1N0JA

The structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Human Mitochondrial Mn3+ Superoxide Dismutase Reveals a Novel Tetrameric Interface of Two 4-Helix Bundles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1n0jA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1n0jA02
1P7GA 1LUVA 1IXBA 2P4KA 3MDSA 4YIOA 2CE4A 4BR6A 1I0HA 2GDSA 1MMMA 5AG2A 1KKCA 1GN4A 4YIPA 2RCVA 1EN6A 1JR9A 4C7UA 4X9QA 1XDCA 3DC5A 1AR5A 1EM1A 1B06A 1GN2A 3EVKA 3BFRA 3TJTA 4GUNA 1PL4A 1XREA 1MSDA 1WB7A 3AK1A 3C3SA 3QVNA 3CEIA 1WB8A 3OT7A 2QKCA 1ZTEA 3AK2A 1XUQA 1EN4A 1EN5A 3C3TA 2AW9A 2CDYA 1AP6A 5A9GA 1AP5A 1Y67A 3DC6A 1N0NA 3K9SA 1ZUQA 1GN6A 4JYYA 1XILA 1IDSA 1AR4A 1MNGA 1VARA 1ZSPA 1I08A 4JZ2A 1MA1A 1PM9A 1BT8A 3AK3A 3RN4A 1ZLZA 1D5NA 1BS3A 1JA8A 4FFKA 2QKAA 2ADPA 1N0JA 1LUWA 1IX9A 1AVMA 1GN3A 3IC9A 4JZGA 4F6EA 3KKYA 2ADQB 4E4EA 1VEWA 1QNMA 1SZXA 1BSMA 3LSUA
chains in the Genus database with same CATH superfamily
4LFCO 2XHBA 2LP7A 1P7GA 3EFFK 4JI8B 4YIOA 5EBLC 1NTZH 1SKVA 5LYJA 2ZR2A 3IJ4A 3W7XA 5GONA 1GN4A 3IGAC 4U3JA 4RUFA 1NZ6A 1FFTB 1PD3A 3SPHA 3AG3B 4J10A 3UQ8A 1Q81W 4UVAA 5JJEB 3EVKA 4DR1O 2JGUA 1EZVH 1BQZA 1RM1C 5H5NA 1FJGO 3B8NA 2WLIA 4JTCB 4MTFA 4QNHB 1HDJA 1IBMO 1GO3F 4JV5B 4MW3A 1WB8A 1YZBA 4FVMA 4DV0O 3T4ZA 1P49A 2UXNA 4X65B 4JI3B 4DV6O 2CH7A 4GT1A 1THZA 5KLVH 3CCLV 2W6IG 5LL6Y 4R6ZA 5GTHZ 3J7AU 5DN6G 5LMNB 3F5TA 4WFHA 1S5JA 1WLEA 4JYYA 2YXYA 4UVBA 2BTQA 5CA0A 2PY5A 4FK5C 1IDSA 3N2KB 1AR4A 1DLBA 1VARA 2RJZA 5BZBA 1XNRB 1H8HG 1URFA 3HKEB 1AI4A 4AHCA 2P6JA 2IH3C 1K7DA 4OPAA 4JZ2A 4LF8B 1CPYA 5JH7B 4ZHQA 1GTOA 5L3GA 2ZE7A 3LDEA 1IX9A 3RYIB 2WLJA 5IDJA 1SF9A 1H38A 4ZI7A 1YCIA 2QWRB 4I55A 2R9IA 4J7KA 4LBEC 4JAUA 1QQCA 2Z5UA 5KUKA 1I5XA 1YDXA 4QPJA 4BWAA 4K0KO 1Y6XA 3UT5A 1Q6UA 5CA1B 3WB1A 2EZPA 2ZE6A 2ZM6O 4ZKIA 4HBNA 1MMMA 4JI8O 4LF6O 1N32B 4DXWA 4UB8Z 1FD9A 2IU3A 4JI5O 2YC0A 3SJQC 5KX5B 2A7WA 1VF7A 2GV9A 4UUJC 3ZMSA 3FB5C 5DM6V 3UCSC 4KL1A 3RBZA 1LR1A 1VQ8V 1Z5WA 5LYJB 4TUYA 1MSDA 2QWQB 1OCCB 3GWKC 2VQEB 3SGIA 1GAXA 5IYZB 3OMNB 4JI7B 4GKKO 1KYOF 2A79B 4FMTA 3VQXA 2JVDA 1XUQA 3FX7A 2XAGA 4NYKA 1JFFB 1FXHA 3JARB 3G71V 2Q0OC 3RW0A 2N04A 4N23A 4DV6B 3JALB 1OCCC 3K9SA 3CCVV 1WPXA 3ZRWB 5C8YA 3VQWA 5GW7A 3LNNA 3LDCA 2Y48A 1KU9A 4LCUC 4KUMA 1NTKH 1PM9A 3J80N 3PN1A 2AZ0A 1VQKV 5K1PA 1MZEA 1SERA 2E5LO 4CH5A 1D5AA 2IM9A 2CTRA 1GH6A 1NVPD 1TUBB 5FPRA 2JEUA 5E79Z 2ZDIC 4OX9O 4DR7B 3C90A 2WA4A 1S5HC 1YIJV 1XNQO 2Q6AA 2VWJA 5IT9N 5CA3A 1XHXA 2YXHA 3ETQA 4ABMA 4CS4A 3UKMA 5C8YB 3H01A 1R3LC 2EIKB 2ZM6B 2YI8A 2A9HA 4MVRA 3K3WA 4DK1A 5BR8O 5LGNA 4X1YA 4BR6A 1VF6A 2GTSA 5LP6B 3UO2A 4K35A 2YICA 3QTCA 2GUZA 1JJ2U 1XMOB 1S72V 4P30A 5C93A 1SQQH 4LF5B 1XQ8A 1SQXH 4LH6A 4WFBV 2UXBO 4IGGA 3K0GA 2OTLV 2E74B 3ZIAG 4DV2B 4B3SO 5A2QN 2UUCO 1M56B 4AI8A 3WU2Z 2OT5A 3K08A 4GKKB 4DR5B 1H8EG 3NXSA 5D5PA 1NI8A 5ITZA 3ZHUA 1XL6A 1HW7A 3MD0A 1XBLA 4LF4O 2PF4E 4G2KA 3CRCA 5BY1A 1EN5A 4O4JB 4DV3O 1Y76A 3B4SA 2HR3A 2MK3A 1Y74B 2HJFC 3BEHA 3L75H 1FXKB 3LDDA 3HKBA 3I55V 1KQSU 1R6KA 1ZSPA 4LFCB 4I55B 2EZOA 2IH1C 5LMUO 4O4LA 3ASNB 3SR2C 2OWOA 3ZRXA 2YXLA 4CS2A 4FLWA 1VQNV 1BT8A 2V7QG 2QKAA 2Q5ZA 5LHHA 2YEVA 2F4VO 4WFFA 1FJGB 2HJDA 4MS2A 4J80A 2XNDG 3R65A 3OEEG 4W4LA 2AHYA 3CPWU 2W0FC 4GX0A 1GM9A 3ZHVA 5CA0B 5LA6B 2ZD9A 1BQ0A 4JYBA 1FXVA 4ASUG 5EBWC 4QE9A 1KP2A 4U7NA 2CE4A 4Z2WA 1XMOO 2Y69B 4FLZA 2UUBO 2W6JG 2XOKG 5EBMC 1J5EO 2WLNA 3ZCCA 3OTOB 4JAVA 1HNXB 3SYQA 3E8FA 3QO7A 3VQVA 1K34A 2QWOB 1NH2D 3DSQA 1OCRC 3STZC 2VQEO 1HR0O 2FL4A 1VIBA 3G67A 1ROPA 5IYDO 5EC2C 3BVOA 4PJ0Z 3OEHG 3CHXA 4DYLA 3ZRWA 1VF6C 4B7EA 3ZS8C 1LNQA 4UCSA 4B7KA 1Y66A 2OTJV 4D7TA 5JCOA 2B9ZA 2X0LA 1KBHA 5KHKA 1K3EA 4EB6A 5LGUA 3AG7A 4TV9B 2HKOA 2RQ6A 4TT3G 2DW4A 2K1EA 4A5UB 3CJHA 2VWKA 4IT5A 5JQGB 4LF6B 3H1JH 3RWRD 1HNWB 4I50A 3CMAV 3U10A 2HHHO 1CEZA 4FLXA 4TV8B 3RYHB 4X62O 3F5WC 3HKBB 3CD6V 3IC9A 2RMKB 2H8PC 1NKDA 4X1YB 2RNBA 1P84F 1GMGA 4O2AA 2B5UA 2EBOA 1OV9A 3HKCB 3E2EA 1FOUA 3ABMC 4LNUA 4HNAB 3CS5A 3ASOB 3CCSV 4J9YB 5LOVA 1AROP 2UXXA 4H44B 1K5SA 2Q67A 1QHTA 4DUZB 2QDOA 4FZ0A 1NS1A 1H2MA 4X89A 1IXMA 3CCJV 2P4VA 3L74H 4D6TH 1SESA 2E3CA 2EINC 1V55B 5LXTA 1Q6HA 2MW2B 4O2AB 2JRIA 1WB7A 4LF5O 1AI7A 2E76B 1Q3EA 1QBZA 3DXRA 4B3SB 1N33B 5IE9A 4UXNA 1KKDA 3BRCA 4YHHO 1KECA 4I4TA 1A32A 2CDYA 2B1GA 3ABKC 3L71H 4FM0A 4DR2O 1OCZC 4DR1B 1WP7A 3AG2C 4X1IB 3APQA 1X4TA 1GN6A 3A2FA 4JAAA 4DV3B 1PNLA 2DQ3A 1K33A 2BSKB 4O4HB 4MSWC 4LR3A 4MVSA 4B08A 4WF9V 3RYFA 1PPJH 1R6NA 2KKWA 2Y0IA 1ENVA 4X65O 2WLKA 5EIBD 1IURA 1N8RW 1O9GA 4DV1B 4IYHA 2IJHA 2M7WA 3JSLA 1N0JA 3OD4A 5LGTA 3BA8A 4U3FH 3RT3C 1P7BA 3K57A 1DGSA 2A0LA 4PHZA 1S77D 4E4EA 2A3QA 3ZN0A 3RYFB 2ATKC 5JJNB 1JQ0A 2Q7EA 2CUGA 4GKJO 4DO2A 1COWG 3KDRA 5JH7A 4CS3A 1MZFA 4XDJA 4O4IA 4R7CA 3BY6A 3LUTB 1BGYH 1L8DA 4EEQA 1QU7A 3QNEA 4MTOA 3D3IA 2P90A 4H37A 5LMUB 1WAZA 4FM1A 1VQLV 1M9NA 1Q6IA 3QVNA 1NR1A 5H6RA 1TUBA 2DYRC 2JDIG 3ETGA 4NXMB 2FTKA 1VQMV 3JSNA 5B3SC 3FAVB 4FZ1A 2K9PA 4Q20A 5BR8B 3KZIZ 2FYUH 3F7VC 4WFEA 1BZKA 1RFYA 5H9CA 4YHHB 2F4VB 4RO2A 4TQFA 3OGCC 2WLLB 3HR0A 3Q4HA 4JI1O 1QCEA 4Z1VA 1S76D 1W0KG 4JYAO 1AB3A 4CH4A 3RYIA 3CX5F 2Z0AA 3AG1B 2QWPB 4XBFA 4DR3B 2ODMA 1H2NA 1JFFA 4PI2A 3FB7C 4FFKA 3N2GB 3JALA 1HP8A 5B1BB 1R1BA 5CBGA 1K9MW 1RPOA 1WNSA 2EIJB 2QSAA 1XOUA 2PTMA 4ZOLB 4DV1O 3O65A 2LW7A 3S3XA 1YSCA 4IIJB 3P30A 4TV9A 4DV0B 5KA5A 4MVZA 1BHAA 1EFRG 5H2FZ 1QR8A 4FFBA 3ZRSA 5D5QA 2Q68A 4DW0A 2IJKA 4LP8A 1Y74A 4HAMA 1SETA 1VQPV 2Q8VA 3P3NA 1XMQB 1SQGA 4I9QA 4I0XA 1KKCA 1NH2B 4WCEV 4YIPA 2BOCC 3CCEV 3DGEA 3CWBH 5IYCO 3HKCA 1E79G 3HKDA 2P06A 1E1RG 4LFBB 4DV4B 4PI0A 3B40A 3BFRA 5H6QA 3SPGA 1YJNV 3K9AA 2KB1A 2HHHB 1BL8A 4UCTA 3UM7A 1VMGA 2DYSB 2CK3G 3K03A 5CB4B 2WWWA 1N34B 5DECA 3VOUA 4WBNB 2DWDC 3WB0A 1VQ5V 4XDLA 5L3EA 2FKXA 2FB5A 3JAMN 5B1OA 1ZTEA 1IBKB 5LP6A 4GYCB 3OR6C 3K79A 4Z1MG 1N0NA 4DV2O 2GUZB 5LBQA 1K73W 4BW5A 1V54C 2Y0PA 2FMLA 3SPCA 4O4LB 1FFXB 1J95A 4J42A 4JI5B 3RYCA 2P7TC 1RSOB 2EILB 4DUYO 3WFVA 2OCCC 4DR3O 3TXSA 2CTQA 1NT2B 1RP3B 1IBLB 3A0RA 5EZYA 1QLEB 4JI7O 1HWYA 3H1HH 3LSUA 4N21A 3D3QA 4J7JA 1E1QG 4JI4O 2WLMA 2QWNB 1ORQC 2Z3YA 3K5LA 2F1MA 3D8CA 5LHGA 5CMUA 5L3BA 2ZXWC 3B77A 2OIEA 4X1IA 4L87A 2WSSG 4P9PA 2QEXV 3ZMUA 1TUEB 1FYJA 1BE3H 2P5OA 2F23A 2ZCEA 4DR2B 2G38A 2DE0X 3FKSG 4CZZA 2DOSA 1M90W 4G28B 3JAKA 3JARA 5GONB 5E1AC 3ABMB 3P32A 3ETEA 4CH3A 3CMEV 1Q5OA 5BXZA 3ZEDA 2UXCO 3BAAA 5EC1C 2EJ7A 5CN0A 3KCYA 4QE7A 5KMGB 4DR7O 3TGUH 3AK2A 2PYJA 3SJAC 4J41A 1WA8B 2EIMB 2CAZC 4QGPA 4KP4A 1Z5VA 4NTXA 1ZUQA 3ZHQA 2UU9B 2VRZA 4O2BA 2M6YA 4HNAA 4JI2B 5B1AC 2E75B 3BABA 5F2VO 1SC5B 1YVWA 1F4MA 3M99B 3OM3B 4PA3A 4P9OA 5IJ0A 2HLDG 2UXCB 1HNWO 4FIPC 4JZGA 1D2DA 1M93A 1V54B 1FAFA 1B6QA 4XDKA 1VEWA 1QVGU 1QNMA 5FL7G 1Q7YW 4NR1A 1L0NH 1XEQA 2Q0AA 1RM1B 1IXBA 4TSFG 4EKWA 2EX3A 3JATA 1W2BU 1U96A 5FPOA 3JD4A 4HYOA 3OR7C 3FD9A 5CB4A 3Q4HB 3CB2A 2GHYA 3AG4B 4GCZA 2JS3A 4QIWF 2GSMB 3RGBA 4PDVA 1FKAO 2CTPA 3CCUV 5FNVB 4DK0A 2Y4TA 1AI5A 5IY5B 3ZN1A 4H13B 2WA3A 1DF4A 3GWOA 1OHHG 3AG2B 2XT9A 4PA6A 1KP3A 2NR5A 1WP8A 3CRRA 4JI3O 4TWKA 1F51A 1H2KA 2ITCC 2Y69C 4G27B 2KG7A 2EULA 3B09A 3X2QB 2LJ2A 2ITDC 5J2TB 1SRYA 1EN4A 2IBZH 1MSWD 3AG3C 3K5OA 4I5SA 2XAQA 3UT5B 2VQFO 5A9GA 3QG5A 2YIDA 2QTSA 4FPPA 3ZMVA 2LFSA 3IAYA 4EFBA 1JX9A 2PYLA 4LF9B 2UUBB 2GTAA 3OMIB 2YUAA 5JWPA 3FYEB 1I08A 5KAFZ 3T1YB 4I50B 2DWEC 3CYOA 1MA1A 1BHBA 4UFZA 1R73A 2LW1A 3QF7A 2QE7G 2C2AA 3E22B 4PDRA 4ZHQB 1Y4MA 3ZRVA 1N36O 1GN3A 3HPLC 3ETDA 4MW8A 4LFAB 2XTAA 5LHIA 1NTMH 3H1LH 3SPIA 2D2CB 3SPJA 4LH7A 1GM8A 3ASNC 4NXMO 1VQ4V 2ETNA 2Q7HA 3I5DA 3U0ZA 3LSQA 1PNMA 3FB8C 1IBMB 3VBBA 3RFRA 4X64O 2E5LB 4JASA 5B5EZ 1Q90D 1DF5A 2NNUA 1Z2GA 2R70A 1PP9H 2WPDG 2YS8A 2JK5C 3ABKB 4YJ2A 3T1YO 2IJIA 1OCZB 1XNQB 5JCOC 1XDCA 3T1HB 3DC5A 1AR5A 3B2EE 3VQYA 3TJTA 3WG7C 4DUYB 3C3SA 4X62B 4GX2A 1ZWIC 1I7FA 5KMGA 2UXBB 1KB9F 5LA6A 2DN9A 1MG1A 4IHJA 3ABUA 1T5EA 3H9VA 5LMNO 2UUAB 4I4TB 1Q8IA 4X66O 4W4KA 4JI4B 3D36A 3DC6A 4DRXA 4KFMA 3OFNG 4BW9A 4CC5A 3BCCH 2AGAA 2EIJC 4X20B 3JCUZ 4LF8O 4UCRA 1G4YB 2JGDB 4QPKA 4YY3O 3X2QC 4JYCA 3TCUA 5KA6A 3J81N 2KSDA 3ZBHA 1VP7A 1AJNA 4X8AA 3RVYA 3TETA 1CXZB 4ICGA 3MHSC 1DTOA 4BIUA 5B1AB 2PUSA 1WA8A 2LFRA 2F43G 4B3TO 1GKFA 3G80A 2YDEA 2ZQMA 3CCQV 1XI1A 3A0HZ 1YXBA 1TVKA 3R66A 4JPRA 1SA0A 2QGNA 2KQXA 4BAYA 1SZTA 2P4KA 1M4UA 3JAWA 3S3WA 4JTAB 2ZKOA 1L1FA 1Q86W 3SDLA 1YEWA 4NXNB 3RVZA 5CBHA 3K58A 4FJCC 5JVDB 4C7UA 1AI6A 2Q69A 5JQGA 1SQBH 2L35A 1US6A 2CTWA 3STLC 4DV7O 3W7UA 5J9PC 3K5NA 1B3QA 4DR6O 1QVFU 2GBOA 4GUNA 1SQPH 2UU9O 4TUYB 3T4DA 4NVPA 1AR1B 3JASB 3E8GA 1TVKB 2UUCB 1AJPA 4HZ3A 3OT7A 5JVDA 1AILA 5IYZA 1YJ9V 3JAWB 2BE3A 1J5EB 2IU0A 4DW1A 4KHPO 3OMAB 1OJHA 2HP8A 4RUEA 4DV5B 2ZIMA 2CGNA 3ZHRA 3A8TA 3M8AA 1P4RA 2OCCB 2OCHA 4GX5A 3T1CA 3W7WA 4JGSA 4LF9O 2V4DA 1PKXA 2H3OA 1S5LZ 2YIBA 1FXKA 4X66B 4MTXA 1KD1W 5KX5A 3ABTA 4BIZA 1QLEC 3JD0A 3A0BZ 2EIKC 1GRJA 4TQDA 1N36B 3AK3A 5IYBO 1S0VA 4UV9A 4LFAO 3K5MA 2Q73A 2PGGA 1JPXA 1UFIA 5FNVA 3E35A 4ZOLA 3AEIA 1BSMA 1MABG 1M56C 4FFBB 4MVOA 4IYIA 4J7ZA 5KUMA 1VQ6V 5J2UA 4DR4O 2HFEC 3QO8A 1SS3A 4FLVA 2BTOA 4NTWA 2B1IA 4Q6GA 1SQVH 4I9WA 3ICXA 5IJ9B 1W0JG 2JS5A 2V1DA 4OXSA 1N4CA 1R3IC 2GDSA 1JOYA 3BA9A 4B3RO 1ZL8A 1XMQO 3K06A 4KXRA 2X6AA 1M57B 1EM1A 1B06A 3GVMA 1YHQV 1GN2A 1BMFG 4FLTA 2R72A 3LSSA 2HVJC 2VS0A 2LGQA 3T1HO 3AK1A 5L3CA 2CGOA 4K0KB 2JJ2G 4X20A 2AHZA 2IJJA 5IJ9A 4GZRB 3OUSA 2AZ2A 3FFQA 1YI2V 3OAAG 4U7OA 4TV8A 3RYHA 1OCOC 2F66C 5EIBC 4E2LA 4X64B 1NBMG 1XILA 2X7RB 2WAMA 5B66Z 1V55C 2BTQB 2OIGA 3BPZA 2ZDIA 4PA7A 2EINB 5TISZ 1Q82W 1N33O 3CC4V 4IIJA 3CCMV 2NN4A 4WFGA 2UXDO 1SA0B 1BS3A 4PDMA 4JI0O 3CXHF 4NKGB 3W7TA 1LUWA 4OGQB 3G6BA 1H5WA 3ZMZA 3OGIB 1FS0G 5KHGA 3G4SV 4F6EA 1OZ0A 2ADQB 3HKEA 2PI5A 2BOBC 3OE7G 4BIOA 1SZXA 4IL6Z 2X6CA 5L3DA 4MVMA 2RDCA 2LO1A 2YIAA 1WPBA 1LUVA 3UO3A 4LNUB 5IJ0B 3TK1A 1F4NA 2WLHA 5L3FA 1I0HA 3OTFA 2WLIB 2QR4A 5AG2A 5DEDA 3CC2V 1ZL8B 2OYQA 2UUAO 1EN6A 3NR7A 2DQ0A 2DJVA 4MVQA 4F6RA 2JEXA 1QR9A 3GB7C 2EJRA 5B1NA 4X88A 3T2MA 1RPRA 4P2ZA 1XREA 3IFXA 3JD3A 4YY3B 4DR6B 1K4DC 2JIZG 4DV5O 3SYAA 1IBLO 1KUQA 1H2SB 5GTIZ 2YEVB 2QKCA 1I94B 3JD1A 1M5IA 4UCOA 2HG5C 2L6LA 3CSXA 2Y4UA 1G8MA 4D7SA 2DYSC 3O9OA 1EZJA 2DMXA 1BCCH 1XNRO 2PI4A 2KG7B 4F6RB 1YTFD 4O2BB 2UXDB 2PZSA 1MNGA 2XAFA 4F4LA 3B8MA 4UCUA 5KAIZ 3ML0A 4JYAB 3RN4A 1JA8A 2WLLA 3ZMTA 4UV8A 2VQFB 1VQ7V 3OUFA 2QM8A 4MT8A 1NR7A 4JF3A 3JASA 3ABLC 1Y76B 2HVKC 4J9ZB 3E89A 4CC6A 1IVSA 2QKSA 4LWSB 3WG7B 1VF5B 3L9DA 1WJZA 5K1XA 1FFXA 3AG4C 2JGDA 2AXTZ 3W7SA 1JVMA 4WFAV 3RYCB 3K59A 3ABLB 5B1BC 3G6EV 1JR9A 5IWAO 4PV1B 4B3MO 3CRQA 4X9QA 2BCCH 4YJ3B 5J2UB 5BMVA 3CJHB 5FLXN 4EFEA 4B3RB 3JYCA 4I7ZB 3CP1A 5LXTB 2R9AA 1ZX3A 2W0XA 1K5QA 1DK1A 1B04A 1HNZO 2ZIOA 4X1KA 2N05A 1NVPB 1XL4A 3DTUB 1JJOA 4H33A 2R9RB 2N74A 5LP6C 4CH6A 2JJ1G 4FLYA 1CP9A 3P3PA 2AW9A 1AP6A 2YSUB 3MAQA 1I94O 4ZBMA 3JCZA 1G1XB 4I0XB 3SYOA 2QA4V 1EBOA 2ILMA 4R8CA 3CXCU 3HKDB 3CRMA 1YJWV 3CRAA 4JV5O 3OTOO 1HNXO 5IWAB 1I5YA 4O4HA 4PDLA 3JAKB 2ZINA 1ZAUA 2Q9LA 3FYIB 1K4CC 1D5NA 4OX9B 3SYCA 1H2LA 1OCOB 3L73H 4RWUA 3E8BA 4U3JB 1HR0B 2NLJC 2A06H 3CC7V 3JATB 1HNZB 3WB2A 4PA4A 4JI0B 3KKYA 3KG2A 4K3AA 1W59A 1S3JA 4AQYO 1KMIZ 4KHPB 3DXRB 3AG1C 3JD2A 1UPGA 4MTGA 4LC1A 3OW2U 2XAJA 3MDSA 3ZJZA 2D3OW 2YIBD 4DR5O 1IZ3A 4DV4O 1XHZA 4UCVA 1NQTA 2H94A 3U11A 3FB6C 3TXQA 4PD4F 1V9PA 4TOIA 2CH7B 2ZNIA 2ZR3A 1TA8A 1R3JC 2XASA 1PL4A 2IW5A 4YXWG 5HFMA 4LFBO 5KHJA 4JI6B 4JI1B 5EZYB 4K8ZA 4R50A 3KCXA 4ZI7B 2P67A 4AILC 4FLUA 1IBKO 1H2GA 4UVCA 3CEIA 5B3SB 1TAEA 4MVUA 4YJ3A 1YTFB 4NXNO 1K97A 3H1KH 5ITZB 4DR4B 2EILC 1SQFA 3BHPA 4RAIA 3K0DA 2LQTA 2X6BA 1AP5A 1Y67A 2P22C 1PNKA 1K8AW 3N2GA 3HB3B 3I56V 4WBNA 1OCRB 2EIMC 1N32O 3E86A 2HEPA 5EYPA 3N2KA 2F95B 3CCRV 1R3KC 4LWSA 2ARHA 3MHHC 2F93B 1WN7A 4LF7O 4UB6Z 1QLNA 4NB5A 3PJSK 3THOA 4JI6O 4AQYB 3EXAA 2ZXWB 1AVMA 5J2TA 4O4JA 3ZX6A 1MOFA 1PV0A 1X59A 1FXKC 1NJIW 3SJBC 1Q43A 4B3TB 3D36C 1KC8W 4FM2A 2ZE8A 4NTYA 1AJQA 4RQEA 5BMVB 2YI9A 4DUZO 5LOVB 2BSKA 5EYPB 1M1KW 4L8JA 4RQFA 1U97A 3QO5A 3ASOC 3N27A 3F7YC 5CA1A 5HFLA 4J11A 2RCVA 3SJCC 4OPHA 1IJGA 5EK0A 4IHJB 3L70H 2QJ1A 4O4IB 3E8HA 5CBFA 4LF7B 5KHHA 3H1IH 1N34O 2DYRB 3M7MX 2RN9A 4EB6B 2QTOA 2XUMA 4DV7B 2XAHA 3CE2A 2ZT9B 1JNBA 4ZIBA 1FPOA 4GKJB 3SYPA 1PL0A 1NU1H 3L72H 1VQ9V 3C3TA 1L0LH 2ZE5A 4PA9A 5JJJB 1UJWB 2LGWA 3IC7A 4JI2O 1YITV 4YJ2B 1F23A 4K8XA 2QM7A 2Q7GA 4PELA 2Q4PA 1R6TA 4QJFB 1YF2A 5IY5C 1K92A 3EHBB 1JCHA 4CBCA 1F7YA 2ZNJA 3E83A 5KHIA 3FAVA 2QM4A 1VQOV 4X1KB 1ZLZA 1JMKC 1RSOA 1G6UA 1GK9A 3APOA 1TGOA 2ADPA 4GX1A 3ZHSA 3K04A 3LNMB 1GM7A 4GLXA 1O9HA 2O57A 1M57C 4H0LB 4B3MB 4JTDB 4LF4B 4DRXB 3ZHTA 3E22A
chains in the Genus database with same CATH topology
3KDRA 1P7GA 1LUVA 1IXBA 2P4KA 3MDSA 4YIOA 2CE4A 4BR6A 1I0HA 2GDSA 1MMMA 5AG2A 1KKCA 1GN4A 4YIPA 2RCVA 1EN6A 1JR9A 4C7UA 4X9QA 1XDCA 3DC5A 1AR5A 1EM1A 1B06A 1GN2A 3EVKA 3BFRA 3TJTA 4GUNA 1PL4A 1XREA 1MSDA 1WB7A 3AK1A 3C3SA 3QVNA 3CEIA 1WB8A 3OT7A 2QKCA 1ZTEA 3AK2A 1XUQA 1EN4A 1EN5A 3C3TA 2AW9A 2CDYA 1AP6A 5A9GA 1AP5A 1Y67A 3DC6A 1N0NA 3K9SA 1ZUQA 1GN6A 4JYYA 1XILA 1IDSA 1AR4A 1MNGA 1VARA 1ZSPA 1I08A 4JZ2A 1MA1A 1PM9A 1BT8A 3AK3A 3RN4A 1ZLZA 1D5NA 1BS3A 1JA8A 4FFKA 2QKAA 2ADPA 1N0JA 1LUWA 1IX9A 1AVMA 1GN3A 3IC9A 4JZGA 4F6EA 3KKYA 2ADQB 4E4EA 1VEWA 1QNMA 1SZXA 1BSMA 3LSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7G A;  1LUV A;  1IXB A;  2P4K A;  3MDS A;  4YIO A;  2CE4 A;  4BR6 A;  1I0H A;  2GDS A;  1MMM A;  5AG2 A;  1KKC A;  1GN4 A;  4YIP A;  2RCV A;  1EN6 A;  1JR9 A;  4C7U A;  4X9Q A;  1XDC A;  3DC5 A;  1AR5 A;  1EM1 A;  1B06 A;  1GN2 A;  3EVK A;  3BFR A;  3TJT A;  4GUN A;  1PL4 A;  1XRE A;  1MSD A;  1WB7 A;  3AK1 A;  3C3S A;  3QVN A;  3CEI A;  1WB8 A;  3OT7 A;  2QKC A;  1ZTE A;  3AK2 A;  1XUQ A;  1EN4 A;  1EN5 A;  3C3T A;  2AW9 A;  2CDY A;  1AP6 A;  5A9G A;  1AP5 A;  1Y67 A;  3DC6 A;  1N0N A;  3K9S A;  1ZUQ A;  1GN6 A;  4JYY A;  1XIL A;  1IDS A;  1AR4 A;  1MNG A;  1VAR A;  1ZSP A;  1I08 A;  4JZ2 A;  1MA1 A;  1PM9 A;  1BT8 A;  3AK3 A;  3RN4 A;  1ZLZ A;  1D5N A;  1BS3 A;  1JA8 A;  4FFK A;  2QKA A;  2ADP A;  1N0J A;  1LUW A;  1IX9 A;  1AVM A;  1GN3 A;  3IC9 A;  4JZG A;  4F6E A;  3KKY A;  2ADQ B;  4E4E A;  1VEW A;  1QNM A;  1SZX A;  1BSM A;  3LSU A; 
#chains in the Genus database with same CATH topology
 4LFC O;  2XHB A;  2LP7 A;  1P7G A;  3EFF K;  4JI8 B;  4YIO A;  5EBL C;  1NTZ H;  1SKV A;  5LYJ A;  2ZR2 A;  3IJ4 A;  3W7X A;  5GON A;  1GN4 A;  3IGA C;  4U3J A;  4RUF A;  1NZ6 A;  1FFT B;  1PD3 A;  3SPH A;  3AG3 B;  4J10 A;  3UQ8 A;  1Q81 W;  4UVA A;  5JJE B;  3EVK A;  4DR1 O;  2JGU A;  1EZV H;  1BQZ A;  1RM1 C;  5H5N A;  1FJG O;  3B8N A;  2WLI A;  4JTC B;  4MTF A;  4QNH B;  1HDJ A;  1IBM O;  1GO3 F;  4JV5 B;  4MW3 A;  1WB8 A;  1YZB A;  4FVM A;  4DV0 O;  3T4Z A;  1P49 A;  2UXN A;  4X65 B;  4JI3 B;  4DV6 O;  2CH7 A;  4GT1 A;  1THZ A;  5KLV H;  3CCL V;  2W6I G;  5LL6 Y;  4R6Z A;  5GTH Z;  3J7A U;  5DN6 G;  5LMN B;  3F5T A;  4WFH A;  1S5J A;  1WLE A;  4JYY A;  2YXY A;  4UVB A;  2BTQ A;  5CA0 A;  2PY5 A;  4FK5 C;  1IDS A;  3N2K B;  1AR4 A;  1DLB A;  1VAR A;  2RJZ A;  5BZB A;  1XNR B;  1H8H G;  1URF A;  3HKE B;  1AI4 A;  4AHC A;  2P6J A;  2IH3 C;  1K7D A;  4OPA A;  4JZ2 A;  4LF8 B;  1CPY A;  5JH7 B;  4ZHQ A;  1GTO A;  5L3G A;  2ZE7 A;  3LDE A;  1IX9 A;  3RYI B;  2WLJ A;  5IDJ A;  1SF9 A;  1H38 A;  4ZI7 A;  1YCI A;  2QWR B;  4I55 A;  2R9I A;  4J7K A;  4LBE C;  4JAU A;  1QQC A;  2Z5U A;  5KUK A;  1I5X A;  1YDX A;  4QPJ A;  4BWA A;  4K0K O;  1Y6X A;  3UT5 A;  1Q6U A;  5CA1 B;  3WB1 A;  2EZP A;  2ZE6 A;  2ZM6 O;  4ZKI A;  4HBN A;  1MMM A;  4JI8 O;  4LF6 O;  1N32 B;  4DXW A;  4UB8 Z;  1FD9 A;  2IU3 A;  4JI5 O;  2YC0 A;  3SJQ C;  5KX5 B;  2A7W A;  1VF7 A;  2GV9 A;  4UUJ C;  3ZMS A;  3FB5 C;  5DM6 V;  3UCS C;  4KL1 A;  3RBZ A;  1LR1 A;  1VQ8 V;  1Z5W A;  5LYJ B;  4TUY A;  1MSD A;  2QWQ B;  1OCC B;  3GWK C;  2VQE B;  3SGI A;  1GAX A;  5IYZ B;  3OMN B;  4JI7 B;  4GKK O;  1KYO F;  2A79 B;  4FMT A;  3VQX A;  2JVD A;  1XUQ A;  3FX7 A;  2XAG A;  4NYK A;  1JFF B;  1FXH A;  3JAR B;  3G71 V;  2Q0O C;  3RW0 A;  2N04 A;  4N23 A;  4DV6 B;  3JAL B;  1OCC C;  3K9S A;  3CCV V;  1WPX A;  3ZRW B;  5C8Y A;  3VQW A;  5GW7 A;  3LNN A;  3LDC A;  2Y48 A;  1KU9 A;  4LCU C;  4KUM A;  1NTK H;  1PM9 A;  3J80 N;  3PN1 A;  2AZ0 A;  1VQK V;  5K1P A;  1MZE A;  1SER A;  2E5L O;  4CH5 A;  1D5A A;  2IM9 A;  2CTR A;  1GH6 A;  1NVP D;  1TUB B;  5FPR A;  2JEU A;  5E79 Z;  2ZDI C;  4OX9 O;  4DR7 B;  3C90 A;  2WA4 A;  1S5H C;  1YIJ V;  1XNQ O;  2Q6A A;  2VWJ A;  5IT9 N;  5CA3 A;  1XHX A;  2YXH A;  3ETQ A;  4ABM A;  4CS4 A;  3UKM A;  5C8Y B;  3H01 A;  1R3L C;  2EIK B;  2ZM6 B;  2YI8 A;  2A9H A;  4MVR A;  3K3W A;  4DK1 A;  5BR8 O;  5LGN A;  4X1Y A;  4BR6 A;  1VF6 A;  2GTS A;  5LP6 B;  3UO2 A;  4K35 A;  2YIC A;  3QTC A;  2GUZ A;  1JJ2 U;  1XMO B;  1S72 V;  4P30 A;  5C93 A;  1SQQ H;  4LF5 B;  1XQ8 A;  1SQX H;  4LH6 A;  4WFB V;  2UXB O;  4IGG A;  3K0G A;  2OTL V;  2E74 B;  3ZIA G;  4DV2 B;  4B3S O;  5A2Q N;  2UUC O;  1M56 B;  4AI8 A;  3WU2 Z;  2OT5 A;  3K08 A;  4GKK B;  4DR5 B;  1H8E G;  3NXS A;  5D5P A;  1NI8 A;  5ITZ A;  3ZHU A;  1XL6 A;  1HW7 A;  3MD0 A;  1XBL A;  4LF4 O;  2PF4 E;  4G2K A;  3CRC A;  5BY1 A;  1EN5 A;  4O4J B;  4DV3 O;  1Y76 A;  3B4S A;  2HR3 A;  2MK3 A;  1Y74 B;  2HJF C;  3BEH A;  3L75 H;  1FXK B;  3LDD A;  3HKB A;  3I55 V;  1KQS U;  1R6K A;  1ZSP A;  4LFC B;  4I55 B;  2EZO A;  2IH1 C;  5LMU O;  4O4L A;  3ASN B;  3SR2 C;  2OWO A;  3ZRX A;  2YXL A;  4CS2 A;  4FLW A;  1VQN V;  1BT8 A;  2V7Q G;  2QKA A;  2Q5Z A;  5LHH A;  2YEV A;  2F4V O;  4WFF A;  1FJG B;  2HJD A;  4MS2 A;  4J80 A;  2XND G;  3R65 A;  3OEE G;  4W4L A;  2AHY A;  3CPW U;  2W0F C;  4GX0 A;  1GM9 A;  3ZHV A;  5CA0 B;  5LA6 B;  2ZD9 A;  1BQ0 A;  4JYB A;  1FXV A;  4ASU G;  5EBW C;  4QE9 A;  1KP2 A;  4U7N A;  2CE4 A;  4Z2W A;  1XMO O;  2Y69 B;  4FLZ A;  2UUB O;  2W6J G;  2XOK G;  5EBM C;  1J5E O;  2WLN A;  3ZCC A;  3OTO B;  4JAV A;  1HNX B;  3SYQ A;  3E8F A;  3QO7 A;  3VQV A;  1K34 A;  2QWO B;  1NH2 D;  3DSQ A;  1OCR C;  3STZ C;  2VQE O;  1HR0 O;  2FL4 A;  1VIB A;  3G67 A;  1ROP A;  5IYD O;  5EC2 C;  3BVO A;  4PJ0 Z;  3OEH G;  3CHX A;  4DYL A;  3ZRW A;  1VF6 C;  4B7E A;  3ZS8 C;  1LNQ A;  4UCS A;  4B7K A;  1Y66 A;  2OTJ V;  4D7T A;  5JCO A;  2B9Z A;  2X0L A;  1KBH A;  5KHK A;  1K3E A;  4EB6 A;  5LGU A;  3AG7 A;  4TV9 B;  2HKO A;  2RQ6 A;  4TT3 G;  2DW4 A;  2K1E A;  4A5U B;  3CJH A;  2VWK A;  4IT5 A;  5JQG B;  4LF6 B;  3H1J H;  3RWR D;  1HNW B;  4I50 A;  3CMA V;  3U10 A;  2HHH O;  1CEZ A;  4FLX A;  4TV8 B;  3RYH B;  4X62 O;  3F5W C;  3HKB B;  3CD6 V;  3IC9 A;  2RMK B;  2H8P C;  1NKD A;  4X1Y B;  2RNB A;  1P84 F;  1GMG A;  4O2A A;  2B5U A;  2EBO A;  1OV9 A;  3HKC B;  3E2E A;  1FOU A;  3ABM C;  4LNU A;  4HNA B;  3CS5 A;  3ASO B;  3CCS V;  4J9Y B;  5LOV A;  1ARO P;  2UXX A;  4H44 B;  1K5S A;  2Q67 A;  1QHT A;  4DUZ B;  2QDO A;  4FZ0 A;  1NS1 A;  1H2M A;  4X89 A;  1IXM A;  3CCJ V;  2P4V A;  3L74 H;  4D6T H;  1SES A;  2E3C A;  2EIN C;  1V55 B;  5LXT A;  1Q6H A;  2MW2 B;  4O2A B;  2JRI A;  1WB7 A;  4LF5 O;  1AI7 A;  2E76 B;  1Q3E A;  1QBZ A;  3DXR A;  4B3S B;  1N33 B;  5IE9 A;  4UXN A;  1KKD A;  3BRC A;  4YHH O;  1KEC A;  4I4T A;  1A32 A;  2CDY A;  2B1G A;  3ABK C;  3L71 H;  4FM0 A;  4DR2 O;  1OCZ C;  4DR1 B;  1WP7 A;  3AG2 C;  4X1I B;  3APQ A;  1X4T A;  1GN6 A;  3A2F A;  4JAA A;  4DV3 B;  1PNL A;  2DQ3 A;  1K33 A;  2BSK B;  4O4H B;  4MSW C;  4LR3 A;  4MVS A;  4B08 A;  4WF9 V;  3RYF A;  1PPJ H;  1R6N A;  2KKW A;  2Y0I A;  1ENV A;  4X65 O;  2WLK A;  5EIB D;  1IUR A;  1N8R W;  1O9G A;  4DV1 B;  4IYH A;  2IJH A;  2M7W A;  3JSL A;  1N0J A;  3OD4 A;  5LGT A;  3BA8 A;  4U3F H;  3RT3 C;  1P7B A;  3K57 A;  1DGS A;  2A0L A;  4PHZ A;  1S77 D;  4E4E A;  2A3Q A;  3ZN0 A;  3RYF B;  2ATK C;  5JJN B;  1JQ0 A;  2Q7E A;  2CUG A;  4GKJ O;  4DO2 A;  1COW G;  3KDR A;  5JH7 A;  4CS3 A;  1MZF A;  4XDJ A;  4O4I A;  4R7C A;  3BY6 A;  3LUT B;  1BGY H;  1L8D A;  4EEQ A;  1QU7 A;  3QNE A;  4MTO A;  3D3I A;  2P90 A;  4H37 A;  5LMU B;  1WAZ A;  4FM1 A;  1VQL V;  1M9N A;  1Q6I A;  3QVN A;  1NR1 A;  5H6R A;  1TUB A;  2DYR C;  2JDI G;  3ETG A;  4NXM B;  2FTK A;  1VQM V;  3JSN A;  5B3S C;  3FAV B;  4FZ1 A;  2K9P A;  4Q20 A;  5BR8 B;  3KZI Z;  2FYU H;  3F7V C;  4WFE A;  1BZK A;  1RFY A;  5H9C A;  4YHH B;  2F4V B;  4RO2 A;  4TQF A;  3OGC C;  2WLL B;  3HR0 A;  3Q4H A;  4JI1 O;  1QCE A;  4Z1V A;  1S76 D;  1W0K G;  4JYA O;  1AB3 A;  4CH4 A;  3RYI A;  3CX5 F;  2Z0A A;  3AG1 B;  2QWP B;  4XBF A;  4DR3 B;  2ODM A;  1H2N A;  1JFF A;  4PI2 A;  3FB7 C;  4FFK A;  3N2G B;  3JAL A;  1HP8 A;  5B1B B;  1R1B A;  5CBG A;  1K9M W;  1RPO A;  1WNS A;  2EIJ B;  2QSA A;  1XOU A;  2PTM A;  4ZOL B;  4DV1 O;  3O65 A;  2LW7 A;  3S3X A;  1YSC A;  4IIJ B;  3P30 A;  4TV9 A;  4DV0 B;  5KA5 A;  4MVZ A;  1BHA A;  1EFR G;  5H2F Z;  1QR8 A;  4FFB A;  3ZRS A;  5D5Q A;  2Q68 A;  4DW0 A;  2IJK A;  4LP8 A;  1Y74 A;  4HAM A;  1SET A;  1VQP V;  2Q8V A;  3P3N A;  1XMQ B;  1SQG A;  4I9Q A;  4I0X A;  1KKC A;  1NH2 B;  4WCE V;  4YIP A;  2BOC C;  3CCE V;  3DGE A;  3CWB H;  5IYC O;  3HKC A;  1E79 G;  3HKD A;  2P06 A;  1E1R G;  4LFB B;  4DV4 B;  4PI0 A;  3B40 A;  3BFR A;  5H6Q A;  3SPG A;  1YJN V;  3K9A A;  2KB1 A;  2HHH B;  1BL8 A;  4UCT A;  3UM7 A;  1VMG A;  2DYS B;  2CK3 G;  3K03 A;  5CB4 B;  2WWW A;  1N34 B;  5DEC A;  3VOU A;  4WBN B;  2DWD C;  3WB0 A;  1VQ5 V;  4XDL A;  5L3E A;  2FKX A;  2FB5 A;  3JAM N;  5B1O A;  1ZTE A;  1IBK B;  5LP6 A;  4GYC B;  3OR6 C;  3K79 A;  4Z1M G;  1N0N A;  4DV2 O;  2GUZ B;  5LBQ A;  1K73 W;  4BW5 A;  1V54 C;  2Y0P A;  2FML A;  3SPC A;  4O4L B;  1FFX B;  1J95 A;  4J42 A;  4JI5 B;  3RYC A;  2P7T C;  1RSO B;  2EIL B;  4DUY O;  3WFV A;  2OCC C;  4DR3 O;  3TXS A;  2CTQ A;  1NT2 B;  1RP3 B;  1IBL B;  3A0R A;  5EZY A;  1QLE B;  4JI7 O;  1HWY A;  3H1H H;  3LSU A;  4N21 A;  3D3Q A;  4J7J A;  1E1Q G;  4JI4 O;  2WLM A;  2QWN B;  1ORQ C;  2Z3Y A;  3K5L A;  2F1M A;  3D8C A;  5LHG A;  5CMU A;  5L3B A;  2ZXW C;  3B77 A;  2OIE A;  4X1I A;  4L87 A;  2WSS G;  4P9P A;  2QEX V;  3ZMU A;  1TUE B;  1FYJ A;  1BE3 H;  2P5O A;  2F23 A;  2ZCE A;  4DR2 B;  2G38 A;  2DE0 X;  3FKS G;  4CZZ A;  2DOS A;  1M90 W;  4G28 B;  3JAK A;  3JAR A;  5GON B;  5E1A C;  3ABM B;  3P32 A;  3ETE A;  4CH3 A;  3CME V;  1Q5O A;  5BXZ A;  3ZED A;  2UXC O;  3BAA A;  5EC1 C;  2EJ7 A;  5CN0 A;  3KCY A;  4QE7 A;  5KMG B;  4DR7 O;  3TGU H;  3AK2 A;  2PYJ A;  3SJA C;  4J41 A;  1WA8 B;  2EIM B;  2CAZ C;  4QGP A;  4KP4 A;  1Z5V A;  4NTX A;  1ZUQ A;  3ZHQ A;  2UU9 B;  2VRZ A;  4O2B A;  2M6Y A;  4HNA A;  4JI2 B;  5B1A C;  2E75 B;  3BAB A;  5F2V O;  1SC5 B;  1YVW A;  1F4M A;  3M99 B;  3OM3 B;  4PA3 A;  4P9O A;  5IJ0 A;  2HLD G;  2UXC B;  1HNW O;  4FIP C;  4JZG A;  1D2D A;  1M93 A;  1V54 B;  1FAF A;  1B6Q A;  4XDK A;  1VEW A;  1QVG U;  1QNM A;  5FL7 G;  1Q7Y W;  4NR1 A;  1L0N H;  1XEQ A;  2Q0A A;  1RM1 B;  1IXB A;  4TSF G;  4EKW A;  2EX3 A;  3JAT A;  1W2B U;  1U96 A;  5FPO A;  3JD4 A;  4HYO A;  3OR7 C;  3FD9 A;  5CB4 A;  3Q4H B;  3CB2 A;  2GHY A;  3AG4 B;  4GCZ A;  2JS3 A;  4QIW F;  2GSM B;  3RGB A;  4PDV A;  1FKA O;  2CTP A;  3CCU V;  5FNV B;  4DK0 A;  2Y4T A;  1AI5 A;  5IY5 B;  3ZN1 A;  4H13 B;  2WA3 A;  1DF4 A;  3GWO A;  1OHH G;  3AG2 B;  2XT9 A;  4PA6 A;  1KP3 A;  2NR5 A;  1WP8 A;  3CRR A;  4JI3 O;  4TWK A;  1F51 A;  1H2K A;  2ITC C;  2Y69 C;  4G27 B;  2KG7 A;  2EUL A;  3B09 A;  3X2Q B;  2LJ2 A;  2ITD C;  5J2T B;  1SRY A;  1EN4 A;  2IBZ H;  1MSW D;  3AG3 C;  3K5O A;  4I5S A;  2XAQ A;  3UT5 B;  2VQF O;  5A9G A;  3QG5 A;  2YID A;  2QTS A;  4FPP A;  3ZMV A;  2LFS A;  3IAY A;  4EFB A;  1JX9 A;  2PYL A;  4LF9 B;  2UUB B;  2GTA A;  3OMI B;  2YUA A;  5JWP A;  3FYE B;  1I08 A;  5KAF Z;  3T1Y B;  4I50 B;  2DWE C;  3CYO A;  1MA1 A;  1BHB A;  4UFZ A;  1R73 A;  2LW1 A;  3QF7 A;  2QE7 G;  2C2A A;  3E22 B;  4PDR A;  4ZHQ B;  1Y4M A;  3ZRV A;  1N36 O;  1GN3 A;  3HPL C;  3ETD A;  4MW8 A;  4LFA B;  2XTA A;  5LHI A;  1NTM H;  3H1L H;  3SPI A;  2D2C B;  3SPJ A;  4LH7 A;  1GM8 A;  3ASN C;  4NXM O;  1VQ4 V;  2ETN A;  2Q7H A;  3I5D A;  3U0Z A;  3LSQ A;  1PNM A;  3FB8 C;  1IBM B;  3VBB A;  3RFR A;  4X64 O;  2E5L B;  4JAS A;  5B5E Z;  1Q90 D;  1DF5 A;  2NNU A;  1Z2G A;  2R70 A;  1PP9 H;  2WPD G;  2YS8 A;  2JK5 C;  3ABK B;  4YJ2 A;  3T1Y O;  2IJI A;  1OCZ B;  1XNQ B;  5JCO C;  1XDC A;  3T1H B;  3DC5 A;  1AR5 A;  3B2E E;  3VQY A;  3TJT A;  3WG7 C;  4DUY B;  3C3S A;  4X62 B;  4GX2 A;  1ZWI C;  1I7F A;  5KMG A;  2UXB B;  1KB9 F;  5LA6 A;  2DN9 A;  1MG1 A;  4IHJ A;  3ABU A;  1T5E A;  3H9V A;  5LMN O;  2UUA B;  4I4T B;  1Q8I A;  4X66 O;  4W4K A;  4JI4 B;  3D36 A;  3DC6 A;  4DRX A;  4KFM A;  3OFN G;  4BW9 A;  4CC5 A;  3BCC H;  2AGA A;  2EIJ C;  4X20 B;  3JCU Z;  4LF8 O;  4UCR A;  1G4Y B;  2JGD B;  4QPK A;  4YY3 O;  3X2Q C;  4JYC A;  3TCU A;  5KA6 A;  3J81 N;  2KSD A;  3ZBH A;  1VP7 A;  1AJN A;  4X8A A;  3RVY A;  3TET A;  1CXZ B;  4ICG A;  3MHS C;  1DTO A;  4BIU A;  5B1A B;  2PUS A;  1WA8 A;  2LFR A;  2F43 G;  4B3T O;  1GKF A;  3G80 A;  2YDE A;  2ZQM A;  3CCQ V;  1XI1 A;  3A0H Z;  1YXB A;  1TVK A;  3R66 A;  4JPR A;  1SA0 A;  2QGN A;  2KQX A;  4BAY A;  1SZT A;  2P4K A;  1M4U A;  3JAW A;  3S3W A;  4JTA B;  2ZKO A;  1L1F A;  1Q86 W;  3SDL A;  1YEW A;  4NXN B;  3RVZ A;  5CBH A;  3K58 A;  4FJC C;  5JVD B;  4C7U A;  1AI6 A;  2Q69 A;  5JQG A;  1SQB H;  2L35 A;  1US6 A;  2CTW A;  3STL C;  4DV7 O;  3W7U A;  5J9P C;  3K5N A;  1B3Q A;  4DR6 O;  1QVF U;  2GBO A;  4GUN A;  1SQP H;  2UU9 O;  4TUY B;  3T4D A;  4NVP A;  1AR1 B;  3JAS B;  3E8G A;  1TVK B;  2UUC B;  1AJP A;  4HZ3 A;  3OT7 A;  5JVD A;  1AIL A;  5IYZ A;  1YJ9 V;  3JAW B;  2BE3 A;  1J5E B;  2IU0 A;  4DW1 A;  4KHP O;  3OMA B;  1OJH A;  2HP8 A;  4RUE A;  4DV5 B;  2ZIM A;  2CGN A;  3ZHR A;  3A8T A;  3M8A A;  1P4R A;  2OCC B;  2OCH A;  4GX5 A;  3T1C A;  3W7W A;  4JGS A;  4LF9 O;  2V4D A;  1PKX A;  2H3O A;  1S5L Z;  2YIB A;  1FXK A;  4X66 B;  4MTX A;  1KD1 W;  5KX5 A;  3ABT A;  4BIZ A;  1QLE C;  3JD0 A;  3A0B Z;  2EIK C;  1GRJ A;  4TQD A;  1N36 B;  3AK3 A;  5IYB O;  1S0V A;  4UV9 A;  4LFA O;  3K5M A;  2Q73 A;  2PGG A;  1JPX A;  1UFI A;  5FNV A;  3E35 A;  4ZOL A;  3AEI A;  1BSM A;  1MAB G;  1M56 C;  4FFB B;  4MVO A;  4IYI A;  4J7Z A;  5KUM A;  1VQ6 V;  5J2U A;  4DR4 O;  2HFE C;  3QO8 A;  1SS3 A;  4FLV A;  2BTO A;  4NTW A;  2B1I A;  4Q6G A;  1SQV H;  4I9W A;  3ICX A;  5IJ9 B;  1W0J G;  2JS5 A;  2V1D A;  4OXS A;  1N4C A;  1R3I C;  2GDS A;  1JOY A;  3BA9 A;  4B3R O;  1ZL8 A;  1XMQ O;  3K06 A;  4KXR A;  2X6A A;  1M57 B;  1EM1 A;  1B06 A;  3GVM A;  1YHQ V;  1GN2 A;  1BMF G;  4FLT A;  2R72 A;  3LSS A;  2HVJ C;  2VS0 A;  2LGQ A;  3T1H O;  3AK1 A;  5L3C A;  2CGO A;  4K0K B;  2JJ2 G;  4X20 A;  2AHZ A;  2IJJ A;  5IJ9 A;  4GZR B;  3OUS A;  2AZ2 A;  3FFQ A;  1YI2 V;  3OAA G;  4U7O A;  4TV8 A;  3RYH A;  1OCO C;  2F66 C;  5EIB C;  4E2L A;  4X64 B;  1NBM G;  1XIL A;  2X7R B;  2WAM A;  5B66 Z;  1V55 C;  2BTQ B;  2OIG A;  3BPZ A;  2ZDI A;  4PA7 A;  2EIN B;  5TIS Z;  1Q82 W;  1N33 O;  3CC4 V;  4IIJ A;  3CCM V;  2NN4 A;  4WFG A;  2UXD O;  1SA0 B;  1BS3 A;  4PDM A;  4JI0 O;  3CXH F;  4NKG B;  3W7T A;  1LUW A;  4OGQ B;  3G6B A;  1H5W A;  3ZMZ A;  3OGI B;  1FS0 G;  5KHG A;  3G4S V;  4F6E A;  1OZ0 A;  2ADQ B;  3HKE A;  2PI5 A;  2BOB C;  3OE7 G;  4BIO A;  1SZX A;  4IL6 Z;  2X6C A;  5L3D A;  4MVM A;  2RDC A;  2LO1 A;  2YIA A;  1WPB A;  1LUV A;  3UO3 A;  4LNU B;  5IJ0 B;  3TK1 A;  1F4N A;  2WLH A;  5L3F A;  1I0H A;  3OTF A;  2WLI B;  2QR4 A;  5AG2 A;  5DED A;  3CC2 V;  1ZL8 B;  2OYQ A;  2UUA O;  1EN6 A;  3NR7 A;  2DQ0 A;  2DJV A;  4MVQ A;  4F6R A;  2JEX A;  1QR9 A;  3GB7 C;  2EJR A;  5B1N A;  4X88 A;  3T2M A;  1RPR A;  4P2Z A;  1XRE A;  3IFX A;  3JD3 A;  4YY3 B;  4DR6 B;  1K4D C;  2JIZ G;  4DV5 O;  3SYA A;  1IBL O;  1KUQ A;  1H2S B;  5GTI Z;  2YEV B;  2QKC A;  1I94 B;  3JD1 A;  1M5I A;  4UCO A;  2HG5 C;  2L6L A;  3CSX A;  2Y4U A;  1G8M A;  4D7S A;  2DYS C;  3O9O A;  1EZJ A;  2DMX A;  1BCC H;  1XNR O;  2PI4 A;  2KG7 B;  4F6R B;  1YTF D;  4O2B B;  2UXD B;  2PZS A;  1MNG A;  2XAF A;  4F4L A;  3B8M A;  4UCU A;  5KAI Z;  3ML0 A;  4JYA B;  3RN4 A;  1JA8 A;  2WLL A;  3ZMT A;  4UV8 A;  2VQF B;  1VQ7 V;  3OUF A;  2QM8 A;  4MT8 A;  1NR7 A;  4JF3 A;  3JAS A;  3ABL C;  1Y76 B;  2HVK C;  4J9Z B;  3E89 A;  4CC6 A;  1IVS A;  2QKS A;  4LWS B;  3WG7 B;  1VF5 B;  3L9D A;  1WJZ A;  5K1X A;  1FFX A;  3AG4 C;  2JGD A;  2AXT Z;  3W7S A;  1JVM A;  4WFA V;  3RYC B;  3K59 A;  3ABL B;  5B1B C;  3G6E V;  1JR9 A;  5IWA O;  4PV1 B;  4B3M O;  3CRQ A;  4X9Q A;  2BCC H;  4YJ3 B;  5J2U B;  5BMV A;  3CJH B;  5FLX N;  4EFE A;  4B3R B;  3JYC A;  4I7Z B;  3CP1 A;  5LXT B;  2R9A A;  1ZX3 A;  2W0X A;  1K5Q A;  1DK1 A;  1B04 A;  1HNZ O;  2ZIO A;  4X1K A;  2N05 A;  1NVP B;  1XL4 A;  3DTU B;  1JJO A;  4H33 A;  2R9R B;  2N74 A;  5LP6 C;  4CH6 A;  2JJ1 G;  4FLY A;  1CP9 A;  3P3P A;  2AW9 A;  1AP6 A;  2YSU B;  3MAQ A;  1I94 O;  4ZBM A;  3JCZ A;  1G1X B;  4I0X B;  3SYO A;  2QA4 V;  1EBO A;  2ILM A;  4R8C A;  3CXC U;  3HKD B;  3CRM A;  1YJW V;  3CRA A;  4JV5 O;  3OTO O;  1HNX O;  5IWA B;  1I5Y A;  4O4H A;  4PDL A;  3JAK B;  2ZIN A;  1ZAU A;  2Q9L A;  3FYI B;  1K4C C;  1D5N A;  4OX9 B;  3SYC A;  1H2L A;  1OCO B;  3L73 H;  4RWU A;  3E8B A;  4U3J B;  1HR0 B;  2NLJ C;  2A06 H;  3CC7 V;  3JAT B;  1HNZ B;  3WB2 A;  4PA4 A;  4JI0 B;  3KKY A;  3KG2 A;  4K3A A;  1W59 A;  1S3J A;  4AQY O;  1KMI Z;  4KHP B;  3DXR B;  3AG1 C;  3JD2 A;  1UPG A;  4MTG A;  4LC1 A;  3OW2 U;  2XAJ A;  3MDS A;  3ZJZ A;  2D3O W;  2YIB D;  4DR5 O;  1IZ3 A;  4DV4 O;  1XHZ A;  4UCV A;  1NQT A;  2H94 A;  3U11 A;  3FB6 C;  3TXQ A;  4PD4 F;  1V9P A;  4TOI A;  2CH7 B;  2ZNI A;  2ZR3 A;  1TA8 A;  1R3J C;  2XAS A;  1PL4 A;  2IW5 A;  4YXW G;  5HFM A;  4LFB O;  5KHJ A;  4JI6 B;  4JI1 B;  5EZY B;  4K8Z A;  4R50 A;  3KCX A;  4ZI7 B;  2P67 A;  4AIL C;  4FLU A;  1IBK O;  1H2G A;  4UVC A;  3CEI A;  5B3S B;  1TAE A;  4MVU A;  4YJ3 A;  1YTF B;  4NXN O;  1K97 A;  3H1K H;  5ITZ B;  4DR4 B;  2EIL C;  1SQF A;  3BHP A;  4RAI A;  3K0D A;  2LQT A;  2X6B A;  1AP5 A;  1Y67 A;  2P22 C;  1PNK A;  1K8A W;  3N2G A;  3HB3 B;  3I56 V;  4WBN A;  1OCR B;  2EIM C;  1N32 O;  3E86 A;  2HEP A;  5EYP A;  3N2K A;  2F95 B;  3CCR V;  1R3K C;  4LWS A;  2ARH A;  3MHH C;  2F93 B;  1WN7 A;  4LF7 O;  4UB6 Z;  1QLN A;  4NB5 A;  3PJS K;  3THO A;  4JI6 O;  4AQY B;  3EXA A;  2ZXW B;  1AVM A;  5J2T A;  4O4J A;  3ZX6 A;  1MOF A;  1PV0 A;  1X59 A;  1FXK C;  1NJI W;  3SJB C;  1Q43 A;  4B3T B;  3D36 C;  1KC8 W;  4FM2 A;  2ZE8 A;  4NTY A;  1AJQ A;  4RQE A;  5BMV B;  2YI9 A;  4DUZ O;  5LOV B;  2BSK A;  5EYP B;  1M1K W;  4L8J A;  4RQF A;  1U97 A;  3QO5 A;  3ASO C;  3N27 A;  3F7Y C;  5CA1 A;  5HFL A;  4J11 A;  2RCV A;  3SJC C;  4OPH A;  1IJG A;  5EK0 A;  4IHJ B;  3L70 H;  2QJ1 A;  4O4I B;  3E8H A;  5CBF A;  4LF7 B;  5KHH A;  3H1I H;  1N34 O;  2DYR B;  3M7M X;  2RN9 A;  4EB6 B;  2QTO A;  2XUM A;  4DV7 B;  2XAH A;  3CE2 A;  2ZT9 B;  1JNB A;  4ZIB A;  1FPO A;  4GKJ B;  3SYP A;  1PL0 A;  1NU1 H;  3L72 H;  1VQ9 V;  3C3T A;  1L0L H;  2ZE5 A;  4PA9 A;  5JJJ B;  1UJW B;  2LGW A;  3IC7 A;  4JI2 O;  1YIT V;  4YJ2 B;  1F23 A;  4K8X A;  2QM7 A;  2Q7G A;  4PEL A;  2Q4P A;  1R6T A;  4QJF B;  1YF2 A;  5IY5 C;  1K92 A;  3EHB B;  1JCH A;  4CBC A;  1F7Y A;  2ZNJ A;  3E83 A;  5KHI A;  3FAV A;  2QM4 A;  1VQO V;  4X1K B;  1ZLZ A;  1JMK C;  1RSO A;  1G6U A;  1GK9 A;  3APO A;  1TGO A;  2ADP A;  4GX1 A;  3ZHS A;  3K04 A;  3LNM B;  1GM7 A;  4GLX A;  1O9H A;  2O57 A;  1M57 C;  4H0L B;  4B3M B;  4JTD B;  4LF4 B;  4DRX B;  3ZHT A;  3E22 A; 
#chains in the Genus database with same CATH homology
 3KDR A;  1P7G A;  1LUV A;  1IXB A;  2P4K A;  3MDS A;  4YIO A;  2CE4 A;  4BR6 A;  1I0H A;  2GDS A;  1MMM A;  5AG2 A;  1KKC A;  1GN4 A;  4YIP A;  2RCV A;  1EN6 A;  1JR9 A;  4C7U A;  4X9Q A;  1XDC A;  3DC5 A;  1AR5 A;  1EM1 A;  1B06 A;  1GN2 A;  3EVK A;  3BFR A;  3TJT A;  4GUN A;  1PL4 A;  1XRE A;  1MSD A;  1WB7 A;  3AK1 A;  3C3S A;  3QVN A;  3CEI A;  1WB8 A;  3OT7 A;  2QKC A;  1ZTE A;  3AK2 A;  1XUQ A;  1EN4 A;  1EN5 A;  3C3T A;  2AW9 A;  2CDY A;  1AP6 A;  5A9G A;  1AP5 A;  1Y67 A;  3DC6 A;  1N0N A;  3K9S A;  1ZUQ A;  1GN6 A;  4JYY A;  1XIL A;  1IDS A;  1AR4 A;  1MNG A;  1VAR A;  1ZSP A;  1I08 A;  4JZ2 A;  1MA1 A;  1PM9 A;  1BT8 A;  3AK3 A;  3RN4 A;  1ZLZ A;  1D5N A;  1BS3 A;  1JA8 A;  4FFK A;  2QKA A;  2ADP A;  1N0J A;  1LUW A;  1IX9 A;  1AVM A;  1GN3 A;  3IC9 A;  4JZG A;  4F6E A;  3KKY A;  2ADQ B;  4E4E A;  1VEW A;  1QNM A;  1SZX A;  1BSM A;  3LSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...