1N0JA

The structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title The Structure of Human Mitochondrial Mn3+ Superoxide Dismutase Reveals a Novel Tetrameric Interface of Two 4-Helix Bundles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1n0jA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1n0jA02
1QNMA 4C7UA 1BT8A 3K9SA 5A9GA 1MSDA 1ZLZA 1XREA 1AP5A 4JZGA 1AR5A 3OT7A 3CEIA 2CDYA 1P7GA 1Y67A 3DC6A 1XDCA 4FFKA 1JA8A 1B06A 3TJTA 1MA1A 1EN4A 1KKCA 4F6EA 2AW9A 1VEWA 4BR6A 1ZSPA 1BSMA 3MDSA 2ADPA 3LSUA 1WB7A 3KKYA 3AK3A 4JZ2A 1I08A 3DC5A 1EN5A 3C3TA 1AR4A 1I0HA 4JYYA 1GN3A 1JR9A 3AK2A 1PL4A 1SZXA 4YIOA 1AP6A 1WB8A 1EM1A 1N0JA 1XUQA 1IX9A 4GUNA 2CE4A 1AVMA 3RN4A 3AK1A 1VARA 3IC9A 2ADQB 1GN6A 1LUVA 1D5NA 1GN4A 2P4KA 1ZUQA 1EN6A 2QKCA 3QVNA 2GDSA 1IDSA 1MNGA 2QKAA 1N0NA 1LUWA 4YIPA 1ZTEA 1MMMA 2RCVA 1IXBA 1PM9A 4X9QA 1GN2A 4E4EA 1XILA 3BFRA 5AG2A 1BS3A 3EVKA 3C3SA
chains in the Genus database with same CATH superfamily
2EILC 3D3QA 4UVBA 4DUYO 1RPRA 4TUYA 1URFA 2BSKA 2ZE8A 4B3SB 4IYHA 1N36O 3NR7A 3CRAA 1WAZA 5JH7A 1ZX3A 4DV6O 1B06A 1NH2B 4J41A 3AG2C 5B1AB 1GK9A 2LW7A 4LFBB 3W7TA 2ZR2A 3CCMV 4LF7B 3FB8C 2VWKA 3W7WA 4J7KA 5KAIZ 1ZAUA 4O2BB 1MZEA 1SA0B 1EN5A 4ZHQB 4FJCC 3C3TA 4DV4B 5E79Z 1F23A 2Q67A 5IWAO 4LF8B 1Z5VA 3B4SA 1TUBB 1K3EA 2AHZA 3CJHA 5HFLA 2F4VB 3SYPA 2JS3A 5EYPB 4PDLA 1U97A 4LFAO 4B3RB 1TA8A 1TAEA 3LNMB 4ABMA 4PA9A 2PI4A 2YEVB 4MS2A 4J9YB 4HNAA 4J7JA 3UKMA 4EB6B 5CA1B 1PP9H 1V55C 4X65O 1Y4MA 4IIJB 4PJ0Z 5BR8B 5LP6C 5BXZA 1YDXA 3X2QB 5L3FA 3FD9A 2JEXA 4QPJA 1GO3F 5KMGA 3TXQA 5AG2A 4J7ZA 2HEPA 5H9CA 1YHQV 1MOFA 3SYQA 5L3BA 3O65A 4GX0A 4B08A 3ABLC 4W4KA 1J95A 3JALA 4UV8A 3LNNA 2QWQB 3ZMTA 1E79G 1E1RG 3HB3B 3OMIB 2FL4A 1GRJA 4DK0A 4TSFG 1FKAO 4RWUA 3LDCA 3B77A 4WFGA 1YTFD 2AW9A 2KG7B 4U3JB 4K0KO 4H0LB 3P30A 4DO2A 2WLMA 5IYBO 4I55A 3RYFB 1WB7A 4FPPA 2EJ7A 4HAMA 4X88A 2IW5A 5IY5B 4JI5O 4DV7O 2DWDC 2G38A 4MVMA 2YC0A 2UUAO 2QR4A 3JCZA 2Q69A 4X1IA 3A0RA 5EZYA 3AK2A 3EHBB 2PF4E 1HNWB 1JFFB 2LGWA 4KL1A 4FLZA 3AG7A 3R66A 3BY6A 4DW0A 1FOUA 2FKXA 2AZ2A 2UXBO 1PV0A 4DR4B 1HW7A 5GONA 1Q82W 4DV2B 2IM9A 4JGSA 4FM0A 4DUZB 4G27B 4DR7O 2P4KA 4E2LA 3J7AU 2QKCA 2YI9A 5EK0A 5IE9A 2RNBA 1Y76A 4J9ZB 4GCZA 2QTOA 5JQGB 2JRIA 3T1YO 4X1YA 3E8HA 4DR5B 1XILA 2P6JA 4X62O 3B2EE 3QTCA 4UVAA 1QLEB 4F6RA 1FJGB 1U96A 4DYLA 3LSQA 4NR1A 1SQXH 4LNUA 5FLXN 1PL0A 1NBMG 1I5YA 3W7XA 1VQ8V 1JCHA 4FLXA 4UB8Z 1XQ8A 1I94O 2JJ2G 4GX2A 4RQFA 2CDYA 1YITV 2P5OA 4WCEV 4PDMA 2E5LO 3E35A 3JARB 3RYIA 5F2VO 2QWRB 1YI2V 2OIEA 1IJGA 1G1XB 2AHYA 3OMNB 4DUYB 4MT8A 4BR6A 2DOSA 1Y6XA 5IJ9B 3OD4A 1VMGA 1R3IC 3FAVA 2F95B 1N36B 2VQEO 2AZ0A 4DV6B 2Y69C 1AI6A 5C93A 2GTAA 4HBNA 1YVWA 4WFFA 3IAYA 1HR0O 1Q8IA 4FZ1A 4QGPA 4YJ3A 2Q9LA 3K0DA 3RYCA 4BIZA 1FXKB 1XUQA 3QG5A 4ZBMA 1HNZO 2GBOA 5IWAB 3I5DA 4N21A 3U0ZA 1XMOB 2QTSA 4JYBA 4NXNO 1YJ9V 4JI6B 1GN6A 3CP1A 2R9RB 4TWKA 3WFVA 3HKBA 2GDSA 3PJSK 4LFAB 2WLKA 3BAAA 4DR3O 4J11A 1S5JA 3WB0A 5KHHA 2PI5A 2EZOA 4CBCA 3K79A 1M1KW 4FLVA 1ZLZA 1HWYA 4NXMO 4I50B 4X65B 3WG7B 4DRXA 2LO1A 4IL6Z 4AHCA 2N74A 1JJOA 4UFZA 4G28B 2CGOA 2YI8A 2IU0A 2PYLA 4MVSA 3CC4V 4L8JA 1HNXO 4JTAB 2ODMA 3DC6A 3OGIB 2WLIA 5H5NA 2EINB 4I4TA 3TJTA 4CS2A 2F43G 2HKOA 1NT2B 1S0VA 2R70A 1S72V 3OGCC 4K35A 1YTFB 2ETNA 3BA8A 3VQWA 2ADPA 1KQSU 3OTOO 4TUYB 2UXCO 2BSKB 2LFRA 4JTDB 4JZ2A 1W0JG 3B40A 1EZJA 1RFYA 2Q0AA 2EJRA 1AI5A 5JH7B 4Z1VA 1Q7YW 3HKEA 4X1KA 4DV4O 2JJ1G 4K0KB 1H2LA 2RQ6A 3E83A 2B1GA 4IYIA 2PY5A 1IXMA 3P3NA 2DJVA 1PL4A 2HFEC 3FYIB 1UJWB 4CS4A 3OEEG 1RSOA 4JI5B 4DV7B 3QO8A 4PA4A 2QGNA 3TGUH 3N2KA 1R73A 1Q3EA 2PZSA 1AJNA 4OXSA 4CS3A 4FM2A 5B5EZ 3I56V 3CJHB 1X4TA 5J9PC 5J2UA 3STLC 2ATKC 2EIMB 1VQPV 1F4MA 1P7BA 1XEQA 2YXHA 1BMFG 2UXBB 3ZS8C 1JX9A 2DYRC 2YDEA 3ZRWB 4B7EA 4E4EA 3BFRA 4WFHA 3D3IA 4ICGA 4Q20A 5JJNB 4HNAB 4LWSA 1W2BU 1Z5WA 4B3TO 3D8CA 3T4ZA 5C8YB 3K58A 1OV9A 2IBZH 3ZX6A 3AG1B 5CBGA 4JZGA 1YIJV 5DM6V 1I7FA 3SJBC 5CB4A 4X62B 5LYJA 2X0LA 3QF7A 4UCRA 1NJIW 5FNVA 1K5QA 3WB2A 1K9MW 4LCUC 5H6RA 3CE2A 4LFCB 3G6EV 1KYOF 1I94B 1BHBA 2EIJB 4I0XA 5BMVA 3CB2A 2E5LB 3N2GB 2JDIG 4JI3B 1VQ4V 3L75H 1PNKA 1QU7A 3JYCA 1BL8A 2YSUB 3A8TA 3HKCA 1M4UA 2EIKB 1MABG 1K92A 3ZBHA 3L70H 2VQEB 1NTKH 1KKDA 1VF5B 1XBLA 5CA0B 2KQXA 4JYCA 2HG5C 3H1HH 3RN4A 1VQ6V 3JAKB 5DN6G 1NZ6A 2XAJA 3HKDB 4PA6A 1M57C 3IC9A 2OCCC 4X1IB 4DUZO 1HR0B 4FIPC 1ZUQA 5EZYB 2FYUH 2XOKG 5BY1A 4JI4O 3BABA 4YIPA 3WU2Z 1CPYA 1QVGU 1HNZB 1ORQC 1WA8B 5GONB 1JNBA 3K03A 1BE3H 3W7UA 4MW8A 4D7SA 4NXNB 5KA6A 4FM1A 5KX5B 3JSNA 3VOUA 5B3SC 3EFFK 1BT8A 4QE9A 5A9GA 1XREA 1Y76B 3OFNG 5FL7G 2B1IA 5LA6A 5L3EA 4GLXA 4DR3B 2MK3A 4RAIA 2ZXWB 3ZHSA 2DWEC 2GTSA 3JASA 3FX7A 4FFKA 4HYOA 2QM7A 4LBEC 4O2AA 4Z1MG 2UU9B 5EBWC 4NXMB 2VRZA 2WAMA 4DV0O 1NTZH 1Q6UA 1YJWV 3K3WA 2PGGA 1GMGA 3SPIA 4O4IA 3SYOA 4FVMA 1HNXB 1L1FA 2CTQA 5LHGA 2W0XA 3JD0A 3BA9A 3ZMUA 3VBBA 2DYSB 1RM1C 3BPZA 1R6NA 1AI7A 4UVCA 4LC1A 3OTOB 2UXCB 5LHIA 3FAVB 1Q90D 4YIOA 2QWNB 3RVYA 2X6BA 4FFBB 1VF7A 5LXTA 4UB6Z 3OM3B 1OCCC 3ABMB 3SYAA 1XMOO 1PPJH 1VARA 4IT5A 1K73W 1D5NA 4JI6O 3G80A 3JATA 3ZN1A 3OEHG 1KMIZ 4P30A 3ZRSA 1RPOA 3G67A 2Q7GA 1M5IA 4X66O 3QO5A 3K06A 2X6AA 3GB7C 2WLLA 3FFQA 2NNUA 5KHGA 1VQ7V 4LF5O 1BGYH 4QJFB 3JAWB 3S3XA 1SF9A 1FAFA 4JF3A 1P7GA 2LGQA 3LUTB 3H1LH 2WA3A 3RYHA 2C2AA 1MA1A 5JVDA 1EN4A 2VWJA 1L0LH 3ML0A 4OX9O 4B3TB 3L71H 1Q86W 3S3WA 3ASNB 1AROP 1M56B 1NKDA 4RUEA 4KXRA 1FFXB 3CXCU 5IJ0A 4GKJO 5EBLC 3KKYA 2CH7A 1SQGA 1XNQO 4PV1B 1H8HG 1K8AW 1BQZA 5IYZA 2CTRA 3JAMN 4I4TB 4ZOLA 4OPAA 3CRQA 4CC5A 2R9AA 2UXNA 3SJAC 3E22B 5B1AC 4TV8A 4GX5A 3RWRD 3H1JH 3UT5B 4X89A 3OUSA 3C90A 3CMAV 3F7VC 3AG3B 2Q5ZA 4B7KA 2O57A 1HP8A 4X1KB 2UXDO 4RUFA 4NKGB 1G6UA 1GN4A 4OPHA 2ILMA 3CS5A 2Q73A 4H33A 4XDKA 4I5SA 2EZPA 3TETA 1N0NA 1YCIA 1IXBA 1V54B 2WLJA 3FB7C 2FMLA 2ZNIA 1RSOB 1OCOB 2OYQA 2BTOA 3N2KB 2P67A 1IVSA 4FLUA 1MZFA 2CK3G 4BIOA 1QNMA 1S5HC 2P22C 5J2UB 4JI4B 3KDRA 3G71V 2GHYA 3PN1A 1XL4A 2ITCC 1AP5A 3X2QC 3ZEDA 1AR5A 3OT7A 4IHJA 4JAAA 2EX3A 2QM4A 1PNMA 2JGDA 1QLNA 4MVUA 4LF9B 1QHTA 4O4JB 1N32O 2GV9A 3CHXA 4LWSB 5LP6A 3ABUA 5CMUA 1BZKA 1BSMA 3LDDA 1AI4A 3OMAB 4LFCO 3ASOB 4YHHO 3DC5A 2A3QA 1R6KA 3A0BZ 5CB4B 2PYJA 4I9WA 4JYAO 3E8BA 5LYJB 4IGGA 4YJ2A 4DV0B 4JI3O 1KP2A 1YXBA 1ROPA 5FNVB 1GN3A 2WLHA 3ETEA 4EKWA 2BOBC 2L35A 3OAAG 5CN0A 2IH3C 5LGNA 3L74H 3T4DA 2QDOA 4GKKO 4KHPO 4J80A 4F4LA 1EM1A 4XDLA 1IX9A 3W7SA 5DEDA 5IY5C 4U7NA 1D5AA 2A0LA 1Q6IA 5KHJA 2W0FC 2YUAA 1PNLA 2PTMA 2RMKB 2ZINA 2DW4A 3G6BA 4A5UB 4DR6O 2P7TC 1LUVA 3HKCB 1WNSA 1SKVA 5B1BB 1EN6A 4L87A 1KBHA 3KG2A 1WPBA 1IDSA 1MNGA 2QKAA 2QWOB 1VF6C 3QO7A 5LMNO 4O2BA 4NTXA 4DXWA 2GSMB 1SETA 1A32A 1R3LC 4W4LA 2VS0A 3P32A 2Q0OC 3M99B 1EZVH 2ZKOA 4CH4A 2ZD9A 1OCZB 4PA7A 5EIBC 3CPWU 3IGAC 1SQFA 3BVOA 1KB9F 4CH3A 2YIBA 1K4DC 2HR3A 1B6QA 4X66B 2JK5C 1ZL8A 3UO3A 1NR7A 1IBLO 5IYCO 2UU9O 1KKCA 1S76D 3ZN0A 2QE7G 4LF5B 1M93A 1QLEC 4B3MO 2Q6AA 2QEXV 1N33O 2D2CB 3L9DA 1BCCH 5GW7A 2XNDG 4X64O 4R7CA 2W6IG 3ZIAG 5IDJA 4JI2O 4DV1B 2LQTA 3I55V 1OZ0A 1YJNV 4PI2A 3JASB 3K59A 5D5QA 2JS5A 1WPXA 2GUZB 4O2AB 4OX9B 4PDRA 4D7TA 3A2FA 1I0HA 2Q7EA 4J10A 2E74B 1AJPA 3ICXA 4GKJB 2IH1C 3DGEA 4O4IB 1XNQB 1FPOA 1SQBH 5GTIZ 2NN4A 4NB5A 2WPDG 1AB3A 3J81N 2QA4V 1DK1A 4PELA 1R6TA 4JV5O 2KSDA 2R9IA 2RJZA 2QJ1A 1VQLV 3NXSA 2LP7A 4TT3G 3OR7C 3B8NA 3QVNA 3BHPA 3RYFA 1LUWA 1TUEB 1MMMA 2RCVA 2X7RB 1FXKC 3HPLC 3AEIA 2N05A 3APQA 2UXDB 3C3SA 1N34O 1CP9A 4D6TH 2IJHA 3JATB 1H2GA 5DECA 2ZR3A 1VIBA 1GM9A 1FD9A 2WWWA 3TCUA 2DE0X 1NVPD 2P4VA 4U3FH 3BRCA 3JD3A 3DSQA 4CH5A 1EBOA 1JA8A 4JI8B 3CCVV 1YEWA 5CBFA 1M57B 4NTYA 2WLLB 3L72H 1Q5OA 1TVKA 4MTXA 3ABKB 4BW5A 1MG1A 4CC6A 2Z5UA 4UCTA 4JI7O 4I9QA 1VQNV 3WG7C 3OUFA 2OWOA 3UQ8A 1IBMO 1Q81W 2DN9A 2YIBD 4JTCB 5KMGB 1K4CC 2ZNJA 3AG4B 2EINC 3RT3C 3DXRA 1MSWD 2H3OA 1N32B 3ZHUA 5JVDB 1GH6A 3SYCA 1OCRC 1PKXA 4GZRB 5IYDO 2XTAA 5HFMA 4KFMA 2IU3A 2E3CA 4YHHB 1GM8A 1KC8W 1WB8A 4YXWG 3MHSC 1N0JA 2CH7B 3JALB 2ZE7A 2CE4A 1S3JA 4JYAB 5JCOC 5IYZB 4ZOLB 2AGAA 1SRYA 2K1EA 2EILB 4X8AA 4AQYO 4YY3O 3K5LA 4TV8B 4GKKB 4KHPB 1UPGA 3CCRV 4I55B 3SJQC 4J42A 1GM7A 5B1NA 3ABTA 1BS3A 3K04A 2Z0AA 3AG2B 2K9PA 3BCCH 5KHKA 4DR6B 5B66Z 4CH6A 1SC5B 1WLEA 2AXTZ 3CSXA 3ZMVA 4UUJC 2EIMC 4K8XA 5LMNB 2JEUA 1FXKA 1JQ0A 4PA3A 5BZBA 2Y4TA 4FLYA 4K8ZA 1V9PA 3IFXA 2V4DA 1D2DA 3CCLV 2BE3A 3OW2U 1L8DA 4LF9O 1P84F 1KECA 2XHBA 2EBOA 2Q68A 3K57A 5J2TA 1ZSPA 2XUMA 2Q7HA 3IC7A 1NQTA 3AG1C 4XBFA 1JMKC 1NTMH 4X1YB 1Y74A 2WSSG 4XDJA 2A7WA 5ITZA 1IBLB 4R8CA 2JGDB 3K5NA 2ARHA 4I50A 4B3MB 4EFEA 1N33B 3RBZA 1SESA 1V55B 4F6RB 1JR9A 1R1BA 3K0GA 4X64B 5LP6B 1QVFU 4JI2B 3LDEA 4LNUB 5LGUA 3FB5C 4JI0O 5LBQA 2EIJC 3M8AA 3T1HO 2ZE6A 4I7ZB 5K1PA 5L3DA 4DV5O 3ETGA 2P06A 4X20A 3AK1A 2JVDA 2ADQB 1WJZA 3RYIB 4JI1O 2EIKC 4MTOA 1XI1A 1XL6A 3ABLB 4U7OA 4NTWA 3ZMZA 1SQPH 4KP4A 4FLWA 5JCOA 1H38A 4ASUG 5EC2C 5CBHA 1QQCA 2CUGA 1KP3A 2HJDA 4JV5B 1COWG 1W0KG 2X6CA 2JIZG 4BWAA 4HZ3A 4LH6A 1AR1B 3H9VA 2QKSA 1H8EG 1VQOV 4YJ3B 4PI0A 3RYCB 2ZM6O 1NVPB 3Q4HA 1G4YB 4ZI7A 3E89A 4DR2O 3ZRXA 3BEHA 2XAFA 1N34B 4P9OA 2A79B 1YZBA 3IJ4A 5LL6Y 1Z2GA 3OE7G 4JASA 4LF6O 2IJIA 1E1QG 4QPKA 4AILC 1VP7A 3HKBB 5LMUO 1O9HA 1VQMV 3SPCA 3ZRWA 3UCSC 3ZHQA 3ZMSA 1I08A 2ZXWC 4DV1O 2HVKC 1ZL8B 2ZIMA 4WBNA 3FB6C 1FXVA 1DLBA 4MVQA 2WA4A 5JJEB 2B5UA 4JI7B 5C8YA 4JAVA 1JJ2U 3CCQV 2HLDG 4DRXB 4MVRA 3RVZA 5H2FZ 1IBMB 1R3JC 2BCCH 1N8RW 4G2KA 1K34A 3CXHF 2WLIB 2Z3YA 1F51A 2Y48A 5JWPA 2M7WA 3SGIA 1H2SB 1P49A 1XHXA 2XAQA 2DYSC 1SERA 2LFSA 2XASA 3M7MX 4TV9A 4FMTA 4MVOA 2V7QG 3CC2V 3ZHRA 1YF2A 5K1XA 1QR9A 1PM9A 1US6A 3MD0A 4UXNA 4ZKIA 4DR1O 3N2GA 3OR6C 3MAQA 1QR8A 3K5MA 2BTQA 3CYOA 3GWOA 2OT5A 3JSLA 3ABMC 3HKEB 4AQYB 3ZHTA 4YY3B 1WN7A 4H37A 2Y0PA 3ETDA 4WFBV 5D5PA 1KD1W 3CC7V 4UCUA 1MSDA 3KCXA 1DTOA 2QM8A 3P3PA 5CA0A 1IBKO 1TGOA 2Y69B 4H44B 4O4HA 1XOUA 1XDCA 4TQFA 3JAKA 4CZZA 1VQKV 1H2MA 3HKDA 3TK1A 4MTGA 2HVJC 4JI8O 5KA5A 4Q6GA 4F6EA 2ZDIC 3RW0A 1XNRO 1ZWIC 5LGTA 3MHHC 2N04A 1SS3A 4LP8A 3TXSA 4GYCB 4PHZA 4LH7A 3N27A 1XMQB 1J5EO 3RGBA 1WA8A 5LOVA 4LR3A 4O4LA 3JD2A 1BQ0A 1TVKB 5KX5A 3R65A 3K08A 3CCUV 2RDCA 1H2NA 4WFAV 2HHHO 3E86A 3K9AA 4UCSA 3ASNC 1M56C 2YIDA 3CCSV 2OCHA 4LF4O 2FTKA 2Y0IA 4DV3O 3L73H 3OTFA 2NR5A 5KUMA 1GKFA 1S77D 2YIAA 1X59A 1HDJA 3DXRB 3ZJZA 1B3QA 1SQQH 1FFTB 1FS0G 5L3CA 1CEZA 1THZA 1M90W 1DGSA 4MVZA 4JI0B 2A9HA 3SPJA 4FK5C 3SJCC 3T1HB 2JGUA 4I0XB 4MTFA 5BMVB 1M9NA 1GN2A 4DV5B 2OIGA 3SR2C 5CA3A 2VQFB 3AG3C 1NR1A 2F1MA 2L6LA 2BOCC 4JI1B 4UV9A 3E2EA 3UM7A 2ZT9B 3E8FA 1DF4A 2H94A 2OTJV 4FFBA 1V54C 3CX5F 2UUCO 5A2QN 1OJHA 1SA0A 3WB1A 5LHHA 5FPRA 4ZHQA 1OCOC 1H2KA 5TISZ 1TUBA 3K5OA 3D36C 1B04A 5EYPA 1JPXA 3VQXA 1W59A 5H6QA 4R6ZA 3CWBH 4MW3A 4PDVA 2ZM6B 5IT9N 1F7YA 3B8MA 3SDLA 2D3OW 2P90A 4AI8A 4DR2B 1I5XA 2F23A 3G4SV 2B9ZA 4TOIA 2ZDIA 2YEVA 2ITDC 5FPOA 1F4NA 4JYYA 3CRCA 3U10A 2M6YA 2Q4PA 4EB6A 1VQ5V 4LF6B 5CA1A 1XHZA 4IIJA 5J2TB 3JAWA 2CTWA 1AILA 5LMUB 2UUBO 3CD6V 4NYKA 2RN9A 3SPGA 2DYRB 2FB5A 5LA6B 3ASOC 4BIUA 3THOA 1G8MA 1Y74B 3GVMA 5ITZB 1IURA 2MW2B 2IJKA 4QNHB 3T1CA 1K97A 4P9PA 1FFXA 2EULA 1L0NH 2PUSA 2F66C 4B3SO 3B09A 3J80N 3CCEV 1FXHA 2Q8VA 3F5WC 4Z2WA 1Q6HA 4DK1A 1RP3B 2W6JG 4JPRA 1SQVH 4GX1A 1OCRB 4X20B 3SPHA 3E22A 4WF9V 3F5TA 2KG7A 4U3JA 2QWPB 2XAGA 3K9SA 3A0HZ 1AJQA 4LFBO 4FZ0A 5B1BC 3UT5A 4JAUA 4OGQB 4LF7O 4DR1B 2UXXA 3CEIA 1GAXA 2YS8A 3JCUZ 2ZCEA 5LXTB 1NH2D 3FYEB 1IZ3A 4LF8O 1LNQA 2XT9A 3ZCCA 1N4CA 1VEWA 4NVPA 2ZIOA 4EFBA 1OCZC 2F4VO 1QCEA 3MDSA 1OHHG 1UFIA 1VF6A 3LSUA 4DW1A 1IBKB 1JFFA 2WLNA 3GWKC 4UCVA 3AK3A 1JVMA 1LR1A 4B3RO 2LW1A 2DMXA 3Q4HB 3KZIZ 4ZI7B 2UUAB 3APOA 1CXZB 2V1DA 4P2ZA 2OCCB 1XNRB 3D36A 4QE7A 2H8PC 4N23A 5BR8O 1SZXA 2NLJC 3CRMA 1J5EB 5JQGA 1AP6A 1Y66A 1NS1A 2HP8A 4FLTA 4QIWF 2OTLV 5L3GA 1K5SA 4WBNB 3KCYA 4KUMA 3RYHB 4K3AA 4O4JA 4DR7B 5KHIA 2QSAA 2HHHB 3UO2A 2ZE5A 5B1OA 5B3SB 3H1IH 1GTOA 1DF5A 5KUKA 5E1AC 4BW9A 4MSWC 5JJJB 3T1YB 4GT1A 4LF4B 4DV3B 4BAYA 1KU9A 3DTUB 5IJ0B 4X9QA 2CGNA 1Q43A 3JD1A 4TQDA 4ZIBA 1EFRG 3CRRA 3CMEV 3JARA 1WP8A 1R3KC 4C7UA 2Y4UA 1VQ9V 3QNEA 3STZC 5IJ9A 4TV9B 5EBMC 3CCJV 1QBZA 2F93B 1T5EA 3LSSA 1K33A 4RO2A 1Y67A 2ZQMA 3E8GA 1NU1H 3ZRVA 2BTQB 1S5LZ 1NI8A 4EEQA 1RM1B 4WFEA 3HR0A 4R50A 3ZHVA 1JOYA 3H01A 3T2MA 4UCOA 2UUCB 1HNWO 1WP7A 4O4HB 1XMQO 2IJJA 1FYJA 2E75B 4DR4O 1OCCB 2E76B 2CAZC 4DV2O 1BHAA 2KKWA 1PD3A 1AR4A 1KUQA 3ABKC 1ENVA 5EC1C 3H1KH 3F7YC 1K7DA 4H13B 3JD4A 4GUNA 1O9GA 3RFRA 1AVMA 4IHJB 4DR5O 1P4RA 2A06H 2DQ3A 5LOVB 4O4LB 1YSCA 2R72A 3O9OA 3AG4C 3EXAA 2LJ2A 2KB1A 5EIBD 2YICA 3U11A 2CTPA 1FJGO 2UUBB 2YXLA 1H5WA 2XAHA 1SZTA 1ZTEA 2YXYA 5GTHZ 4RQEA 3ETQA 3VQVA 2GUZA 3VQYA 5KAFZ 2HJFC 2VQFO 3EVKA 3FKSG 4PD4F 4YJ2B 2DQ0A 5KLVH
chains in the Genus database with same CATH topology
1QNMA 4C7UA 1BT8A 3K9SA 3KDRA 5A9GA 1MSDA 1ZLZA 1XREA 1AP5A 4JZGA 1AR5A 3OT7A 3CEIA 2CDYA 1P7GA 1Y67A 3DC6A 1XDCA 4FFKA 1JA8A 1B06A 3TJTA 1MA1A 1EN4A 1KKCA 4F6EA 2AW9A 1VEWA 4BR6A 1ZSPA 1BSMA 3MDSA 2ADPA 3LSUA 1WB7A 3KKYA 3AK3A 4JZ2A 1I08A 3DC5A 1EN5A 3C3TA 1AR4A 1I0HA 4JYYA 1GN3A 1JR9A 3AK2A 1PL4A 1SZXA 4YIOA 1AP6A 1WB8A 1EM1A 1N0JA 1XUQA 1IX9A 4GUNA 2CE4A 1AVMA 3RN4A 3AK1A 1VARA 3IC9A 2ADQB 1GN6A 1LUVA 1D5NA 1GN4A 2P4KA 1ZUQA 1EN6A 2QKCA 3QVNA 2GDSA 1IDSA 1MNGA 2QKAA 1N0NA 1LUWA 4YIPA 1ZTEA 1MMMA 2RCVA 1IXBA 1PM9A 4X9QA 1GN2A 4E4EA 1XILA 3BFRA 5AG2A 1BS3A 3EVKA 3C3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNM A;  4C7U A;  1BT8 A;  3K9S A;  5A9G A;  1MSD A;  1ZLZ A;  1XRE A;  1AP5 A;  4JZG A;  1AR5 A;  3OT7 A;  3CEI A;  2CDY A;  1P7G A;  1Y67 A;  3DC6 A;  1XDC A;  4FFK A;  1JA8 A;  1B06 A;  3TJT A;  1MA1 A;  1EN4 A;  1KKC A;  4F6E A;  2AW9 A;  1VEW A;  4BR6 A;  1ZSP A;  1BSM A;  3MDS A;  2ADP A;  3LSU A;  1WB7 A;  3KKY A;  3AK3 A;  4JZ2 A;  1I08 A;  3DC5 A;  1EN5 A;  3C3T A;  1AR4 A;  1I0H A;  4JYY A;  1GN3 A;  1JR9 A;  3AK2 A;  1PL4 A;  1SZX A;  4YIO A;  1AP6 A;  1WB8 A;  1EM1 A;  1N0J A;  1XUQ A;  1IX9 A;  4GUN A;  2CE4 A;  1AVM A;  3RN4 A;  3AK1 A;  1VAR A;  3IC9 A;  2ADQ B;  1GN6 A;  1LUV A;  1D5N A;  1GN4 A;  2P4K A;  1ZUQ A;  1EN6 A;  2QKC A;  3QVN A;  2GDS A;  1IDS A;  1MNG A;  2QKA A;  1N0N A;  1LUW A;  4YIP A;  1ZTE A;  1MMM A;  2RCV A;  1IXB A;  1PM9 A;  4X9Q A;  1GN2 A;  4E4E A;  1XIL A;  3BFR A;  5AG2 A;  1BS3 A;  3EVK A;  3C3S A; 
#chains in the Genus database with same CATH topology
 2EIL C;  3D3Q A;  4UVB A;  4DUY O;  1RPR A;  4TUY A;  1URF A;  2BSK A;  2ZE8 A;  4B3S B;  4IYH A;  1N36 O;  3NR7 A;  3CRA A;  1WAZ A;  5JH7 A;  1ZX3 A;  4DV6 O;  1B06 A;  1NH2 B;  4J41 A;  3AG2 C;  5B1A B;  1GK9 A;  2LW7 A;  4LFB B;  3W7T A;  2ZR2 A;  3CCM V;  4LF7 B;  3FB8 C;  2VWK A;  3W7W A;  4J7K A;  5KAI Z;  1ZAU A;  4O2B B;  1MZE A;  1SA0 B;  1EN5 A;  4ZHQ B;  4FJC C;  3C3T A;  4DV4 B;  5E79 Z;  1F23 A;  2Q67 A;  5IWA O;  4LF8 B;  1Z5V A;  3B4S A;  1TUB B;  1K3E A;  2AHZ A;  3CJH A;  5HFL A;  2F4V B;  3SYP A;  2JS3 A;  5EYP B;  4PDL A;  1U97 A;  4LFA O;  4B3R B;  1TA8 A;  1TAE A;  3LNM B;  4ABM A;  4PA9 A;  2PI4 A;  2YEV B;  4MS2 A;  4J9Y B;  4HNA A;  4J7J A;  3UKM A;  4EB6 B;  5CA1 B;  1PP9 H;  1V55 C;  4X65 O;  1Y4M A;  4IIJ B;  4PJ0 Z;  5BR8 B;  5LP6 C;  5BXZ A;  1YDX A;  3X2Q B;  5L3F A;  3FD9 A;  2JEX A;  4QPJ A;  1GO3 F;  5KMG A;  3TXQ A;  5AG2 A;  4J7Z A;  2HEP A;  5H9C A;  1YHQ V;  1MOF A;  3SYQ A;  5L3B A;  3O65 A;  4GX0 A;  4B08 A;  3ABL C;  4W4K A;  1J95 A;  3JAL A;  4UV8 A;  3LNN A;  2QWQ B;  3ZMT A;  1E79 G;  1E1R G;  3HB3 B;  3OMI B;  2FL4 A;  1GRJ A;  4DK0 A;  4TSF G;  1FKA O;  4RWU A;  3LDC A;  3B77 A;  4WFG A;  1YTF D;  2AW9 A;  2KG7 B;  4U3J B;  4K0K O;  4H0L B;  3P30 A;  4DO2 A;  2WLM A;  5IYB O;  4I55 A;  3RYF B;  1WB7 A;  4FPP A;  2EJ7 A;  4HAM A;  4X88 A;  2IW5 A;  5IY5 B;  4JI5 O;  4DV7 O;  2DWD C;  2G38 A;  4MVM A;  2YC0 A;  2UUA O;  2QR4 A;  3JCZ A;  2Q69 A;  4X1I A;  3A0R A;  5EZY A;  3AK2 A;  3EHB B;  2PF4 E;  1HNW B;  1JFF B;  2LGW A;  4KL1 A;  4FLZ A;  3AG7 A;  3R66 A;  3BY6 A;  4DW0 A;  1FOU A;  2FKX A;  2AZ2 A;  2UXB O;  1PV0 A;  4DR4 B;  1HW7 A;  5GON A;  1Q82 W;  4DV2 B;  2IM9 A;  4JGS A;  4FM0 A;  4DUZ B;  4G27 B;  4DR7 O;  2P4K A;  4E2L A;  3J7A U;  2QKC A;  2YI9 A;  5EK0 A;  5IE9 A;  2RNB A;  1Y76 A;  4J9Z B;  4GCZ A;  2QTO A;  5JQG B;  2JRI A;  3T1Y O;  4X1Y A;  3E8H A;  4DR5 B;  1XIL A;  2P6J A;  4X62 O;  3B2E E;  3QTC A;  4UVA A;  1QLE B;  4F6R A;  1FJG B;  1U96 A;  4DYL A;  3LSQ A;  4NR1 A;  1SQX H;  4LNU A;  5FLX N;  1PL0 A;  1NBM G;  1I5Y A;  3W7X A;  1VQ8 V;  1JCH A;  4FLX A;  4UB8 Z;  1XQ8 A;  1I94 O;  2JJ2 G;  4GX2 A;  4RQF A;  2CDY A;  1YIT V;  2P5O A;  4WCE V;  4PDM A;  2E5L O;  3E35 A;  3JAR B;  3RYI A;  5F2V O;  2QWR B;  1YI2 V;  2OIE A;  1IJG A;  1G1X B;  2AHY A;  3OMN B;  4DUY B;  4MT8 A;  4BR6 A;  2DOS A;  1Y6X A;  5IJ9 B;  3OD4 A;  1VMG A;  1R3I C;  3FAV A;  2F95 B;  1N36 B;  2VQE O;  2AZ0 A;  4DV6 B;  2Y69 C;  1AI6 A;  5C93 A;  2GTA A;  4HBN A;  1YVW A;  4WFF A;  3IAY A;  1HR0 O;  1Q8I A;  4FZ1 A;  4QGP A;  4YJ3 A;  2Q9L A;  3K0D A;  3RYC A;  4BIZ A;  1FXK B;  1XUQ A;  3QG5 A;  4ZBM A;  1HNZ O;  2GBO A;  5IWA B;  3I5D A;  4N21 A;  3U0Z A;  1XMO B;  2QTS A;  4JYB A;  4NXN O;  1YJ9 V;  4JI6 B;  1GN6 A;  3CP1 A;  2R9R B;  4TWK A;  3WFV A;  3HKB A;  2GDS A;  3PJS K;  4LFA B;  2WLK A;  3BAA A;  4DR3 O;  4J11 A;  1S5J A;  3WB0 A;  5KHH A;  2PI5 A;  2EZO A;  4CBC A;  3K79 A;  1M1K W;  4FLV A;  1ZLZ A;  1HWY A;  4NXM O;  4I50 B;  4X65 B;  3WG7 B;  4DRX A;  2LO1 A;  4IL6 Z;  4AHC A;  2N74 A;  1JJO A;  4UFZ A;  4G28 B;  2CGO A;  2YI8 A;  2IU0 A;  2PYL A;  4MVS A;  3CC4 V;  4L8J A;  1HNX O;  4JTA B;  2ODM A;  3DC6 A;  3OGI B;  2WLI A;  5H5N A;  2EIN B;  4I4T A;  3TJT A;  4CS2 A;  2F43 G;  2HKO A;  1NT2 B;  1S0V A;  2R70 A;  1S72 V;  3OGC C;  4K35 A;  1YTF B;  2ETN A;  3BA8 A;  3VQW A;  2ADP A;  1KQS U;  3OTO O;  4TUY B;  2UXC O;  2BSK B;  2LFR A;  4JTD B;  4JZ2 A;  1W0J G;  3B40 A;  1EZJ A;  1RFY A;  2Q0A A;  2EJR A;  1AI5 A;  5JH7 B;  4Z1V A;  1Q7Y W;  3HKE A;  4X1K A;  4DV4 O;  2JJ1 G;  4K0K B;  1H2L A;  2RQ6 A;  3E83 A;  2B1G A;  4IYI A;  2PY5 A;  1IXM A;  3P3N A;  2DJV A;  1PL4 A;  2HFE C;  3FYI B;  1UJW B;  4CS4 A;  3OEE G;  1RSO A;  4JI5 B;  4DV7 B;  3QO8 A;  4PA4 A;  2QGN A;  3TGU H;  3N2K A;  1R73 A;  1Q3E A;  2PZS A;  1AJN A;  4OXS A;  4CS3 A;  4FM2 A;  5B5E Z;  3I56 V;  3CJH B;  1X4T A;  5J9P C;  5J2U A;  3STL C;  2ATK C;  2EIM B;  1VQP V;  1F4M A;  1P7B A;  1XEQ A;  2YXH A;  1BMF G;  2UXB B;  3ZS8 C;  1JX9 A;  2DYR C;  2YDE A;  3ZRW B;  4B7E A;  4E4E A;  3BFR A;  4WFH A;  3D3I A;  4ICG A;  4Q20 A;  5JJN B;  4HNA B;  4LWS A;  1W2B U;  1Z5W A;  4B3T O;  3D8C A;  3T4Z A;  5C8Y B;  3K58 A;  1OV9 A;  2IBZ H;  3ZX6 A;  3AG1 B;  5CBG A;  4JZG A;  1YIJ V;  5DM6 V;  1I7F A;  3SJB C;  5CB4 A;  4X62 B;  5LYJ A;  2X0L A;  3QF7 A;  4UCR A;  1NJI W;  5FNV A;  1K5Q A;  3WB2 A;  1K9M W;  4LCU C;  5H6R A;  3CE2 A;  4LFC B;  3G6E V;  1KYO F;  1I94 B;  1BHB A;  2EIJ B;  4I0X A;  5BMV A;  3CB2 A;  2E5L B;  3N2G B;  2JDI G;  4JI3 B;  1VQ4 V;  3L75 H;  1PNK A;  1QU7 A;  3JYC A;  1BL8 A;  2YSU B;  3A8T A;  3HKC A;  1M4U A;  2EIK B;  1MAB G;  1K92 A;  3ZBH A;  3L70 H;  2VQE B;  1NTK H;  1KKD A;  1VF5 B;  1XBL A;  5CA0 B;  2KQX A;  4JYC A;  2HG5 C;  3H1H H;  3RN4 A;  1VQ6 V;  3JAK B;  5DN6 G;  1NZ6 A;  2XAJ A;  3HKD B;  4PA6 A;  1M57 C;  3IC9 A;  2OCC C;  4X1I B;  4DUZ O;  1HR0 B;  4FIP C;  1ZUQ A;  5EZY B;  2FYU H;  2XOK G;  5BY1 A;  4JI4 O;  3BAB A;  4YIP A;  3WU2 Z;  1CPY A;  1QVG U;  1HNZ B;  1ORQ C;  1WA8 B;  5GON B;  1JNB A;  3K03 A;  1BE3 H;  3W7U A;  4MW8 A;  4D7S A;  4NXN B;  5KA6 A;  4FM1 A;  5KX5 B;  3JSN A;  3VOU A;  5B3S C;  3EFF K;  1BT8 A;  4QE9 A;  5A9G A;  1XRE A;  1Y76 B;  3OFN G;  5FL7 G;  2B1I A;  5LA6 A;  5L3E A;  4GLX A;  4DR3 B;  2MK3 A;  4RAI A;  2ZXW B;  3ZHS A;  2DWE C;  2GTS A;  3JAS A;  3FX7 A;  4FFK A;  4HYO A;  2QM7 A;  4LBE C;  4O2A A;  4Z1M G;  2UU9 B;  5EBW C;  4NXM B;  2VRZ A;  2WAM A;  4DV0 O;  1NTZ H;  1Q6U A;  1YJW V;  3K3W A;  2PGG A;  1GMG A;  3SPI A;  4O4I A;  3SYO A;  4FVM A;  1HNX B;  1L1F A;  2CTQ A;  5LHG A;  2W0X A;  3JD0 A;  3BA9 A;  3ZMU A;  3VBB A;  2DYS B;  1RM1 C;  3BPZ A;  1R6N A;  1AI7 A;  4UVC A;  4LC1 A;  3OTO B;  2UXC B;  5LHI A;  3FAV B;  1Q90 D;  4YIO A;  2QWN B;  3RVY A;  2X6B A;  4FFB B;  1VF7 A;  5LXT A;  4UB6 Z;  3OM3 B;  1OCC C;  3ABM B;  3SYA A;  1XMO O;  1PPJ H;  1VAR A;  4IT5 A;  1K73 W;  1D5N A;  4JI6 O;  3G80 A;  3JAT A;  3ZN1 A;  3OEH G;  1KMI Z;  4P30 A;  3ZRS A;  1RPO A;  3G67 A;  2Q7G A;  1M5I A;  4X66 O;  3QO5 A;  3K06 A;  2X6A A;  3GB7 C;  2WLL A;  3FFQ A;  2NNU A;  5KHG A;  1VQ7 V;  4LF5 O;  1BGY H;  4QJF B;  3JAW B;  3S3X A;  1SF9 A;  1FAF A;  4JF3 A;  1P7G A;  2LGQ A;  3LUT B;  3H1L H;  2WA3 A;  3RYH A;  2C2A A;  1MA1 A;  5JVD A;  1EN4 A;  2VWJ A;  1L0L H;  3ML0 A;  4OX9 O;  4B3T B;  3L71 H;  1Q86 W;  3S3W A;  3ASN B;  1ARO P;  1M56 B;  1NKD A;  4RUE A;  4KXR A;  1FFX B;  3CXC U;  5IJ0 A;  4GKJ O;  5EBL C;  3KKY A;  2CH7 A;  1SQG A;  1XNQ O;  4PV1 B;  1H8H G;  1K8A W;  1BQZ A;  5IYZ A;  2CTR A;  3JAM N;  4I4T B;  4ZOL A;  4OPA A;  3CRQ A;  4CC5 A;  2R9A A;  2UXN A;  3SJA C;  3E22 B;  5B1A C;  4TV8 A;  4GX5 A;  3RWR D;  3H1J H;  3UT5 B;  4X89 A;  3OUS A;  3C90 A;  3CMA V;  3F7V C;  3AG3 B;  2Q5Z A;  4B7K A;  2O57 A;  1HP8 A;  4X1K B;  2UXD O;  4RUF A;  4NKG B;  1G6U A;  1GN4 A;  4OPH A;  2ILM A;  3CS5 A;  2Q73 A;  4H33 A;  4XDK A;  4I5S A;  2EZP A;  3TET A;  1N0N A;  1YCI A;  1IXB A;  1V54 B;  2WLJ A;  3FB7 C;  2FML A;  2ZNI A;  1RSO B;  1OCO B;  2OYQ A;  2BTO A;  3N2K B;  2P67 A;  1IVS A;  4FLU A;  1MZF A;  2CK3 G;  4BIO A;  1QNM A;  1S5H C;  2P22 C;  5J2U B;  4JI4 B;  3KDR A;  3G71 V;  2GHY A;  3PN1 A;  1XL4 A;  2ITC C;  1AP5 A;  3X2Q C;  3ZED A;  1AR5 A;  3OT7 A;  4IHJ A;  4JAA A;  2EX3 A;  2QM4 A;  1PNM A;  2JGD A;  1QLN A;  4MVU A;  4LF9 B;  1QHT A;  4O4J B;  1N32 O;  2GV9 A;  3CHX A;  4LWS B;  5LP6 A;  3ABU A;  5CMU A;  1BZK A;  1BSM A;  3LDD A;  1AI4 A;  3OMA B;  4LFC O;  3ASO B;  4YHH O;  3DC5 A;  2A3Q A;  1R6K A;  3A0B Z;  5CB4 B;  2PYJ A;  4I9W A;  4JYA O;  3E8B A;  5LYJ B;  4IGG A;  4YJ2 A;  4DV0 B;  4JI3 O;  1KP2 A;  1YXB A;  1ROP A;  5FNV B;  1GN3 A;  2WLH A;  3ETE A;  4EKW A;  2BOB C;  2L35 A;  3OAA G;  5CN0 A;  2IH3 C;  5LGN A;  3L74 H;  3T4D A;  2QDO A;  4GKK O;  4KHP O;  4J80 A;  4F4L A;  1EM1 A;  4XDL A;  1IX9 A;  3W7S A;  5DED A;  5IY5 C;  4U7N A;  1D5A A;  2A0L A;  1Q6I A;  5KHJ A;  2W0F C;  2YUA A;  1PNL A;  2PTM A;  2RMK B;  2ZIN A;  2DW4 A;  3G6B A;  4A5U B;  4DR6 O;  2P7T C;  1LUV A;  3HKC B;  1WNS A;  1SKV A;  5B1B B;  1EN6 A;  4L87 A;  1KBH A;  3KG2 A;  1WPB A;  1IDS A;  1MNG A;  2QKA A;  2QWO B;  1VF6 C;  3QO7 A;  5LMN O;  4O2B A;  4NTX A;  4DXW A;  2GSM B;  1SET A;  1A32 A;  1R3L C;  4W4L A;  2VS0 A;  3P32 A;  2Q0O C;  3M99 B;  1EZV H;  2ZKO A;  4CH4 A;  2ZD9 A;  1OCZ B;  4PA7 A;  5EIB C;  3CPW U;  3IGA C;  1SQF A;  3BVO A;  1KB9 F;  4CH3 A;  2YIB A;  1K4D C;  2HR3 A;  1B6Q A;  4X66 B;  2JK5 C;  1ZL8 A;  3UO3 A;  1NR7 A;  1IBL O;  5IYC O;  2UU9 O;  1KKC A;  1S76 D;  3ZN0 A;  2QE7 G;  4LF5 B;  1M93 A;  1QLE C;  4B3M O;  2Q6A A;  2QEX V;  1N33 O;  2D2C B;  3L9D A;  1BCC H;  5GW7 A;  2XND G;  4X64 O;  4R7C A;  2W6I G;  3ZIA G;  5IDJ A;  4JI2 O;  4DV1 B;  2LQT A;  3I55 V;  1OZ0 A;  1YJN V;  4PI2 A;  3JAS B;  3K59 A;  5D5Q A;  2JS5 A;  1WPX A;  2GUZ B;  4O2A B;  4OX9 B;  4PDR A;  4D7T A;  3A2F A;  1I0H A;  2Q7E A;  4J10 A;  2E74 B;  1AJP A;  3ICX A;  4GKJ B;  2IH1 C;  3DGE A;  4O4I B;  1XNQ B;  1FPO A;  1SQB H;  5GTI Z;  2NN4 A;  4NB5 A;  2WPD G;  1AB3 A;  3J81 N;  2QA4 V;  1DK1 A;  4PEL A;  1R6T A;  4JV5 O;  2KSD A;  2R9I A;  2RJZ A;  2QJ1 A;  1VQL V;  3NXS A;  2LP7 A;  4TT3 G;  3OR7 C;  3B8N A;  3QVN A;  3BHP A;  3RYF A;  1LUW A;  1TUE B;  1MMM A;  2RCV A;  2X7R B;  1FXK C;  3HPL C;  3AEI A;  2N05 A;  3APQ A;  2UXD B;  3C3S A;  1N34 O;  1CP9 A;  4D6T H;  2IJH A;  3JAT B;  1H2G A;  5DEC A;  2ZR3 A;  1VIB A;  1GM9 A;  1FD9 A;  2WWW A;  3TCU A;  2DE0 X;  1NVP D;  2P4V A;  4U3F H;  3BRC A;  3JD3 A;  3DSQ A;  4CH5 A;  1EBO A;  1JA8 A;  4JI8 B;  3CCV V;  1YEW A;  5CBF A;  1M57 B;  4NTY A;  2WLL B;  3L72 H;  1Q5O A;  1TVK A;  4MTX A;  3ABK B;  4BW5 A;  1MG1 A;  4CC6 A;  2Z5U A;  4UCT A;  4JI7 O;  4I9Q A;  1VQN V;  3WG7 C;  3OUF A;  2OWO A;  3UQ8 A;  1IBM O;  1Q81 W;  2DN9 A;  2YIB D;  4JTC B;  5KMG B;  1K4C C;  2ZNJ A;  3AG4 B;  2EIN C;  3RT3 C;  3DXR A;  1MSW D;  2H3O A;  1N32 B;  3ZHU A;  5JVD B;  1GH6 A;  3SYC A;  1OCR C;  1PKX A;  4GZR B;  5IYD O;  2XTA A;  5HFM A;  4KFM A;  2IU3 A;  2E3C A;  4YHH B;  1GM8 A;  1KC8 W;  1WB8 A;  4YXW G;  3MHS C;  1N0J A;  2CH7 B;  3JAL B;  2ZE7 A;  2CE4 A;  1S3J A;  4JYA B;  5JCO C;  5IYZ B;  4ZOL B;  2AGA A;  1SRY A;  2K1E A;  2EIL B;  4X8A A;  4AQY O;  4YY3 O;  3K5L A;  4TV8 B;  4GKK B;  4KHP B;  1UPG A;  3CCR V;  4I55 B;  3SJQ C;  4J42 A;  1GM7 A;  5B1N A;  3ABT A;  1BS3 A;  3K04 A;  2Z0A A;  3AG2 B;  2K9P A;  3BCC H;  5KHK A;  4DR6 B;  5B66 Z;  4CH6 A;  1SC5 B;  1WLE A;  2AXT Z;  3CSX A;  3ZMV A;  4UUJ C;  2EIM C;  4K8X A;  5LMN B;  2JEU A;  1FXK A;  1JQ0 A;  4PA3 A;  5BZB A;  2Y4T A;  4FLY A;  4K8Z A;  1V9P A;  3IFX A;  2V4D A;  1D2D A;  3CCL V;  2BE3 A;  3OW2 U;  1L8D A;  4LF9 O;  1P84 F;  1KEC A;  2XHB A;  2EBO A;  2Q68 A;  3K57 A;  5J2T A;  1ZSP A;  2XUM A;  2Q7H A;  3IC7 A;  1NQT A;  3AG1 C;  4XBF A;  1JMK C;  1NTM H;  4X1Y B;  1Y74 A;  2WSS G;  4XDJ A;  2A7W A;  5ITZ A;  1IBL B;  4R8C A;  2JGD B;  3K5N A;  2ARH A;  4I50 A;  4B3M B;  4EFE A;  1N33 B;  3RBZ A;  1SES A;  1V55 B;  4F6R B;  1JR9 A;  1R1B A;  3K0G A;  4X64 B;  5LP6 B;  1QVF U;  4JI2 B;  3LDE A;  4LNU B;  5LGU A;  3FB5 C;  4JI0 O;  5LBQ A;  2EIJ C;  3M8A A;  3T1H O;  2ZE6 A;  4I7Z B;  5K1P A;  5L3D A;  4DV5 O;  3ETG A;  2P06 A;  4X20 A;  3AK1 A;  2JVD A;  2ADQ B;  1WJZ A;  3RYI B;  4JI1 O;  2EIK C;  4MTO A;  1XI1 A;  1XL6 A;  3ABL B;  4U7O A;  4NTW A;  3ZMZ A;  1SQP H;  4KP4 A;  4FLW A;  5JCO A;  1H38 A;  4ASU G;  5EC2 C;  5CBH A;  1QQC A;  2CUG A;  1KP3 A;  2HJD A;  4JV5 B;  1COW G;  1W0K G;  2X6C A;  2JIZ G;  4BWA A;  4HZ3 A;  4LH6 A;  1AR1 B;  3H9V A;  2QKS A;  1H8E G;  1VQO V;  4YJ3 B;  4PI0 A;  3RYC B;  2ZM6 O;  1NVP B;  3Q4H A;  1G4Y B;  4ZI7 A;  3E89 A;  4DR2 O;  3ZRX A;  3BEH A;  2XAF A;  1N34 B;  4P9O A;  2A79 B;  1YZB A;  3IJ4 A;  5LL6 Y;  1Z2G A;  3OE7 G;  4JAS A;  4LF6 O;  2IJI A;  1E1Q G;  4QPK A;  4AIL C;  1VP7 A;  3HKB B;  5LMU O;  1O9H A;  1VQM V;  3SPC A;  3ZRW A;  3UCS C;  3ZHQ A;  3ZMS A;  1I08 A;  2ZXW C;  4DV1 O;  2HVK C;  1ZL8 B;  2ZIM A;  4WBN A;  3FB6 C;  1FXV A;  1DLB A;  4MVQ A;  2WA4 A;  5JJE B;  2B5U A;  4JI7 B;  5C8Y A;  4JAV A;  1JJ2 U;  3CCQ V;  2HLD G;  4DRX B;  4MVR A;  3RVZ A;  5H2F Z;  1IBM B;  1R3J C;  2BCC H;  1N8R W;  4G2K A;  1K34 A;  3CXH F;  2WLI B;  2Z3Y A;  1F51 A;  2Y48 A;  5JWP A;  2M7W A;  3SGI A;  1H2S B;  1P49 A;  1XHX A;  2XAQ A;  2DYS C;  1SER A;  2LFS A;  2XAS A;  3M7M X;  4TV9 A;  4FMT A;  4MVO A;  2V7Q G;  3CC2 V;  3ZHR A;  1YF2 A;  5K1X A;  1QR9 A;  1PM9 A;  1US6 A;  3MD0 A;  4UXN A;  4ZKI A;  4DR1 O;  3N2G A;  3OR6 C;  3MAQ A;  1QR8 A;  3K5M A;  2BTQ A;  3CYO A;  3GWO A;  2OT5 A;  3JSL A;  3ABM C;  3HKE B;  4AQY B;  3ZHT A;  4YY3 B;  1WN7 A;  4H37 A;  2Y0P A;  3ETD A;  4WFB V;  5D5P A;  1KD1 W;  3CC7 V;  4UCU A;  1MSD A;  3KCX A;  1DTO A;  2QM8 A;  3P3P A;  5CA0 A;  1IBK O;  1TGO A;  2Y69 B;  4H44 B;  4O4H A;  1XOU A;  1XDC A;  4TQF A;  3JAK A;  4CZZ A;  1VQK V;  1H2M A;  3HKD A;  3TK1 A;  4MTG A;  2HVJ C;  4JI8 O;  5KA5 A;  4Q6G A;  4F6E A;  2ZDI C;  3RW0 A;  1XNR O;  1ZWI C;  5LGT A;  3MHH C;  2N04 A;  1SS3 A;  4LP8 A;  3TXS A;  4GYC B;  4PHZ A;  4LH7 A;  3N27 A;  1XMQ B;  1J5E O;  3RGB A;  1WA8 A;  5LOV A;  4LR3 A;  4O4L A;  3JD2 A;  1BQ0 A;  1TVK B;  5KX5 A;  3R65 A;  3K08 A;  3CCU V;  2RDC A;  1H2N A;  4WFA V;  2HHH O;  3E86 A;  3K9A A;  4UCS A;  3ASN C;  1M56 C;  2YID A;  3CCS V;  2OCH A;  4LF4 O;  2FTK A;  2Y0I A;  4DV3 O;  3L73 H;  3OTF A;  2NR5 A;  5KUM A;  1GKF A;  1S77 D;  2YIA A;  1X59 A;  1HDJ A;  3DXR B;  3ZJZ A;  1B3Q A;  1SQQ H;  1FFT B;  1FS0 G;  5L3C A;  1CEZ A;  1THZ A;  1M90 W;  1DGS A;  4MVZ A;  4JI0 B;  2A9H A;  3SPJ A;  4FK5 C;  3SJC C;  3T1H B;  2JGU A;  4I0X B;  4MTF A;  5BMV B;  1M9N A;  1GN2 A;  4DV5 B;  2OIG A;  3SR2 C;  5CA3 A;  2VQF B;  3AG3 C;  1NR1 A;  2F1M A;  2L6L A;  2BOC C;  4JI1 B;  4UV9 A;  3E2E A;  3UM7 A;  2ZT9 B;  3E8F A;  1DF4 A;  2H94 A;  2OTJ V;  4FFB A;  1V54 C;  3CX5 F;  2UUC O;  5A2Q N;  1OJH A;  1SA0 A;  3WB1 A;  5LHH A;  5FPR A;  4ZHQ A;  1OCO C;  1H2K A;  5TIS Z;  1TUB A;  3K5O A;  3D36 C;  1B04 A;  5EYP A;  1JPX A;  3VQX A;  1W59 A;  5H6Q A;  4R6Z A;  3CWB H;  4MW3 A;  4PDV A;  2ZM6 B;  5IT9 N;  1F7Y A;  3B8M A;  3SDL A;  2D3O W;  2P90 A;  4AI8 A;  4DR2 B;  1I5X A;  2F23 A;  3G4S V;  2B9Z A;  4TOI A;  2ZDI A;  2YEV A;  2ITD C;  5FPO A;  1F4N A;  4JYY A;  3CRC A;  3U10 A;  2M6Y A;  2Q4P A;  4EB6 A;  1VQ5 V;  4LF6 B;  5CA1 A;  1XHZ A;  4IIJ A;  5J2T B;  3JAW A;  2CTW A;  1AIL A;  5LMU B;  2UUB O;  3CD6 V;  4NYK A;  2RN9 A;  3SPG A;  2DYR B;  2FB5 A;  5LA6 B;  3ASO C;  4BIU A;  3THO A;  1G8M A;  1Y74 B;  3GVM A;  5ITZ B;  1IUR A;  2MW2 B;  2IJK A;  4QNH B;  3T1C A;  1K97 A;  4P9P A;  1FFX A;  2EUL A;  1L0N H;  2PUS A;  2F66 C;  4B3S O;  3B09 A;  3J80 N;  3CCE V;  1FXH A;  2Q8V A;  3F5W C;  4Z2W A;  1Q6H A;  4DK1 A;  1RP3 B;  2W6J G;  4JPR A;  1SQV H;  4GX1 A;  1OCR B;  4X20 B;  3SPH A;  3E22 A;  4WF9 V;  3F5T A;  2KG7 A;  4U3J A;  2QWP B;  2XAG A;  3K9S A;  3A0H Z;  1AJQ A;  4LFB O;  4FZ0 A;  5B1B C;  3UT5 A;  4JAU A;  4OGQ B;  4LF7 O;  4DR1 B;  2UXX A;  3CEI A;  1GAX A;  2YS8 A;  3JCU Z;  2ZCE A;  5LXT B;  1NH2 D;  3FYE B;  1IZ3 A;  4LF8 O;  1LNQ A;  2XT9 A;  3ZCC A;  1N4C A;  1VEW A;  4NVP A;  2ZIO A;  4EFB A;  1OCZ C;  2F4V O;  1QCE A;  3MDS A;  1OHH G;  1UFI A;  1VF6 A;  3LSU A;  4DW1 A;  1IBK B;  1JFF A;  2WLN A;  3GWK C;  4UCV A;  3AK3 A;  1JVM A;  1LR1 A;  4B3R O;  2LW1 A;  2DMX A;  3Q4H B;  3KZI Z;  4ZI7 B;  2UUA B;  3APO A;  1CXZ B;  2V1D A;  4P2Z A;  2OCC B;  1XNR B;  3D36 A;  4QE7 A;  2H8P C;  4N23 A;  5BR8 O;  1SZX A;  2NLJ C;  3CRM A;  1J5E B;  5JQG A;  1AP6 A;  1Y66 A;  1NS1 A;  2HP8 A;  4FLT A;  4QIW F;  2OTL V;  5L3G A;  1K5S A;  4WBN B;  3KCY A;  4KUM A;  3RYH B;  4K3A A;  4O4J A;  4DR7 B;  5KHI A;  2QSA A;  2HHH B;  3UO2 A;  2ZE5 A;  5B1O A;  5B3S B;  3H1I H;  1GTO A;  1DF5 A;  5KUK A;  5E1A C;  4BW9 A;  4MSW C;  5JJJ B;  3T1Y B;  4GT1 A;  4LF4 B;  4DV3 B;  4BAY A;  1KU9 A;  3DTU B;  5IJ0 B;  4X9Q A;  2CGN A;  1Q43 A;  3JD1 A;  4TQD A;  4ZIB A;  1EFR G;  3CRR A;  3CME V;  3JAR A;  1WP8 A;  1R3K C;  4C7U A;  2Y4U A;  1VQ9 V;  3QNE A;  3STZ C;  5IJ9 A;  4TV9 B;  5EBM C;  3CCJ V;  1QBZ A;  2F93 B;  1T5E A;  3LSS A;  1K33 A;  4RO2 A;  1Y67 A;  2ZQM A;  3E8G A;  1NU1 H;  3ZRV A;  2BTQ B;  1S5L Z;  1NI8 A;  4EEQ A;  1RM1 B;  4WFE A;  3HR0 A;  4R50 A;  3ZHV A;  1JOY A;  3H01 A;  3T2M A;  4UCO A;  2UUC B;  1HNW O;  1WP7 A;  4O4H B;  1XMQ O;  2IJJ A;  1FYJ A;  2E75 B;  4DR4 O;  1OCC B;  2E76 B;  2CAZ C;  4DV2 O;  1BHA A;  2KKW A;  1PD3 A;  1AR4 A;  1KUQ A;  3ABK C;  1ENV A;  5EC1 C;  3H1K H;  3F7Y C;  1K7D A;  4H13 B;  3JD4 A;  4GUN A;  1O9G A;  3RFR A;  1AVM A;  4IHJ B;  4DR5 O;  1P4R A;  2A06 H;  2DQ3 A;  5LOV B;  4O4L B;  1YSC A;  2R72 A;  3O9O A;  3AG4 C;  3EXA A;  2LJ2 A;  2KB1 A;  5EIB D;  2YIC A;  3U11 A;  2CTP A;  1FJG O;  2UUB B;  2YXL A;  1H5W A;  2XAH A;  1SZT A;  1ZTE A;  2YXY A;  5GTH Z;  4RQE A;  3ETQ A;  3VQV A;  2GUZ A;  3VQY A;  5KAF Z;  2HJF C;  2VQF O;  3EVK A;  3FKS G;  4PD4 F;  4YJ2 B;  2DQ0 A;  5KLV H; 
#chains in the Genus database with same CATH homology
 1QNM A;  4C7U A;  1BT8 A;  3K9S A;  3KDR A;  5A9G A;  1MSD A;  1ZLZ A;  1XRE A;  1AP5 A;  4JZG A;  1AR5 A;  3OT7 A;  3CEI A;  2CDY A;  1P7G A;  1Y67 A;  3DC6 A;  1XDC A;  4FFK A;  1JA8 A;  1B06 A;  3TJT A;  1MA1 A;  1EN4 A;  1KKC A;  4F6E A;  2AW9 A;  1VEW A;  4BR6 A;  1ZSP A;  1BSM A;  3MDS A;  2ADP A;  3LSU A;  1WB7 A;  3KKY A;  3AK3 A;  4JZ2 A;  1I08 A;  3DC5 A;  1EN5 A;  3C3T A;  1AR4 A;  1I0H A;  4JYY A;  1GN3 A;  1JR9 A;  3AK2 A;  1PL4 A;  1SZX A;  4YIO A;  1AP6 A;  1WB8 A;  1EM1 A;  1N0J A;  1XUQ A;  1IX9 A;  4GUN A;  2CE4 A;  1AVM A;  3RN4 A;  3AK1 A;  1VAR A;  3IC9 A;  2ADQ B;  1GN6 A;  1LUV A;  1D5N A;  1GN4 A;  2P4K A;  1ZUQ A;  1EN6 A;  2QKC A;  3QVN A;  2GDS A;  1IDS A;  1MNG A;  2QKA A;  1N0N A;  1LUW A;  4YIP A;  1ZTE A;  1MMM A;  2RCV A;  1IXB A;  1PM9 A;  4X9Q A;  1GN2 A;  4E4E A;  1XIL A;  3BFR A;  5AG2 A;  1BS3 A;  3EVK A;  3C3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...