP V;  4FMT A;  1SER A;  5CB4 A;  5B1B B;  1IBL O;  2IBZ H;  5HFM A;  3FYI B;  2ZIM A;  3CS5 A;  1MZF A;  4CH5 A;  4LF5 O;  2Y0P A;  5BMV B;  4AIL C;  4B3T O;  2UXB O;  5CB4 B;  1QR8 A;  3SJB C;  1L0N H;  4IIJ A;  3STZ C;  2HHH O;  1BMF G;  2F95 B;  2OT5 A;  2QM8 A;  1I5X A;  5EC2 C;  4UV9 A;  1M56 B;  3DXR B;  2RMK B;  2OCH A;  1NTM H;  1KMI Z;  4KP4 A;  4P9O A;  4J42 A;  3ZCC A;  1S5J A;  2AXT Z;  3THO A;  3ZBH A;  3CP1 A;  2IJI A;  4PDL A;  5JCO C;  5LBQ A;  4FLT A;  2ETN A;  3IAY A;  4IYH A;  5JJN B;  4LF9 B;  5DED A;  2VWJ A;  2P7T C;  1HNX O;  2PUS A;  3AK1 A;  4X65 B;  1NBM G;  5L3G A;  1AI4 A;  3F7V C;  3SDL A;  3UO3 A;  1X59 A;  2L6L A;  3B8N A;  4IT5 A;  2QM7 A;  4TSF G;  2Q4P A;  4PI0 A;  1KP3 A;  1BQ0 A;  3X2Q B;  2W0X A;  4FIP C;  2ZIN A;  5C8Y B;  3CE2 A;  4TQF A;  1H38 A;  1I7F A;  2D2C B;  3CCL V;  4LH7 A;  3SJA C;  3D3I A;  2QE7 G;  3RVY A;  2QA4 V;  2BOC C;  3JAR A;  3T1H B;  1N33 B;  2BE3 A;  3JD3 A;  4YHH O;  3ZRV A;  4MTX A;  1KYO F;  5KHH A;  3BA9 A;  5EZY A;  4NXN O;  1AIL A;  1AJQ A;  5IJ9 A;  5CN0 A;  4CC5 A;  3SYP A;  4JI0 B;  4HZ3 A;  4PA3 A;  3JAR B;  1Q3E A;  3DC6 A;  1S77 D;  1R6N A;  3TCU A;  1OZ0 A;  3JD0 A;  4GX2 A;  5KX5 A;  3AG4 C;  2ZE5 A;  2FTK A;  5IJ9 B;  3Q4H A;  1ZWI C;  4PA4 A;  3ZMT A;  1R6T A;  3LDD A;  3SYC A;  4DR5 B;  3KDR A;  2XAH A;  5IWA B;  2JGU A;  2V4D A;  4QE9 A;  5KX5 B;  4NVP A;  1AR5 A;  4J80 A;  3CCR V;  3BAB A;  1HNX B;  3Q4H B;  1S72 V;  4JGS A;  3OEE G;  1XDC A;  2XTA A;  1JA8 A;  3OMI B;  4NB5 A;  1U96 A;  1CPY A;  3MHH C;  5CBH A;  3FD9 A;  4Z2W A;  5LYJ B;  3ABK B;  2XAQ A;  4JI5 O;  2QWQ B;  3SJC C;  1V54 B;  1Q8I A;  1PV0 A;  2C2A A;  2AHY A;  1N4C A;  3K5O A;  2W6J G;  4X89 A;  4X20 B;  2A0L A;  4DR3 B;  3EHB B;  4PDR A;  2Z5U A;  2ZXW B;  1YIT V;  3JAT A;  3HPL C;  4IL6 Z;  4DV4 O;  3BRC A;  3E83 A;  1QHT A;  3IJ4 A;  1SRY A;  3UQ8 A;  3CC2 V;  4I7Z B;  4IYI A;  2ZD9 A;  5IYD O;  1VQK V;  2P06 A;  4O2A A;  3J7A U;  5B1B C;  3JAT B;  5D5Q A;  1MNG A;  3H1I H;  3JYC A;  4YJ3 A;  2DMX A;  3ASN C;  1YSC A;  3E8B A;  1YTF D;  4P9P A;  5BR8 O;  3QG5 A;  4DR2 B;  2DW4 A;  4CBC A;  1VMG A;  4BIZ A;  4DV7 B;  2QWP B;  1N36 O;  4YJ3 B;  2YXY A;  4B3S B;  3E8G A;  5IYC O;  4WBN B;  1VF6 A;  4DV2 O;  5DN6 G;  3RYH A;  1XUQ A;  2R72 A;  2HR3 A;  1PD3 A;  2EIM B;  2QWO B;  2ZNJ A;  2QKS A;  3AG3 B;  4JAA A;  3D3Q A;  1B6Q A;  3M99 B;  4FM2 A;  1R6K A; 
#chains in the Genus database with same CATH homology
 1AVM A;  1AR4 A;  4JZG A;  1LUV A;  1MA1 A;  3C3T A;  3QVN A;  3OT7 A;  1IDS A;  2CE4 A;  1EN6 A;  1AR5 A;  1I08 A;  5A9G A;  3TJT A;  1WB7 A;  1N0J A;  1XDC A;  1BSM A;  1JA8 A;  1EN5 A;  1VEW A;  1GN3 A;  1XRE A;  1AP5 A;  1SZX A;  2CDY A;  3LSU A;  4F6E A;  1JR9 A;  5AG2 A;  3AK1 A;  3AK2 A;  1IXB A;  1ZSP A;  4JZ2 A;  1B06 A;  4GUN A;  3KKY A;  4E4E A;  1I0H A;  3BFR A;  2QKC A;  4YIP A;  1ZLZ A;  2ADQ B;  1MSD A;  4BR6 A;  1IX9 A;  1D5N A;  1EN4 A;  1BT8 A;  2ADP A;  1QNM A;  1MMM A;  3K9S A;  3C3S A;  1PL4 A;  1EM1 A;  3MDS A;  1P7G A;  1MNG A;  1GN6 A;  3AK3 A;  1XIL A;  1KKC A;  1PM9 A;  2P4K A;  2QKA A;  1AP6 A;  1WB8 A;  1GN2 A;  1N0N A;  4X9Q A;  3DC6 A;  2AW9 A;  3RN4 A;  2RCV A;  4YIO A;  1XUQ A;  1BS3 A;  1Y67 A;  3DC5 A;  3IC9 A;  1ZUQ A;  4FFK A;  2GDS A;  4C7U A;  1VAR A;  3EVK A;  3CEI A;  3KDR A;  1ZTE A;  1GN4 A;  4JYY A;  1LUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...