1N0JA

The structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title The Structure of Human Mitochondrial Mn3+ Superoxide Dismutase Reveals a Novel Tetrameric Interface of Two 4-Helix Bundles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1n0jA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1n0jA02
2CE4A 4YIOA 1AR4A 2ADQB 3TJTA 1XILA 4BR6A 1LUWA 1D5NA 1XUQA 1IXBA 1I08A 4JZ2A 1I0HA 1B06A 1MNGA 1JA8A 1XDCA 3OT7A 3AK3A 1N0NA 1GN3A 1GN6A 4JZGA 3K9SA 4YIPA 1AP6A 1EN6A 1VEWA 4F6EA 3AK1A 5AG2A 3EVKA 1AP5A 1BT8A 1PM9A 1BS3A 1Y67A 3CEIA 1VARA 4E4EA 3DC6A 1JR9A 1KKCA 1XREA 2RCVA 3BFRA 3KKYA 2ADPA 2GDSA 1ZSPA 1ZUQA 1N0JA 1GN4A 1AVMA 2AW9A 4JYYA 4GUNA 1PL4A 1WB7A 1AR5A 1EN4A 1EM1A 3MDSA 1MSDA 2QKAA 1P7GA 5A9GA 1ZLZA 1IX9A 2CDYA 1EN5A 1QNMA 1IDSA 1MA1A 4C7UA 2QKCA 1GN2A 1SZXA 3RN4A 1WB8A 3QVNA 3DC5A 3C3TA 3LSUA 3AK2A 1LUVA 1MMMA 3C3SA 4FFKA 3IC9A 1BSMA 1ZTEA 4X9QA 2P4KA
chains in the Genus database with same CATH superfamily
1BL8A 2EZOA 2BTQB 1W59A 3TJTA 5L3DA 3ABKB 3BA8A 5KX5B 4J9YB 2Q0AA 2EILB 2ITDC 3ETQA 4MW3A 2R9AA 2UUCB 2DMXA 2IJIA 1I0HA 2KQXA 3BRCA 1IBLO 3S3WA 1ENVA 3FX7A 3AK3A 2XHBA 1LNQA 4LF9O 1QLNA 3RYIB 2A9HA 4PA3A 4LF5B 3ABLB 1HW7A 1E79G 5LMNB 1SESA 1VEWA 4TV8B 4F6EA 5AG2A 2JS5A 5EZYA 2QWNB 4FPPA 4KFMA 5LL6Y 3ZN1A 4J7KA 3WG7C 1IVSA 1NS1A 4ZI7A 1KKCA 1K3EA 2F43G 3H9VA 1FFXA 1WN7A 2RCVA 4I50B 1SQGA 2LP7A 4UCUA 2BOCC 2EJRA 4I0XB 1BHBA 4BWAA 1TAEA 4JYBA 2ZNIA 5JQGB 2GDSA 3FAVA 1Q81W 1XHXA 2EIMC 1XNQO 1GK9A 1NR7A 1V9PA 4WFGA 4GUNA 2UXCB 1Q6IA 1EM1A 1QQCA 1YVWA 2FTKA 1TUBA 3LDEA 3OAAG 3NR7A 5IY5B 2BE3A 1NH2B 5B3SB 2UU9B 4KP4A 1IXMA 1OZ0A 1GN2A 1NU1H 2HFEC 3K0GA 3JYCA 4FIPC 3HKEA 5EK0A 1JPXA 1NI8A 1SQQH 3HKBB 4YJ3A 1DK1A 5IDJA 4J42A 4LF4O 2QJ1A 2V1DA 1XMOB 2LW1A 1FXKB 5ITZA 5HFLA 4P9PA 5LHIA 2A0LA 3B40A 4PA7A 3SPHA 1AR4A 5EIBC 2WLNA 1F4MA 2YXYA 2XAGA 4D7SA 2O57A 1IXBA 3JASA 4JZ2A 3W7WA 5JJEB 3DGEA 2M6YA 3SJBC 4GT1A 1FS0G 3JAKB 3BAAA 5IWAB 1FPOA 3I5DA 1GN3A 4DK0A 3I55V 4JZGA 4JI2B 3QTCA 3UQ8A 1RP3B 1YXBA 5IJ0A 1EN6A 5KHKA 2Q69A 5BR8B 4PHZA 2HJDA 4MSWC 3AG1B 3OGCC 4IHJB 4UCSA 1E1QG 2N04A 2XASA 3EXAA 5B1BC 3U11A 1NTKH 5IY5C 2C2AA 2Q4PA 3KG2A 5EBMC 1KC8W 4FJCC 1S77D 2E76B 4J80A 1Y66A 4TUYA 4BIZA 3OE7G 1PNMA 4X62B 4FZ0A 2JK5C 1YZBA 3JD2A 3W7XA 5E1AC 4NXMB 3GWKC 3IJ4A 4MVZA 4KXRA 4HBNA 1RSOB 1XNRB 2CDYA 4PDLA 3OTOB 1GAXA 4DV6B 1KMIZ 5LP6B 3EFFK 4IL6Z 4QGPA 1N32B 3C3TA 1M57B 1XMQB 2YDEA 2Y0IA 2EZPA 2ZINA 4AHCA 4GKKO 3TXSA 4K0KO 2Q7GA 2Q67A 1Y6XA 5BY1A 2EIKC 1HNZO 2VQFB 4FFBB 2VRZA 3CX5F 4RWUA 4MT8A 4UCVA 1H38A 2V7QG 4LF6B 4TWKA 5DN6G 3LNNA 1TA8A 4WFFA 3PN1A 3CC4V 3FD9A 2MK3A 4BIUA 3HB3B 4ABMA 5K1PA 3JD4A 4GCZA 1PL0A 4DV7O 1DLBA 4YIPA 1QVGU 5KLVH 4LF7O 3E83A 2QTOA 5L3GA 4I9QA 3CWBH 4RO2A 3L75H 5E79Z 2FL4A 1GH6A 3RYFA 3GVMA 2XOKG 3JSLA 3T4DA 1NZ6A 2BTQA 2DQ3A 5GW7A 3DTUB 4JI8O 2A79B 4B3RO 4HNAB 2CTRA 4XDLA 1JJ2U 3IC7A 2WLLB 2JIZG 4BIOA 1H2KA 1WNSA 2ZM6B 1ZL8A 4X1KA 5IE9A 1AI7A 1M57C 3JAWB 3ZRWB 2Q9LA 3K79A 1EN4A 1QLEC 2VQEB 1IX9A 2B9ZA 4JF3A 4TV8A 3RBZA 4CH5A 1NTZH 2CH7B 1Q90D 3AG4C 2RJZA 3SJQC 1N34B 1ZWIC 4LWSB 4I0XA 3ASNB 1XQ8A 5CA0A 2CTPA 4JI6O 1UPGA 4X66O 1Q5OA 3H1HH 5CBHA 1Q6UA 1OCCB 1NJIW 4BW5A 2ZR2A 4LFCO 3RYHA 1XUQA 4DV2B 4B3MB 4DR4B 4WCEV 3B77A 2Q7EA 3RGBA 4JI3O 1WAZA 2W0XA 1U96A 3HKBA 3ZN0A 3JD1A 3PJSK 4PI0A 4ZI7B 5KHHA 1FXKA 4GKJB 5LGUA 2Z3YA 3UCSC 1HR0B 1G6UA 1FFXB 2IJJA 5EBLC 3K08A 1WP8A 1ZAUA 2YIBA 3FAVB 4GX2A 4JI0O 3ETGA 4X64B 3QNEA 4MS2A 1K97A 1P7BA 4F4LA 1SA0B 3P32A 5LGTA 1VQ6V 3SYQA 3A0RA 3K58A 1R3JC 4GYCB 3H1JH 4DV0B 4L8JA 1K5SA 1JVMA 1OHHG 4HAMA 5L3EA 1O9HA 1OCOC 1I94B 2CTWA 2HR3A 3CCLV 3OM3B 1SRYA 4UUJC 4YJ3B 1GMGA 3CC2V 2R70A 3E8BA 2ZCEA 5H5NA 4QIWF 3ML0A 5ITZB 4HYOA 2JJ1G 2GTAA 2ZDIA 2HJFC 3AK2A 3SR2C 5J9PC 4O4IB 3C3SA 3AG3B 3FB6C 1OCRB 3K5LA 3SPCA 5KHJA 1BMFG 2XNDG 5J2TB 2HLDG 1YIJV 4I55B 4JYAO 4YIOA 1KECA 1G8MA 2OCCB 4DUYO 5LHHA 3MHSC 1L0NH 3TCUA 3ZEDA 1ROPA 5KHIA 3TGUH 2E74B 1H2MA 4DYLA 2QTSA 1XEQA 5LP6A 2XAHA 1TVKB 1Z5VA 4GX5A 3CRCA 5IJ0B 2X6CA 4N21A 2DOSA 3G4SV 5IT9N 1YTFD 1Q6HA 1HNWO 2WWWA 2Q5ZA 2PF4E 4DV1B 4DR2O 4X20A 1AP5A 1GM7A 1VMGA 4E2LA 4TUYB 2ZXWC 1N36O 4DR7O 1IBKO 1GRJA 4EEQA 2V4DA 1R6KA 4X8AA 3ABTA 5HFMA 2IW5A 3ICXA 3RVYA 1B3QA 4I4TB 2AW9A 2YI9A 4AI8A 3CHXA 1KBHA 2KG7A 1Z2GA 1K7DA 1KU9A 3HKDA 2QGNA 5DEDA 1ZLZA 3OMIB 4U7OA 4DR5B 2GHYA 2PGGA 2DYSC 1BQZA 1EN5A 3CSXA 3T2MA 3STLC 3WFVA 4DK1A 1AI5A 4PDVA 3UT5A 4OX9B 4HNAA 1FYJA 2OIGA 3ABMC 2F4VB 1COWG 3CRAA 1RM1B 2K9PA 5KA6A 1Y4MA 3DSQA 4JI4B 4FFKA 4FLVA 4O4HA 2LFSA 3SPGA 1EZJA 3ZRWA 2KSDA 4LFAB 2A7WA 2GBOA 4AQYO 2Y4TA 4QPJA 1GO3F 1GTOA 4QNHB 4J11A 2JDIG 1UFIA 2DWEC 3P30A 4YJ2B 1YHQV 4U3JB 2CH7A 4X65B 3F7YC 3D3QA 2ZKOA 1JFFA 5JCOC 4RQEA 4DV5B 1J5EB 1F4NA 4DV4O 4B7EA 5DECA 3ETEA 5CB4B 3B8NA 4LWSA 2XAQA 5GTIZ 1N0NA 1KQSU 2FB5A 3RYFB 4ZBMA 1S3JA 4YY3O 4RQFA 4B3SO 4OPAA 4U3FH 4H44B 2Y0PA 3D3IA 3C90A 3N2GA 5EC1C 2YEVB 3K0DA 1XL4A 3FYIB 1K8AW 1Q86W 1FXVA 3UKMA 4DR1O 1G1XB 2HP8A 1RFYA 4DR6B 2CK3G 1ZL8B 4X1KB 3LSQA 4LFBB 3BFRA 1PNLA 2DYRC 5B66Z 4WFEA 3U0ZA 4FM1A 1K73W 2ARHA 4ZKIA 2ATKC 1WPBA 1SQFA 3B2EE 5CA1B 2E75B 1AR5A 3MDSA 2CTQA 1VQ8V 1KYOF 4FLTA 5A9GA 1IBLB 1HDJA 3G6BA 5KAIZ 1HP8A 2H94A 1QNMA 1IDSA 4LF9B 1LR1A 4ZHQB 4MTGA 4I9WA 4DR3O 3CB2A 3P3NA 4JAUA 3ZMSA 3MHHC 1JNBA 3CRRA 5CA0B 4Z2WA 4Z1MG 1SA0A 3LSSA 1M90W 5D5PA 4FM2A 3M99B 1HNXO 2BTOA 1P4RA 3CMAV 5J2UA 5LMUO 3OFNG 5IYZB 3STZC 2UU9O 4J9ZB 1ZTEA 2QM7A 2X6BA 3RYHB 2CE4A 3ABKC 1Q82W 2ZQMA 2PYLA 1XNQB 2QWRB 5H6RA 3LDCA 2NR5A 5KAFZ 4GZRB 2EILC 3WB0A 1I08A 1V54B 3D36A 4JV5O 3FB7C 5IYDO 4B3TO 2ILMA 4DRXB 3ABLC 4TQDA 2WPDG 1R73A 4J7ZA 4O4IA 4WFAV 3P3PA 1PP9H 4X1IB 5J2TA 2Q6AA 2F23A 4DV3O 3CRQA 4I55A 4FZ1A 3W7UA 4PA6A 3B09A 3APQA 4LF4B 4YHHO 3WB2A 4JAAA 3CCMV 5EIBD 3A2FA 1P84F 4TQFA 2ADPA 3KCYA 1TVKA 2PUSA 2ZE7A 3VBBA 1OV9A 1W0KG 1CXZB 1FD9A 1H2LA 2HHHO 2BOBC 2AZ2A 5B3SC 2Y69B 1XL6A 1HWYA 4PA9A 4JGSA 3CPWU 1P49A 1X59A 5BMVB 3RYCA 4Q6GA 2GUZA 2LJ2A 2AHZA 3L70H 5FL7G 4D7TA 1Q3EA 3DC5A 1AJQA 1D5AA 2QSAA 4X88A 5JH7B 4UV9A 1NH2D 1WJZA 4JI5O 3J81N 4I4TA 4JI1O 1FXKC 5LYJB 1FJGO 4DW1A 3OTOO 3APOA 3TXQA 1QR8A 1FFTB 5KMGA 5GTHZ 2CGNA 4Z1VA 5B5EZ 4EFEA 2PTMA 3RW0A 3K04A 4RUEA 5K1XA 2Y48A 3ZRSA 3VQXA 1QHTA 1M56B 5B1OA 3T1YO 1YJNV 4F6RA 3JARA 5B1AB 4X20B 3ZMVA 3H01A 5L3CA 4XDJA 5GONA 1KUQA 2D2CB 2IM9A 1DGSA 1OCZB 4LCUC 3AG1C 4J7JA 1K4CC 2CGOA 3G67A 2D3OW 2DE0X 4KUMA 1Q8IA 1QU7A 2RDCA 2R9IA 4GKKB 4K0KB 3HPLC 5LOVB 3FYEB 3IAYA 1PKXA 4XDKA 4YJ2A 3JD0A 2F93B 1WA8A 5CN0A 2HG5C 4U3JA 1HNZB 4NXNO 1M5IA 2KG7B 5BXZA 3ZCCA 2ZDIC 3HKDB 3R65A 1D2DA 1OJHA 2LGQA 2YIDA 5CB4A 4QJFB 2XT9A 2ZIMA 1WB7A 1PL4A 1IBMO 5EYPA 3SPIA 4W4KA 1YJ9V 3RT3C 4D6TH 1K33A 1AJPA 2EIJB 1K9MW 1NT2B 2FMLA 3UT5B 3K57A 1R1BA 2YEVA 2YUAA 3OGIB 4FLUA 4NTYA 3CCRV 4PDRA 4NB5A 2LW7A 4P9OA 2WSSG 4JTCB 4DV7B 2YXHA 5LP6C 3LDDA 3LUTB 1WB8A 4LF7B 3E35A 3OD4A 2XAFA 2UUAO 1SZTA 4O4HB 3K06A 5C93A 1M56C 2IBZH 2WLMA 3OUSA 2NLJC 4GX0A 2YICA 3QF7A 2UUBO 3CCSV 2OYQA 4DUZO 4JI8B 5CA1A 3JSNA 4B3RB 5CBFA 1GM8A 2P5OA 1JFFB 2EJ7A 1T5EA 3KDRA 3HKCA 2KB1A 3CD6V 1M1KW 5FPOA 4ZHQA 4PA4A 2HEPA 5LHGA 1N33B 4W4LA 3QO7A 4OGQB 4Q20A 3N2GB 3T4ZA 3GB7C 2JGUA 2YI8A 3M8AA 1EFRG 2X0LA 4PV1B 2M7WA 5IYZA 4FLZA 3EHBB 4DO2A 5KUKA 4CS4A 2GTSA 5EC2C 3FFQA 3AK1A 2LFRA 3AG2B 4TOIA 1BS3A 4FLWA 2EIJC 3DC6A 1NVPD 1Q43A 2Q73A 4O4JA 2KKWA 4LNUB 2YSUB 3ZHRA 5IJ9A 4JI6B 4X66B 3RWRD 2PI5A 3T1HO 3QO8A 3MAQA 2EBOA 4BW9A 1N0JA 3BA9A 4H0LB 1AVMA 4KHPO 3X2QB 1VF6C 4DRXA 1URFA 1MSDA 4LFCB 3H1LH 2HVKC 4X1IA 3NXSA 4P2ZA 1CEZA 3N2KA 4QE7A 4C7UA 3D8CA 3A0HZ 3BCCH 5J2UB 3QVNA 4LP8A 2GV9A 1M93A 3KZIZ 3L74H 4PD4F 1YTFB 1VIBA 3FB5C 3TETA 2BSKB 2CAZC 2GSMB 3ASNC 4FM0A 1KD1W 4JI7O 1AI4A 4IIJB 3F7VC 4JI0B 4H13B 4IYIA 2QM8A 4EB6B 5FNVA 2QWQB 1Y74A 1OCCC 1I5XA 1QCEA 2FKXA 1H8HG 2LO1A 2UXDO 3HR0A 4EFBA 5BMVA 4NR1A 1XDCA 2OT5A 1DTOA 1IURA 2ODMA 1DF5A 1W0JG 2XAJA 3E8GA 1GM9A 3ZRXA 5JH7A 4K3AA 3ETDA 2RN9A 4J10A 4FVMA 5C8YA 5LYJA 2JRIA 3EVKA 3ZMUA 4CBCA 3W7SA 3CEIA 3ZRVA 4DXWA 1V55B 4AILC 2NNUA 1VQPV 2PZSA 1XREA 4H37A 4ASUG 4LBEC 4JYAB 5H2FZ 2N05A 2QKSA 4WFBV 5KHGA 2W6IG 2ZR3A 4DUYB 3CCVV 3ZMTA 1K4DC 1R6TA 1S5HC 3OUFA 3RYCB 3G71V 1KB9F 2GUZB 3K5NA 2WLHA 4XBFA 2QWPB 1DF4A 4PELA 3OEEG 4NVPA 3OMAB 4UXNA 1SERA 4DW0A 3D36C 2QR4A 4LF8O 2IH1C 5LOVA 1HNWB 4PJ0Z 4CH4A 4UB8Z 1NBMG 2JGDA 2DJVA 5KMGB 2EINB 4ZIBA 4DR2B 4O2AA 5FLXN 1Q7YW 2QWOB 3AG3C 1OCRC 1H2SB 1N36B 4LH6A 4DR7B 1IBKB 2PYJA 4X9QA 2AXTZ 1YEWA 2OCCC 2UXXA 2WLIA 2R9RB 2IJKA 4F6RB 1VF7A 3CCEV 3H1KH 3JARB 4PDMA 2YC0A 3ZJZA 4NKGB 2UXBO 3OT7A 5CMUA 3WU2Z 4QE9A 5BZBA 5GONB 2ZT9B 5A2QN 3E2EA 2LQTA 3ABUA 3BHPA 4CH6A 3MD0A 1K34A 1AP6A 2OIEA 2QEXV 2G38A 2QM4A 3SDLA 1B6QA 5KA5A 3CCUV 1VQMV 3K59A 1WA8B 1BT8A 3R66A 4E4EA 3JD3A 1AROP 1JMKC 4O2BA 3WG7B 3OTFA 2E5LO 3KKYA 5B1NA 1QBZA 5EYPB 1MZFA 4FMTA 5CA3A 3SGIA 4UV8A 2HKOA 1JCHA 4AQYB 2EIMB 3VOUA 2VWJA 2ZE5A 2UUCO 3F5WC 1F23A 1SC5B 3TK1A 4MVRA 1F7YA 4RUFA 3CE2A 4DV4B 1O9GA 4LF5O 5H6QA 4X1YB 5LMNO 2UXNA 4BAYA 1Y76A 2H8PC 4YY3B 4O4LB 4B3SB 1K5QA 4LNUA 4TT3G 4G28B 3E8FA 4B7KA 5JVDB 1JJOA 1LUVA 4G2KA 1RM1C 4B08A 3CMEV 4R6ZA 1MMMA 4DR1B 2P22C 4IT5A 4MTXA 3E8HA 3HKCB 1BE3H 1VQLV 2Q68A 2B5UA 1U97A 2ADQB 4ICGA 4K8XA 1K92A 2RMKB 3AG7A 2UXCO 1H5WA 1D5NA 3CP1A 1JX9A 1YSCA 1AI6A 2BCCH 1VQ5V 4MVQA 4UCOA 1CP9A 2WLKA 3K9AA 4LC1A 2W6JG 2ETNA 2BSKA 1BQ0A 2AHYA 3B4SA 2F66C 2YS8A 4IIJA 1Z5WA 4N23A 5LA6A 4OXSA 4DR3B 1BCCH 3CXHF 3A0BZ 2ZIOA 4O4JB 5F2VO 4EB6A 5IJ9B 1NQTA 2X6AA 5KUMA 1VARA 1XMOO 1AJNA 1HNXB 3JCZA 2L35A 3A8TA 5B1BB 5LMUB 1US6A 3ZX6A 3CCQV 4LH7A 3JCUZ 3I56V 4MW8A 4FLXA 3GWOA 1ZSPA 2CUGA 3QG5A 2A06H 4CS2A 2OTLV 1GN4A 3VQYA 3CS5A 3WB1A 4I7ZB 2FYUH 4R50A 3DXRB 2Z5UA 3N2KB 1XBLA 1YITV 1RPOA 5IWAO 2E3CA 5CBGA 4JV5B 3CJHA 4B3TB 4JTAB 4JI2O 2JEUA 5L3BA 4MVMA 4U7NA 1YI2V 3BY6A 2QKCA 1ORQC 2OWOA 2Q8VA 3ZHQA 2P6JA 5BR8O 3RN4A 3Q4HA 1J95A 4FLYA 1I5YA 4ZOLB 1FXHA 4DV3B 1H2NA 2WA3A 1WP7A 5FNVB 4G27B 1Y74B 2JVDA 4GLXA 3E22A 3BABA 2EIKB 1R3LC 3ZMZA 1VQ7V 4YHHB 2WLJA 3JATA 3FB8C 1QVFU 4X62O 3K5MA 2YXLA 3SYPA 3CYOA 2XTAA 2OCHA 3CXCU 1VQ9V 4NXMO 1THZA 3JALA 1S0VA 1V54C 5IYCO 3G6EV 1MNGA 1JA8A 1XNRO 2HVJC 2HHHB 5C8YB 2ITCC 4UVAA 3ZHVA 3QO5A 2X7RB 4JPRA 1CPYA 5JCOA 4DV6O 1N32O 3E89A 1R3KC 1B04A 2YIAA 3SYCA 1XMQO 4CS3A 4OPHA 1YDXA 2XUMA 2LGWA 4MVOA 1MZEA 1R3IC 3T1CA 4JI5B 2YIBD 4JI1B 2VQFO 1MSWD 3B8MA 2DW4A 1FJGB 2Q7HA 1R6NA 2IH3C 5IYBO 3ASOB 5LXTB 4LF6O 3L71H 5D5QA 4MTFA 4JYYA 1SETA 4WBNB 4A5UB 1QLEB 1H2GA 3THOA 3L73H 3T1YB 3BEHA 2Y69C 1S5JA 2JGDB 2VS0A 3F5TA 4K35A 1IZ3A 1L8DA 4LR3A 4O2AB 2OTJV 3AG4B 4GX1A 1E1RG 5LGNA 2Y4UA 4PI2A 4TV9B 2ZE8A 4X89A 1SF9A 4NTWA 2IU0A 1M9NA 2K1EA 3K3WA 3UM7A 2WLIB 1IJGA 1PPJH 1VQNV 1NVPB 4TSFG 4NXNB 2ZM6O 1VF5B 3ZIAG 4CH3A 3SJAC 2EULA 3OR7C 3L9DA 2VQEO 4X1YA 1IBMB 1TGOA 1S72V 4K8ZA 5KX5A 4O4LA 1KP3A 2N74A 2VWKA 5B1AC 3ASOC 3K9SA 5JVDA 2PY5A 2Z0AA 1N34O 4L87A 3RYIA 3OW2U 4O2BB 1OCZC 1SQVH 2B1IA 2QE7G 4CC5A 3K03A 2NN4A 1N33O 3J80N 3SYOA 2UUAB 1BZKA 3U10A 4MVSA 2F95B 4JASA 1AR1B 4JAVA 4YXWG 3ZHTA 2UUBB 4KL1A 4DUZB 2DWDC 1SQXH 5TISZ 3ZHSA 4WF9V 3OEHG 1MOFA 1M4UA 3W7TA 2ZNJA 3KCXA 4I50A 1L0LH 1SQBH 4DV2O 3S3XA 4R8CA 4B3MO 5JQGA 4DR4O 4NYKA 2QKAA 1XOUA 1Y76B 2QDOA 4HZ3A 1VQKV 5LBQA 1PD3A 4MVUA 1SS3A 1OCOB 1MA1A 5EBWC 4UFZA 2MW2B 5H9CA 1SZXA 1L1FA 4GKJO 1SQPH 1HR0O 3UO3A 3J7AU 2Q0OC 1AILA 4I5SA 3N27A 4X64O 4UVBA 1QR9A 4JI3B 3DXRA 5EZYB 2WAMA 5L3FA 3M7MX 3T1HB 5JWPA 4UCTA 2JS3A 3SPJA 1X4TA 3IGAC 5FPRA 4KHPB 1PNKA 4DV0O 1B06A 3O9OA 1PV0A 1A32A 2P7TC 2DQ0A 3IFXA 3ZS8C 1WPXA 3ZHUA 5LA6B 1I94O 4R7CA 1ZX3A 4ZOLA 3VQWA 3RFRA 4J41A 2DN9A 3JAKA 2ZD9A 2JEXA 2ZE6A 1TUBB 4CZZA 4JTDB 3AG2C 3CCJV 1PM9A 1Y67A 1JR9A 2ZXWB 1S5LZ 4JYCA 4JI7B 3HKEB 1G4YB 3AEIA 2IJHA 2PI4A 3L72H 4IHJA 1BHAA 5JJNB 1VQ4V 1YCIA 3X2QC 1AB3A 2AZ0A 1VQOV 3CJHB 3ZBHA 1TUEB 1GKFA 1FOUA 2P4VA 1P7GA 2UXDB 4EKWA 1YJWV 3VQVA 3Q4HB 2DYSB 1SKVA 3JASB 3OMNB 4FK5C 1KKDA 2W0FC 3CC7V 2EX3A 1RSOA 4P30A 1UJWB 4DV1O 2JJ2G 1FAFA 3E22B 1NKDA 3LSUA 4UVCA 3JATB 3ABMB 5LXTA 1N8RW 2B1GA 3FKSG 1H8EG 3JAMN 4WBNA 3IC9A 1F51A 3JALB 2P4KA 1WLEA 2A3QA 2RNBA 4MTOA 1XILA 1NTMH 4BR6A 1LUWA 2F1MA 4NTXA 2P67A 3E86A 3K5OA 4FFBA 4UB6Z 4DR5O 3LNMB 2P06A 3SYAA 3CRMA 1JOYA 1GN6A 4TV9A 4IYHA 4OX9O 1W2BU 3BVOA 1EZVH 1YF2A 4LF8B 2P90A 2F4VO 1V55C 4IGGA 1N4CA 4JI4O 3OR6C 2QA4V 5DM6V 4LFAO 1MABG 4QPKA 2L6LA 2E5LB 2DYRB 2AGAA 1RPRA 1ZUQA 1I7FA 2IU3A 4X65O 1VP7A 3UO2A 1JQ0A 4DV5O 1J5EO 2WLLA 4CC6A 2H3OA 3BPZA 4RAIA 2UXBB 2R72A 3JAWA 1VF6A 1NR1A 1MG1A 2WA4A 1BGYH 4UCRA 1S76D 3G80A 1EBOA 3SJCC 2EINC 1XHZA 4DR6O 1XI1A 2RQ6A 1FKAO 4H33A 3O65A 3RVZA 4LFBO 1BSMA 5JJJB 4WFHA 1KP2A 3H1IH
chains in the Genus database with same CATH topology
2CE4A 4YIOA 1AR4A 2ADQB 3TJTA 1XILA 3KDRA 4BR6A 1LUWA 1D5NA 1XUQA 1IXBA 1I08A 4JZ2A 1I0HA 1B06A 1MNGA 1JA8A 1XDCA 3OT7A 3AK3A 1N0NA 1GN3A 1GN6A 4JZGA 3K9SA 4YIPA 1AP6A 1EN6A 1VEWA 4F6EA 3AK1A 5AG2A 3EVKA 1AP5A 1BT8A 1PM9A 1BS3A 1Y67A 3CEIA 1VARA 4E4EA 3DC6A 1JR9A 1KKCA 1XREA 2RCVA 3BFRA 3KKYA 2ADPA 2GDSA 1ZSPA 1ZUQA 1N0JA 1GN4A 1AVMA 2AW9A 4JYYA 4GUNA 1PL4A 1WB7A 1AR5A 1EN4A 1EM1A 3MDSA 1MSDA 2QKAA 1P7GA 5A9GA 1ZLZA 1IX9A 2CDYA 1EN5A 1QNMA 1IDSA 1MA1A 4C7UA 2QKCA 1GN2A 1SZXA 3RN4A 1WB8A 3QVNA 3DC5A 3C3TA 3LSUA 3AK2A 1LUVA 1MMMA 3C3SA 4FFKA 3IC9A 1BSMA 1ZTEA 4X9QA 2P4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CE4 A;  4YIO A;  1AR4 A;  2ADQ B;  3TJT A;  1XIL A;  4BR6 A;  1LUW A;  1D5N A;  1XUQ A;  1IXB A;  1I08 A;  4JZ2 A;  1I0H A;  1B06 A;  1MNG A;  1JA8 A;  1XDC A;  3OT7 A;  3AK3 A;  1N0N A;  1GN3 A;  1GN6 A;  4JZG A;  3K9S A;  4YIP A;  1AP6 A;  1EN6 A;  1VEW A;  4F6E A;  3AK1 A;  5AG2 A;  3EVK A;  1AP5 A;  1BT8 A;  1PM9 A;  1BS3 A;  1Y67 A;  3CEI A;  1VAR A;  4E4E A;  3DC6 A;  1JR9 A;  1KKC A;  1XRE A;  2RCV A;  3BFR A;  3KKY A;  2ADP A;  2GDS A;  1ZSP A;  1ZUQ A;  1N0J A;  1GN4 A;  1AVM A;  2AW9 A;  4JYY A;  4GUN A;  1PL4 A;  1WB7 A;  1AR5 A;  1EN4 A;  1EM1 A;  3MDS A;  1MSD A;  2QKA A;  1P7G A;  5A9G A;  1ZLZ A;  1IX9 A;  2CDY A;  1EN5 A;  1QNM A;  1IDS A;  1MA1 A;  4C7U A;  2QKC A;  1GN2 A;  1SZX A;  3RN4 A;  1WB8 A;  3QVN A;  3DC5 A;  3C3T A;  3LSU A;  3AK2 A;  1LUV A;  1MMM A;  3C3S A;  4FFK A;  3IC9 A;  1BSM A;  1ZTE A;  4X9Q A;  2P4K A; 
#chains in the Genus database with same CATH topology
 1BL8 A;  2EZO A;  2BTQ B;  1W59 A;  3TJT A;  5L3D A;  3ABK B;  3BA8 A;  5KX5 B;  4J9Y B;  2Q0A A;  2EIL B;  2ITD C;  3ETQ A;  4MW3 A;  2R9A A;  2UUC B;  2DMX A;  2IJI A;  1I0H A;  2KQX A;  3BRC A;  1IBL O;  3S3W A;  1ENV A;  3FX7 A;  3AK3 A;  2XHB A;  1LNQ A;  4LF9 O;  1QLN A;  3RYI B;  2A9H A;  4PA3 A;  4LF5 B;  3ABL B;  1HW7 A;  1E79 G;  5LMN B;  1SES A;  1VEW A;  4TV8 B;  4F6E A;  5AG2 A;  2JS5 A;  5EZY A;  2QWN B;  4FPP A;  4KFM A;  5LL6 Y;  3ZN1 A;  4J7K A;  3WG7 C;  1IVS A;  1NS1 A;  4ZI7 A;  1KKC A;  1K3E A;  2F43 G;  3H9V A;  1FFX A;  1WN7 A;  2RCV A;  4I50 B;  1SQG A;  2LP7 A;  4UCU A;  2BOC C;  2EJR A;  4I0X B;  1BHB A;  4BWA A;  1TAE A;  4JYB A;  2ZNI A;  5JQG B;  2GDS A;  3FAV A;  1Q81 W;  1XHX A;  2EIM C;  1XNQ O;  1GK9 A;  1NR7 A;  1V9P A;  4WFG A;  4GUN A;  2UXC B;  1Q6I A;  1EM1 A;  1QQC A;  1YVW A;  2FTK A;  1TUB A;  3LDE A;  3OAA G;  3NR7 A;  5IY5 B;  2BE3 A;  1NH2 B;  5B3S B;  2UU9 B;  4KP4 A;  1IXM A;  1OZ0 A;  1GN2 A;  1NU1 H;  2HFE C;  3K0G A;  3JYC A;  4FIP C;  3HKE A;  5EK0 A;  1JPX A;  1NI8 A;  1SQQ H;  3HKB B;  4YJ3 A;  1DK1 A;  5IDJ A;  4J42 A;  4LF4 O;  2QJ1 A;  2V1D A;  1XMO B;  2LW1 A;  1FXK B;  5ITZ A;  5HFL A;  4P9P A;  5LHI A;  2A0L A;  3B40 A;  4PA7 A;  3SPH A;  1AR4 A;  5EIB C;  2WLN A;  1F4M A;  2YXY A;  2XAG A;  4D7S A;  2O57 A;  1IXB A;  3JAS A;  4JZ2 A;  3W7W A;  5JJE B;  3DGE A;  2M6Y A;  3SJB C;  4GT1 A;  1FS0 G;  3JAK B;  3BAA A;  5IWA B;  1FPO A;  3I5D A;  1GN3 A;  4DK0 A;  3I55 V;  4JZG A;  4JI2 B;  3QTC A;  3UQ8 A;  1RP3 B;  1YXB A;  5IJ0 A;  1EN6 A;  5KHK A;  2Q69 A;  5BR8 B;  4PHZ A;  2HJD A;  4MSW C;  3AG1 B;  3OGC C;  4IHJ B;  4UCS A;  1E1Q G;  2N04 A;  2XAS A;  3EXA A;  5B1B C;  3U11 A;  1NTK H;  5IY5 C;  2C2A A;  2Q4P A;  3KG2 A;  5EBM C;  1KC8 W;  4FJC C;  1S77 D;  2E76 B;  4J80 A;  1Y66 A;  4TUY A;  4BIZ A;  3OE7 G;  1PNM A;  4X62 B;  4FZ0 A;  2JK5 C;  1YZB A;  3JD2 A;  3W7X A;  5E1A C;  4NXM B;  3GWK C;  3IJ4 A;  4MVZ A;  4KXR A;  4HBN A;  1RSO B;  1XNR B;  2CDY A;  4PDL A;  3OTO B;  1GAX A;  4DV6 B;  1KMI Z;  5LP6 B;  3EFF K;  4IL6 Z;  4QGP A;  1N32 B;  3C3T A;  1M57 B;  1XMQ B;  2YDE A;  2Y0I A;  2EZP A;  2ZIN A;  4AHC A;  4GKK O;  3TXS A;  4K0K O;  2Q7G A;  2Q67 A;  1Y6X A;  5BY1 A;  2EIK C;  1HNZ O;  2VQF B;  4FFB B;  2VRZ A;  3CX5 F;  4RWU A;  4MT8 A;  4UCV A;  1H38 A;  2V7Q G;  4LF6 B;  4TWK A;  5DN6 G;  3LNN A;  1TA8 A;  4WFF A;  3PN1 A;  3CC4 V;  3FD9 A;  2MK3 A;  4BIU A;  3HB3 B;  4ABM A;  5K1P A;  3JD4 A;  4GCZ A;  1PL0 A;  4DV7 O;  1DLB A;  4YIP A;  1QVG U;  5KLV H;  4LF7 O;  3E83 A;  2QTO A;  5L3G A;  4I9Q A;  3CWB H;  4RO2 A;  3L75 H;  5E79 Z;  2FL4 A;  1GH6 A;  3RYF A;  3GVM A;  2XOK G;  3JSL A;  3T4D A;  1NZ6 A;  2BTQ A;  2DQ3 A;  5GW7 A;  3DTU B;  4JI8 O;  2A79 B;  4B3R O;  4HNA B;  2CTR A;  4XDL A;  1JJ2 U;  3IC7 A;  2WLL B;  2JIZ G;  4BIO A;  1H2K A;  1WNS A;  2ZM6 B;  1ZL8 A;  4X1K A;  5IE9 A;  1AI7 A;  1M57 C;  3JAW B;  3ZRW B;  2Q9L A;  3K79 A;  1EN4 A;  1QLE C;  2VQE B;  1IX9 A;  2B9Z A;  4JF3 A;  4TV8 A;  3RBZ A;  4CH5 A;  1NTZ H;  2CH7 B;  1Q90 D;  3AG4 C;  2RJZ A;  3SJQ C;  1N34 B;  1ZWI C;  4LWS B;  4I0X A;  3ASN B;  1XQ8 A;  5CA0 A;  2CTP A;  4JI6 O;  1UPG A;  4X66 O;  1Q5O A;  3H1H H;  5CBH A;  1Q6U A;  1OCC B;  1NJI W;  4BW5 A;  2ZR2 A;  4LFC O;  3RYH A;  1XUQ A;  4DV2 B;  4B3M B;  4DR4 B;  4WCE V;  3B77 A;  2Q7E A;  3RGB A;  4JI3 O;  1WAZ A;  2W0X A;  1U96 A;  3HKB A;  3ZN0 A;  3JD1 A;  3PJS K;  4PI0 A;  4ZI7 B;  5KHH A;  1FXK A;  4GKJ B;  5LGU A;  2Z3Y A;  3UCS C;  1HR0 B;  1G6U A;  1FFX B;  2IJJ A;  5EBL C;  3K08 A;  1WP8 A;  1ZAU A;  2YIB A;  3FAV B;  4GX2 A;  4JI0 O;  3ETG A;  4X64 B;  3QNE A;  4MS2 A;  1K97 A;  1P7B A;  4F4L A;  1SA0 B;  3P32 A;  5LGT A;  1VQ6 V;  3SYQ A;  3A0R A;  3K58 A;  1R3J C;  4GYC B;  3H1J H;  4DV0 B;  4L8J A;  1K5S A;  1JVM A;  1OHH G;  4HAM A;  5L3E A;  1O9H A;  1OCO C;  1I94 B;  2CTW A;  2HR3 A;  3CCL V;  3OM3 B;  1SRY A;  4UUJ C;  4YJ3 B;  1GMG A;  3CC2 V;  2R70 A;  3E8B A;  2ZCE A;  5H5N A;  4QIW F;  3ML0 A;  5ITZ B;  4HYO A;  2JJ1 G;  2GTA A;  2ZDI A;  2HJF C;  3AK2 A;  3SR2 C;  5J9P C;  4O4I B;  3C3S A;  3AG3 B;  3FB6 C;  1OCR B;  3K5L A;  3SPC A;  5KHJ A;  1BMF G;  2XND G;  5J2T B;  2HLD G;  1YIJ V;  4I55 B;  4JYA O;  4YIO A;  1KEC A;  1G8M A;  2OCC B;  4DUY O;  5LHH A;  3MHS C;  1L0N H;  3TCU A;  3ZED A;  1ROP A;  5KHI A;  3TGU H;  2E74 B;  1H2M A;  4DYL A;  2QTS A;  1XEQ A;  5LP6 A;  2XAH A;  1TVK B;  1Z5V A;  4GX5 A;  3CRC A;  5IJ0 B;  2X6C A;  4N21 A;  2DOS A;  3G4S V;  5IT9 N;  1YTF D;  1Q6H A;  1HNW O;  2WWW A;  2Q5Z A;  2PF4 E;  4DV1 B;  4DR2 O;  4X20 A;  1AP5 A;  1GM7 A;  1VMG A;  4E2L A;  4TUY B;  2ZXW C;  1N36 O;  4DR7 O;  1IBK O;  1GRJ A;  4EEQ A;  2V4D A;  1R6K A;  4X8A A;  3ABT A;  5HFM A;  2IW5 A;  3ICX A;  3RVY A;  1B3Q A;  4I4T B;  2AW9 A;  2YI9 A;  4AI8 A;  3CHX A;  1KBH A;  2KG7 A;  1Z2G A;  1K7D A;  1KU9 A;  3HKD A;  2QGN A;  5DED A;  1ZLZ A;  3OMI B;  4U7O A;  4DR5 B;  2GHY A;  2PGG A;  2DYS C;  1BQZ A;  1EN5 A;  3CSX A;  3T2M A;  3STL C;  3WFV A;  4DK1 A;  1AI5 A;  4PDV A;  3UT5 A;  4OX9 B;  4HNA A;  1FYJ A;  2OIG A;  3ABM C;  2F4V B;  1COW G;  3CRA A;  1RM1 B;  2K9P A;  5KA6 A;  1Y4M A;  3DSQ A;  4JI4 B;  4FFK A;  4FLV A;  4O4H A;  2LFS A;  3SPG A;  1EZJ A;  3ZRW A;  2KSD A;  4LFA B;  2A7W A;  2GBO A;  4AQY O;  2Y4T A;  4QPJ A;  1GO3 F;  1GTO A;  4QNH B;  4J11 A;  2JDI G;  1UFI A;  2DWE C;  3P30 A;  4YJ2 B;  1YHQ V;  4U3J B;  2CH7 A;  4X65 B;  3F7Y C;  3D3Q A;  2ZKO A;  1JFF A;  5JCO C;  4RQE A;  4DV5 B;  1J5E B;  1F4N A;  4DV4 O;  4B7E A;  5DEC A;  3ETE A;  5CB4 B;  3B8N A;  4LWS A;  2XAQ A;  5GTI Z;  1N0N A;  1KQS U;  2FB5 A;  3RYF B;  4ZBM A;  1S3J A;  4YY3 O;  4RQF A;  4B3S O;  4OPA A;  4U3F H;  4H44 B;  2Y0P A;  3D3I A;  3C90 A;  3N2G A;  5EC1 C;  2YEV B;  3K0D A;  1XL4 A;  3FYI B;  1K8A W;  1Q86 W;  1FXV A;  3UKM A;  4DR1 O;  1G1X B;  2HP8 A;  1RFY A;  4DR6 B;  2CK3 G;  1ZL8 B;  4X1K B;  3LSQ A;  4LFB B;  3BFR A;  1PNL A;  2DYR C;  5B66 Z;  4WFE A;  3U0Z A;  4FM1 A;  1K73 W;  2ARH A;  4ZKI A;  2ATK C;  1WPB A;  1SQF A;  3B2E E;  5CA1 B;  2E75 B;  1AR5 A;  3MDS A;  2CTQ A;  1VQ8 V;  1KYO F;  4FLT A;  5A9G A;  1IBL B;  1HDJ A;  3G6B A;  5KAI Z;  1HP8 A;  2H94 A;  1QNM A;  1IDS A;  4LF9 B;  1LR1 A;  4ZHQ B;  4MTG A;  4I9W A;  4DR3 O;  3CB2 A;  3P3N A;  4JAU A;  3ZMS A;  3MHH C;  1JNB A;  3CRR A;  5CA0 B;  4Z2W A;  4Z1M G;  1SA0 A;  3LSS A;  1M90 W;  5D5P A;  4FM2 A;  3M99 B;  1HNX O;  2BTO A;  1P4R A;  3CMA V;  5J2U A;  5LMU O;  3OFN G;  5IYZ B;  3STZ C;  2UU9 O;  4J9Z B;  1ZTE A;  2QM7 A;  2X6B A;  3RYH B;  2CE4 A;  3ABK C;  1Q82 W;  2ZQM A;  2PYL A;  1XNQ B;  2QWR B;  5H6R A;  3LDC A;  2NR5 A;  5KAF Z;  4GZR B;  2EIL C;  3WB0 A;  1I08 A;  1V54 B;  3D36 A;  4JV5 O;  3FB7 C;  5IYD O;  4B3T O;  2ILM A;  4DRX B;  3ABL C;  4TQD A;  2WPD G;  1R73 A;  4J7Z A;  4O4I A;  4WFA V;  3P3P A;  1PP9 H;  4X1I B;  5J2T A;  2Q6A A;  2F23 A;  4DV3 O;  3CRQ A;  4I55 A;  4FZ1 A;  3W7U A;  4PA6 A;  3B09 A;  3APQ A;  4LF4 B;  4YHH O;  3WB2 A;  4JAA A;  3CCM V;  5EIB D;  3A2F A;  1P84 F;  4TQF A;  2ADP A;  3KCY A;  1TVK A;  2PUS A;  2ZE7 A;  3VBB A;  1OV9 A;  1W0K G;  1CXZ B;  1FD9 A;  1H2L A;  2HHH O;  2BOB C;  2AZ2 A;  5B3S C;  2Y69 B;  1XL6 A;  1HWY A;  4PA9 A;  4JGS A;  3CPW U;  1P49 A;  1X59 A;  5BMV B;  3RYC A;  4Q6G A;  2GUZ A;  2LJ2 A;  2AHZ A;  3L70 H;  5FL7 G;  4D7T A;  1Q3E A;  3DC5 A;  1AJQ A;  1D5A A;  2QSA A;  4X88 A;  5JH7 B;  4UV9 A;  1NH2 D;  1WJZ A;  4JI5 O;  3J81 N;  4I4T A;  4JI1 O;  1FXK C;  5LYJ B;  1FJG O;  4DW1 A;  3OTO O;  3APO A;  3TXQ A;  1QR8 A;  1FFT B;  5KMG A;  5GTH Z;  2CGN A;  4Z1V A;  5B5E Z;  4EFE A;  2PTM A;  3RW0 A;  3K04 A;  4RUE A;  5K1X A;  2Y48 A;  3ZRS A;  3VQX A;  1QHT A;  1M56 B;  5B1O A;  3T1Y O;  1YJN V;  4F6R A;  3JAR A;  5B1A B;  4X20 B;  3ZMV A;  3H01 A;  5L3C A;  4XDJ A;  5GON A;  1KUQ A;  2D2C B;  2IM9 A;  1DGS A;  1OCZ B;  4LCU C;  3AG1 C;  4J7J A;  1K4C C;  2CGO A;  3G67 A;  2D3O W;  2DE0 X;  4KUM A;  1Q8I A;  1QU7 A;  2RDC A;  2R9I A;  4GKK B;  4K0K B;  3HPL C;  5LOV B;  3FYE B;  3IAY A;  1PKX A;  4XDK A;  4YJ2 A;  3JD0 A;  2F93 B;  1WA8 A;  5CN0 A;  2HG5 C;  4U3J A;  1HNZ B;  4NXN O;  1M5I A;  2KG7 B;  5BXZ A;  3ZCC A;  2ZDI C;  3HKD B;  3R65 A;  1D2D A;  1OJH A;  2LGQ A;  2YID A;  5CB4 A;  4QJF B;  2XT9 A;  2ZIM A;  1WB7 A;  1PL4 A;  1IBM O;  5EYP A;  3SPI A;  4W4K A;  1YJ9 V;  3RT3 C;  4D6T H;  1K33 A;  1AJP A;  2EIJ B;  1K9M W;  1NT2 B;  2FML A;  3UT5 B;  3K57 A;  1R1B A;  2YEV A;  2YUA A;  3OGI B;  4FLU A;  4NTY A;  3CCR V;  4PDR A;  4NB5 A;  2LW7 A;  4P9O A;  2WSS G;  4JTC B;  4DV7 B;  2YXH A;  5LP6 C;  3LDD A;  3LUT B;  1WB8 A;  4LF7 B;  3E35 A;  3OD4 A;  2XAF A;  2UUA O;  1SZT A;  4O4H B;  3K06 A;  5C93 A;  1M56 C;  2IBZ H;  2WLM A;  3OUS A;  2NLJ C;  4GX0 A;  2YIC A;  3QF7 A;  2UUB O;  3CCS V;  2OYQ A;  4DUZ O;  4JI8 B;  5CA1 A;  3JSN A;  4B3R B;  5CBF A;  1GM8 A;  2P5O A;  1JFF B;  2EJ7 A;  1T5E A;  3KDR A;  3HKC A;  2KB1 A;  3CD6 V;  1M1K W;  5FPO A;  4ZHQ A;  4PA4 A;  2HEP A;  5LHG A;  1N33 B;  4W4L A;  3QO7 A;  4OGQ B;  4Q20 A;  3N2G B;  3T4Z A;  3GB7 C;  2JGU A;  2YI8 A;  3M8A A;  1EFR G;  2X0L A;  4PV1 B;  2M7W A;  5IYZ A;  4FLZ A;  3EHB B;  4DO2 A;  5KUK A;  4CS4 A;  2GTS A;  5EC2 C;  3FFQ A;  3AK1 A;  2LFR A;  3AG2 B;  4TOI A;  1BS3 A;  4FLW A;  2EIJ C;  3DC6 A;  1NVP D;  1Q43 A;  2Q73 A;  4O4J A;  2KKW A;  4LNU B;  2YSU B;  3ZHR A;  5IJ9 A;  4JI6 B;  4X66 B;  3RWR D;  2PI5 A;  3T1H O;  3QO8 A;  3MAQ A;  2EBO A;  4BW9 A;  1N0J A;  3BA9 A;  4H0L B;  1AVM A;  4KHP O;  3X2Q B;  1VF6 C;  4DRX A;  1URF A;  1MSD A;  4LFC B;  3H1L H;  2HVK C;  4X1I A;  3NXS A;  4P2Z A;  1CEZ A;  3N2K A;  4QE7 A;  4C7U A;  3D8C A;  3A0H Z;  3BCC H;  5J2U B;  3QVN A;  4LP8 A;  2GV9 A;  1M93 A;  3KZI Z;  3L74 H;  4PD4 F;  1YTF B;  1VIB A;  3FB5 C;  3TET A;  2BSK B;  2CAZ C;  2GSM B;  3ASN C;  4FM0 A;  1KD1 W;  4JI7 O;  1AI4 A;  4IIJ B;  3F7V C;  4JI0 B;  4H13 B;  4IYI A;  2QM8 A;  4EB6 B;  5FNV A;  2QWQ B;  1Y74 A;  1OCC C;  1I5X A;  1QCE A;  2FKX A;  1H8H G;  2LO1 A;  2UXD O;  3HR0 A;  4EFB A;  5BMV A;  4NR1 A;  1XDC A;  2OT5 A;  1DTO A;  1IUR A;  2ODM A;  1DF5 A;  1W0J G;  2XAJ A;  3E8G A;  1GM9 A;  3ZRX A;  5JH7 A;  4K3A A;  3ETD A;  2RN9 A;  4J10 A;  4FVM A;  5C8Y A;  5LYJ A;  2JRI A;  3EVK A;  3ZMU A;  4CBC A;  3W7S A;  3CEI A;  3ZRV A;  4DXW A;  1V55 B;  4AIL C;  2NNU A;  1VQP V;  2PZS A;  1XRE A;  4H37 A;  4ASU G;  4LBE C;  4JYA B;  5H2F Z;  2N05 A;  2QKS A;  4WFB V;  5KHG A;  2W6I G;  2ZR3 A;  4DUY B;  3CCV V;  3ZMT A;  1K4D C;  1R6T A;  1S5H C;  3OUF A;  3RYC B;  3G71 V;  1KB9 F;  2GUZ B;  3K5N A;  2WLH A;  4XBF A;  2QWP B;  1DF4 A;  4PEL A;  3OEE G;  4NVP A;  3OMA B;  4UXN A;  1SER A;  4DW0 A;  3D36 C;  2QR4 A;  4LF8 O;  2IH1 C;  5LOV A;  1HNW B;  4PJ0 Z;  4CH4 A;  4UB8 Z;  1NBM G;  2JGD A;  2DJV A;  5KMG B;  2EIN B;  4ZIB A;  4DR2 B;  4O2A A;  5FLX N;  1Q7Y W;  2QWO B;  3AG3 C;  1OCR C;  1H2S B;  1N36 B;  4LH6 A;  4DR7 B;  1IBK B;  2PYJ A;  4X9Q A;  2AXT Z;  1YEW A;  2OCC C;  2UXX A;  2WLI A;  2R9R B;  2IJK A;  4F6R B;  1VF7 A;  3CCE V;  3H1K H;  3JAR B;  4PDM A;  2YC0 A;  3ZJZ A;  4NKG B;  2UXB O;  3OT7 A;  5CMU A;  3WU2 Z;  4QE9 A;  5BZB A;  5GON B;  2ZT9 B;  5A2Q N;  3E2E A;  2LQT A;  3ABU A;  3BHP A;  4CH6 A;  3MD0 A;  1K34 A;  1AP6 A;  2OIE A;  2QEX V;  2G38 A;  2QM4 A;  3SDL A;  1B6Q A;  5KA5 A;  3CCU V;  1VQM V;  3K59 A;  1WA8 B;  1BT8 A;  3R66 A;  4E4E A;  3JD3 A;  1ARO P;  1JMK C;  4O2B A;  3WG7 B;  3OTF A;  2E5L O;  3KKY A;  5B1N A;  1QBZ A;  5EYP B;  1MZF A;  4FMT A;  5CA3 A;  3SGI A;  4UV8 A;  2HKO A;  1JCH A;  4AQY B;  2EIM B;  3VOU A;  2VWJ A;  2ZE5 A;  2UUC O;  3F5W C;  1F23 A;  1SC5 B;  3TK1 A;  4MVR A;  1F7Y A;  4RUF A;  3CE2 A;  4DV4 B;  1O9G A;  4LF5 O;  5H6Q A;  4X1Y B;  5LMN O;  2UXN A;  4BAY A;  1Y76 A;  2H8P C;  4YY3 B;  4O4L B;  4B3S B;  1K5Q A;  4LNU A;  4TT3 G;  4G28 B;  3E8F A;  4B7K A;  5JVD B;  1JJO A;  1LUV A;  4G2K A;  1RM1 C;  4B08 A;  3CME V;  4R6Z A;  1MMM A;  4DR1 B;  2P22 C;  4IT5 A;  4MTX A;  3E8H A;  3HKC B;  1BE3 H;  1VQL V;  2Q68 A;  2B5U A;  1U97 A;  2ADQ B;  4ICG A;  4K8X A;  1K92 A;  2RMK B;  3AG7 A;  2UXC O;  1H5W A;  1D5N A;  3CP1 A;  1JX9 A;  1YSC A;  1AI6 A;  2BCC H;  1VQ5 V;  4MVQ A;  4UCO A;  1CP9 A;  2WLK A;  3K9A A;  4LC1 A;  2W6J G;  2ETN A;  2BSK A;  1BQ0 A;  2AHY A;  3B4S A;  2F66 C;  2YS8 A;  4IIJ A;  1Z5W A;  4N23 A;  5LA6 A;  4OXS A;  4DR3 B;  1BCC H;  3CXH F;  3A0B Z;  2ZIO A;  4O4J B;  5F2V O;  4EB6 A;  5IJ9 B;  1NQT A;  2X6A A;  5KUM A;  1VAR A;  1XMO O;  1AJN A;  1HNX B;  3JCZ A;  2L35 A;  3A8T A;  5B1B B;  5LMU B;  1US6 A;  3ZX6 A;  3CCQ V;  4LH7 A;  3JCU Z;  3I56 V;  4MW8 A;  4FLX A;  3GWO A;  1ZSP A;  2CUG A;  3QG5 A;  2A06 H;  4CS2 A;  2OTL V;  1GN4 A;  3VQY A;  3CS5 A;  3WB1 A;  4I7Z B;  2FYU H;  4R50 A;  3DXR B;  2Z5U A;  3N2K B;  1XBL A;  1YIT V;  1RPO A;  5IWA O;  2E3C A;  5CBG A;  4JV5 B;  3CJH A;  4B3T B;  4JTA B;  4JI2 O;  2JEU A;  5L3B A;  4MVM A;  4U7N A;  1YI2 V;  3BY6 A;  2QKC A;  1ORQ C;  2OWO A;  2Q8V A;  3ZHQ A;  2P6J A;  5BR8 O;  3RN4 A;  3Q4H A;  1J95 A;  4FLY A;  1I5Y A;  4ZOL B;  1FXH A;  4DV3 B;  1H2N A;  2WA3 A;  1WP7 A;  5FNV B;  4G27 B;  1Y74 B;  2JVD A;  4GLX A;  3E22 A;  3BAB A;  2EIK B;  1R3L C;  3ZMZ A;  1VQ7 V;  4YHH B;  2WLJ A;  3JAT A;  3FB8 C;  1QVF U;  4X62 O;  3K5M A;  2YXL A;  3SYP A;  3CYO A;  2XTA A;  2OCH A;  3CXC U;  1VQ9 V;  4NXM O;  1THZ A;  3JAL A;  1S0V A;  1V54 C;  5IYC O;  3G6E V;  1MNG A;  1JA8 A;  1XNR O;  2HVJ C;  2HHH B;  5C8Y B;  2ITC C;  4UVA A;  3ZHV A;  3QO5 A;  2X7R B;  4JPR A;  1CPY A;  5JCO A;  4DV6 O;  1N32 O;  3E89 A;  1R3K C;  1B04 A;  2YIA A;  3SYC A;  1XMQ O;  4CS3 A;  4OPH A;  1YDX A;  2XUM A;  2LGW A;  4MVO A;  1MZE A;  1R3I C;  3T1C A;  4JI5 B;  2YIB D;  4JI1 B;  2VQF O;  1MSW D;  3B8M A;  2DW4 A;  1FJG B;  2Q7H A;  1R6N A;  2IH3 C;  5IYB O;  3ASO B;  5LXT B;  4LF6 O;  3L71 H;  5D5Q A;  4MTF A;  4JYY A;  1SET A;  4WBN B;  4A5U B;  1QLE B;  1H2G A;  3THO A;  3L73 H;  3T1Y B;  3BEH A;  2Y69 C;  1S5J A;  2JGD B;  2VS0 A;  3F5T A;  4K35 A;  1IZ3 A;  1L8D A;  4LR3 A;  4O2A B;  2OTJ V;  3AG4 B;  4GX1 A;  1E1R G;  5LGN A;  2Y4U A;  4PI2 A;  4TV9 B;  2ZE8 A;  4X89 A;  1SF9 A;  4NTW A;  2IU0 A;  1M9N A;  2K1E A;  3K3W A;  3UM7 A;  2WLI B;  1IJG A;  1PPJ H;  1VQN V;  1NVP B;  4TSF G;  4NXN B;  2ZM6 O;  1VF5 B;  3ZIA G;  4CH3 A;  3SJA C;  2EUL A;  3OR7 C;  3L9D A;  2VQE O;  4X1Y A;  1IBM B;  1TGO A;  1S72 V;  4K8Z A;  5KX5 A;  4O4L A;  1KP3 A;  2N74 A;  2VWK A;  5B1A C;  3ASO C;  3K9S A;  5JVD A;  2PY5 A;  2Z0A A;  1N34 O;  4L87 A;  3RYI A;  3OW2 U;  4O2B B;  1OCZ C;  1SQV H;  2B1I A;  2QE7 G;  4CC5 A;  3K03 A;  2NN4 A;  1N33 O;  3J80 N;  3SYO A;  2UUA B;  1BZK A;  3U10 A;  4MVS A;  2F95 B;  4JAS A;  1AR1 B;  4JAV A;  4YXW G;  3ZHT A;  2UUB B;  4KL1 A;  4DUZ B;  2DWD C;  1SQX H;  5TIS Z;  3ZHS A;  4WF9 V;  3OEH G;  1MOF A;  1M4U A;  3W7T A;  2ZNJ A;  3KCX A;  4I50 A;  1L0L H;  1SQB H;  4DV2 O;  3S3X A;  4R8C A;  4B3M O;  5JQG A;  4DR4 O;  4NYK A;  2QKA A;  1XOU A;  1Y76 B;  2QDO A;  4HZ3 A;  1VQK V;  5LBQ A;  1PD3 A;  4MVU A;  1SS3 A;  1OCO B;  1MA1 A;  5EBW C;  4UFZ A;  2MW2 B;  5H9C A;  1SZX A;  1L1F A;  4GKJ O;  1SQP H;  1HR0 O;  3UO3 A;  3J7A U;  2Q0O C;  1AIL A;  4I5S A;  3N27 A;  4X64 O;  4UVB A;  1QR9 A;  4JI3 B;  3DXR A;  5EZY B;  2WAM A;  5L3F A;  3M7M X;  3T1H B;  5JWP A;  4UCT A;  2JS3 A;  3SPJ A;  1X4T A;  3IGA C;  5FPR A;  4KHP B;  1PNK A;  4DV0 O;  1B06 A;  3O9O A;  1PV0 A;  1A32 A;  2P7T C;  2DQ0 A;  3IFX A;  3ZS8 C;  1WPX A;  3ZHU A;  5LA6 B;  1I94 O;  4R7C A;  1ZX3 A;  4ZOL A;  3VQW A;  3RFR A;  4J41 A;  2DN9 A;  3JAK A;  2ZD9 A;  2JEX A;  2ZE6 A;  1TUB B;  4CZZ A;  4JTD B;  3AG2 C;  3CCJ V;  1PM9 A;  1Y67 A;  1JR9 A;  2ZXW B;  1S5L Z;  4JYC A;  4JI7 B;  3HKE B;  1G4Y B;  3AEI A;  2IJH A;  2PI4 A;  3L72 H;  4IHJ A;  1BHA A;  5JJN B;  1VQ4 V;  1YCI A;  3X2Q C;  1AB3 A;  2AZ0 A;  1VQO V;  3CJH B;  3ZBH A;  1TUE B;  1GKF A;  1FOU A;  2P4V A;  1P7G A;  2UXD B;  4EKW A;  1YJW V;  3VQV A;  3Q4H B;  2DYS B;  1SKV A;  3JAS B;  3OMN B;  4FK5 C;  1KKD A;  2W0F C;  3CC7 V;  2EX3 A;  1RSO A;  4P30 A;  1UJW B;  4DV1 O;  2JJ2 G;  1FAF A;  3E22 B;  1NKD A;  3LSU A;  4UVC A;  3JAT B;  3ABM B;  5LXT A;  1N8R W;  2B1G A;  3FKS G;  1H8E G;  3JAM N;  4WBN A;  3IC9 A;  1F51 A;  3JAL B;  2P4K A;  1WLE A;  2A3Q A;  2RNB A;  4MTO A;  1XIL A;  1NTM H;  4BR6 A;  1LUW A;  2F1M A;  4NTX A;  2P67 A;  3E86 A;  3K5O A;  4FFB A;  4UB6 Z;  4DR5 O;  3LNM B;  2P06 A;  3SYA A;  3CRM A;  1JOY A;  1GN6 A;  4TV9 A;  4IYH A;  4OX9 O;  1W2B U;  3BVO A;  1EZV H;  1YF2 A;  4LF8 B;  2P90 A;  2F4V O;  1V55 C;  4IGG A;  1N4C A;  4JI4 O;  3OR6 C;  2QA4 V;  5DM6 V;  4LFA O;  1MAB G;  4QPK A;  2L6L A;  2E5L B;  2DYR B;  2AGA A;  1RPR A;  1ZUQ A;  1I7F A;  2IU3 A;  4X65 O;  1VP7 A;  3UO2 A;  1JQ0 A;  4DV5 O;  1J5E O;  2WLL A;  4CC6 A;  2H3O A;  3BPZ A;  4RAI A;  2UXB B;  2R72 A;  3JAW A;  1VF6 A;  1NR1 A;  1MG1 A;  2WA4 A;  1BGY H;  4UCR A;  1S76 D;  3G80 A;  1EBO A;  3SJC C;  2EIN C;  1XHZ A;  4DR6 O;  1XI1 A;  2RQ6 A;  1FKA O;  4H33 A;  3O65 A;  3RVZ A;  4LFB O;  1BSM A;  5JJJ B;  4WFH A;  1KP2 A;  3H1I H; 
#chains in the Genus database with same CATH homology
 2CE4 A;  4YIO A;  1AR4 A;  2ADQ B;  3TJT A;  1XIL A;  3KDR A;  4BR6 A;  1LUW A;  1D5N A;  1XUQ A;  1IXB A;  1I08 A;  4JZ2 A;  1I0H A;  1B06 A;  1MNG A;  1JA8 A;  1XDC A;  3OT7 A;  3AK3 A;  1N0N A;  1GN3 A;  1GN6 A;  4JZG A;  3K9S A;  4YIP A;  1AP6 A;  1EN6 A;  1VEW A;  4F6E A;  3AK1 A;  5AG2 A;  3EVK A;  1AP5 A;  1BT8 A;  1PM9 A;  1BS3 A;  1Y67 A;  3CEI A;  1VAR A;  4E4E A;  3DC6 A;  1JR9 A;  1KKC A;  1XRE A;  2RCV A;  3BFR A;  3KKY A;  2ADP A;  2GDS A;  1ZSP A;  1ZUQ A;  1N0J A;  1GN4 A;  1AVM A;  2AW9 A;  4JYY A;  4GUN A;  1PL4 A;  1WB7 A;  1AR5 A;  1EN4 A;  1EM1 A;  3MDS A;  1MSD A;  2QKA A;  1P7G A;  5A9G A;  1ZLZ A;  1IX9 A;  2CDY A;  1EN5 A;  1QNM A;  1IDS A;  1MA1 A;  4C7U A;  2QKC A;  1GN2 A;  1SZX A;  3RN4 A;  1WB8 A;  3QVN A;  3DC5 A;  3C3T A;  3LSU A;  3AK2 A;  1LUV A;  1MMM A;  3C3S A;  4FFK A;  3IC9 A;  1BSM A;  1ZTE A;  4X9Q A;  2P4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...