1XDCA

Hydrogen bonding in human manganese superoxide dismutase containing 3-fluorotyrosine
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
198
structure length
189
Chain Sequence
KHSLPDLPDGALEPHINAQIMQLHHSKHHAAVNNLNVTEEKQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHALQKNVRPDLKAIWNVINWENVTERMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Hydrogen bonding in human manganese superoxide dismutase containing 3-fluorotyrosine
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 189
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1xdcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1xdcA02
1MMMA 1N0NA 1GN3A 1AR5A 1AP5A 1MSDA 3OT7A 1ZTEA 3AK3A 3EVKA 4YIPA 1ZSPA 1IDSA 1EN4A 3CEIA 1EM1A 2CE4A 1I08A 2ADQB 1EN6A 1AR4A 3MDSA 1PM9A 3KKYA 1AP6A 3C3TA 3K9SA 1P7GA 4JYYA 1B06A 1WB7A 3QVNA 1LUVA 1GN2A 4JZ2A 2CDYA 1N0JA 1XUQA 1EN5A 4E4EA 1PL4A 5AG2A 1MA1A 1VEWA 4FFKA 3AK1A 2GDSA 4GUNA 1QNMA 1MNGA 2RCVA 1VARA 1XREA 3TJTA 3BFRA 1WB8A 1IXBA 3DC5A 1KKCA 1ZUQA 1ZLZA 1IX9A 1XDCA 4BR6A 2QKCA 1D5NA 1GN6A 1XILA 4X9QA 1JA8A 3AK2A 3LSUA 1LUWA 4C7UA 5A9GA 4YIOA 2QKAA 2ADPA 4F6EA 1Y67A 1BSMA 1AVMA 1JR9A 1GN4A 3IC9A 2AW9A 3DC6A 1BT8A 3C3SA 1BS3A 3RN4A 2P4KA 4JZGA 1SZXA 1I0HA
chains in the Genus database with same CATH superfamily
2OT5A 1J95A 3BABA 3PJSK 4DV0O 2WLMA 2JRIA 4FLTA 1JCHA 5L3CA 3CPWU 1N8RW 3DSQA 1L1FA 2Z0AA 1YVWA 3UO2A 3I56V 4I4TA 4X66O 2XUMA 1IBKO 4DUYB 2Y0PA 3K0GA 4KFMA 2VS0A 4QE9A 4HAMA 1GH6A 2QWRB 1AP6A 4Z1MG 1B3QA 2P4VA 1I94B 2HP8A 1K3EA 4NR1A 4JI7B 1LUVA 2QM8A 5J2TA 2EINB 1JFFA 4B3SO 4MS2A 2XHBA 2E75B 2RDCA 4WFFA 2P7TC 2ZT9B 4DV7O 3H1KH 4X20B 1WB8A 1YIJV 1XNRB 4JYAB 2XTAA 2XAQA 3BY6A 1XL6A 5FLXN 5LMUB 3H1HH 1GM7A 1NT2B 1N32B 4C7UA 3BCCH 2X0LA 5CA0A 3THOA 2W6JG 5FL7G 1FFXA 2YC0A 2H8PC 4GLXA 2ZIOA 1GAXA 5KHGA 5EYPB 2QE7G 4QIWF 3CSXA 3FYEB 5IWAB 3CB2A 2DW4A 2HLDG 3Q4HA 3LNNA 1BS3A 4I4TB 3JALA 2Y4TA 4LC1A 5K1XA 2ZKOA 2LFRA 3AG7A 4TOIA 2F1MA 4X65B 5EIBD 3FX7A 3HKDA 4I7ZB 1M56C 2UXBB 5BXZA 4X88A 5J2TB 1KECA 1FD9A 1YSCA 4OPAA 2BTQB 5LA6A 3A8TA 2XAFA 1GM8A 1JFFB 4RUEA 3JCZA 1VF7A 1I08A 5LHIA 3FB8C 3CC4V 3MDSA 1PM9A 1PNLA 5KUKA 4IYIA 1M9NA 2XOKG 1WB7A 1FXKA 1Q7YW 4JZ2A 4PJ0Z 2F93B 1Q6IA 3ASOB 1MABG 1X4TA 2B1IA 3LNMB 4I55A 3CC7V 1NI8A 4FFKA 3ZBHA 1WN7A 3ABMC 3BPZA 5KHKA 3K3WA 2YIBD 3W7UA 4RQFA 4J42A 2A9HA 1SQVH 1ZWIC 1XREA 3TJTA 1NTZH 1FFXB 5JJEB 1KKCA 2QKCA 3CMEV 1QLNA 3DTUB 1COWG 1VQNV 4UVBA 2EJRA 1H2MA 4FLVA 1O9HA 2ZNIA 3FYIB 4YY3O 2QKAA 2OCCC 3FB5C 4YHHB 5EBWC 1K8AW 1XI1A 2ATKC 4CH5A 1SQGA 1BSMA 1TAEA 1JR9A 1GN4A 3F7VC 3L72H 3T1HO 3HKDB 3JYCA 2PZSA 2JIZG 1BL8A 2YI8A 4DRXA 3RFRA 3OGIB 1DTOA 5LL6Y 1K73W 4JTAB 1JNBA 4IIJB 3L75H 3HR0A 1FXKB 4AQYB 4LF5B 4ZHQA 1YTFB 1KU9A 2HJDA 4PI0A 1AJNA 2HFEC 3AK3A 3LDCA 3U11A 1BCCH 2JJ1G 1QLEC 4J11A 4FJCC 2H3OA 1AR4A 2IW5A 1S5JA 3MD0A 4IT5A 1SESA 4E2LA 5D5PA 4B08A 5LGUA 2X6AA 1FOUA 1XUQA 2EULA 2OWOA 3A0HZ 1A32A 2N74A 5AG2A 4DXWA 2QM7A 4CH3A 4LF4O 2GTAA 3CCSV 4P9PA 4MT8A 1UJWB 2JGDB 1PKXA 2W0FC 4MVZA 3QO7A 1V54B 2KQXA 4TV8A 4DV4B 3HKCA 2VRZA 2Q73A 2EZPA 3DC5A 4WF9V 3E8HA 4QPKA 4BWAA 3E89A 4X64O 1JA8A 3SYAA 2BSKB 3BA8A 2ZCEA 3E8GA 1P4RA 1J5EO 3SPIA 1UPGA 2FL4A 4DRXB 4PA7A 2HHHB 5KHHA 4KUMA 4UFZA 4MTFA 1AVMA 4ZOLA 4ZKIA 1KYOF 2YDEA 4J9ZB 1GK9A 5J2UA 3G6BA 2PY5A 1ZAUA 2VQEB 5GTIZ 3R65A 2P4KA 2ZE5A 1Y4MA 4O4HB 2WPDG 3CC2V 2PUSA 2Q68A 2VQFB 1HR0B 3CRMA 3H1JH 3ZN1A 1BGYH 5KMGA 5LP6A 1XBLA 2CH7A 4JYCA 3K04A 3AG2B 3CWBH 1EN4A 2QGNA 5JQGA 1QU7A 2JS3A 2LGQA 3SJQC 2H94A 1SRYA 4KHPB 1SC5B 1GN2A 1ZL8A 3OTFA 4NTWA 3ZRWA 1NH2D 1H2LA 4TV8B 2B9ZA 2QTOA 2UU9B 3HKCB 4UV8A 4BIOA 1K34A 1MA1A 4JAAA 3N2KA 2LW7A 2C2AA 3MAQA 4LFBB 5EC1C 1KB9F 1H8HG 2WLNA 2F43G 4NXMO 4FLYA 1OHHG 5BZBA 2CK3G 3WG7B 1D5NA 4DR6B 3TXQA 4QE7A 2EIMC 5J2UB 3K9AA 4FVMA 3HKBA 4NTXA 4J7ZA 1ENVA 1JQ0A 2AHYA 2QWNB 3JSLA 2LFSA 1W2BU 4I50A 4Z1VA 4WBNA 2FTKA 3AG3B 1F4MA 2Q7EA 1JMKC 4DR7O 3OEEG 4X1IB 5IJ9A 3ABLC 2CAZC 4JI5O 1CEZA 2XASA 4X89A 4G28B 5KMGB 2GBOA 4DV5B 1S5LZ 3K79A 1V55B 5KX5A 1Q5OA 4J10A 4GKKB 3MHHC 3ML0A 2AHZA 4DR3B 1HNWO 5GW7A 1Y76A 4LFCO 4PA6A 3RBZA 4DO2A 1SERA 1L0NH 2YI9A 2RNBA 3X2QB 2UXCB 1AJQA 3BA9A 4JI0O 1ZL8B 1N4CA 3ZRWB 4K0KO 3JD3A 1IVSA 4Q20A 4DK0A 2QWPB 1KD1W 3N2KB 4MTXA 3AG4C 3ZHVA 5HFMA 5B3SB 4DW1A 4WFBV 2B5UA 1SKVA 4WFGA 2ZR2A 5GONB 1H8EG 2WA4A 4GZRB 2YXLA 1Q3EA 4JTDB 2CTRA 3OUFA 4ABMA 4JF3A 4I5SA 4L8JA 5BR8O 1M90W 1QCEA 4DV3B 5CMUA 2UUBO 4H37A 1WPXA 3E35A 1XHZA 5EC2C 4OX9B 1JJOA 3G80A 4JV5B 2JVDA 1Q6HA 3ETGA 4UCRA 4I50B 3ETEA 3KCXA 4DV0B 3SJCC 1XNQO 1OCRB 4TQDA 5IJ9B 2FKXA 2OTJV 1RPOA 4X66B 1IBKB 2JEUA 3STZC 5KX5B 3H1IH 5EZYA 2LJ2A 4FM0A 5CBFA 3ZMTA 3FAVB 4PDMA 1F4NA 5B1BB 3ZRSA 1Y76B 1DF5A 1K9MW 2JEXA 2DN9A 4MVOA 1OJHA 1OV9A 3WB2A 3F5TA 1KC8W 4LF8O 4TQFA 3T2MA 2ODMA 1R73A 3IAYA 4B3SB 1P84F 3W7XA 1US6A 1NVPD 2Y69C 4DK1A 4JI3O 5LMNO 3I55V 2DYSB 3CCVV 1FKAO 4X20A 4OXSA 2A0LA 4DV7B 3ZHRA 4O4LA 1NQTA 5K1PA 3W7TA 2KB1A 2IH3C 3SPCA 4D7TA 4EEQA 1VMGA 1EM1A 3B2EE 1CP9A 2ZXWB 3N2GA 3GB7C 1VQ7V 1HNXO 4FMTA 3A0BZ 1AJPA 1YJWV 4YJ3A 4HNAB 2E3CA 1PL0A 4BIZA 4MVMA 1Q81W 4CBCA 2YIBA 2YUAA 1OCZB 2F4VO 1QNMA 4N21A 1MNGA 4JAVA 5EZYB 1YCIA 3SYPA 3BFRA 1Q43A 4LNUA 4RO2A 3JAKA 5B1OA 2BTQA 1MOFA 1H2GA 1DGSA 1DK1A 1R3IC 5KA6A 1PV0A 1CPYA 1THZA 4XDKA 4I0XB 4P2ZA 4FPPA 3RYCB 2EIJB 3CJHA 5CA1A 3ASNB 5LGNA 5JJJB 1BT8A 3C3SA 4O4LB 1K5SA 4K8ZA 4JTCB 4KXRA 4TT3G 4JZGA 2CTPA 2Q4PA 4GYCB 3SYQA 2YSUB 3KG2A 5CN0A 1Y6XA 1WPBA 3N2GB 2NLJC 1AR5A 4FFBA 3CRAA 5IYZA 4YJ3B 3OT7A 2R72A 5KA5A 3SJAC 1JPXA 2IBZH 3RT3C 3F5WC 5B1AB 3ZEDA 5IT9N 1SQFA 4D6TH 2RMKB 4CS3A 1WLEA 4DV1O 3AG2C 1DLBA 2EBOA 1B06A 4WCEV 1JOYA 5ITZA 3TETA 4YY3B 2A06H 4YJ2A 3BAAA 5LYJA 4E4EA 4LNUB 3T1CA 2RJZA 2E5LO 2YIAA 4MTOA 3JAKB 1XMOO 3T1HB 1HW7A 5L3GA 1WP7A 3OW2U 3ZMZA 4GUNA 3IGAC 4IIJA 2KKWA 2OIGA 3A0RA 4WFAV 3OTOO 1IXBA 2R70A 4DV2O 4UCOA 1XOUA 3CJHB 5CA1B 3AG1C 1HWYA 3ABKB 5IDJA 3B8MA 3JCUZ 3D36A 4DR1O 2EIKB 1M5IA 1OCCB 1BMFG 4LF9O 3P3PA 2Q5ZA 3UKMA 3ZHUA 3GWKC 4CS4A 1M57B 3H1LH 1E1QG 3IC9A 4UUJC 3L70H 1VQ5V 4FFBB 5IYZB 3T1YO 3ZX6A 1EFRG 2JGDA 5C93A 1FAFA 1KKDA 4FIPC 5LP6C 1TUBB 4LF4B 2ZE8A 3F7YC 1MMMA 2Z5UA 2KG7B 3SR2C 5E1AC 3RW0A 3SJBC 2DOSA 5ITZB 3LDDA 3DGEA 4R6ZA 3RYHB 1JJ2U 1NR7A 1H2NA 2K9PA 3CMAV 4J41A 4H44B 1E1RG 2BSKA 4YJ2B 3B40A 3ZMVA 5LYJB 4YIPA 3G67A 4TV9B 4X64B 1P7GA 4JGSA 4CC6A 2UXDO 1J5EB 3ZHSA 5FNVA 1VQ6V 1I5XA 1R6KA 3OFNG 4JI1O 1NS1A 2WLIA 4JI8B 3RVYA 5LHGA 1RFYA 4MVQA 2M7WA 1SA0A 1OCOC 4O4HA 3D3IA 1FYJA 4IL6Z 2Q0AA 5IYBO 5CA3A 1RP3B 1IBLO 1YXBA 3ICXA 2QJ1A 2DYRB 4NVPA 1N36O 3L9DA 1PPJH 4DV6O 4HYOA 5EK0A 4PV1B 2P67A 1IX9A 4BR6A 4GX2A 4B3TO 2P6JA 4LF6O 4O4JA 3O65A 3EXAA 3OMNB 3UT5A 3UM7A 1LUWA 2IJIA 1Q86W 5JCOA 5CBHA 3IJ4A 1RM1C 3NXSA 1BQZA 2MK3A 4AILC 3J80N 5KUMA 3K5MA 3CCUV 4NYKA 1S72V 3OMAB 3FKSG 3ZHTA 2AXTZ 4H33A 1H38A 1PD3A 5L3FA 2V1DA 3W7SA 1F23A 1NTMH 4MW8A 1K7DA 4U3FH 4RWUA 1TVKB 2W0XA 2ZNJA 4LWSA 2EILB 3CP1A 1NH2B 2P5OA 5FNVB 4JI8O 2B1GA 3G71V 4NXMB 1S5HC 1Z2GA 1YTFD 5B5EZ 2PI5A 2WLIB 2UUAO 5LXTB 2CE4A 1EN6A 2PTMA 1LR1A 1SA0B 3RGBA 3L73H 2ZDIC 3OMIB 1HDJA 4X1IA 3PN1A 5LOVA 3LDEA 3CX5F 2Y48A 3RWRD 3WFVA 2XT9A 2WWWA 3FD9A 1YEWA 1SF9A 4DR7B 4JI5B 2QWQB 2HKOA 4MVSA 1Y66A 2F95B 4O4JB 1GTOA 1TA8A 4PDVA 3U0ZA 3UT5B 1OCZC 4MSWC 3S3XA 2CGOA 1HNWB 2LGWA 4LFCB 1IZ3A 1YJNV 2IU3A 1XDCA 4PA9A 4UB8Z 4LP8A 2EINC 4JI0B 4O2AB 1N33O 4GKJO 4K0KB 4FK5C 2XAJA 5GTHZ 4JI4O 2OYQA 4X1KA 1Q6UA 1MZFA 4LF7O 3CCQV 2Q9LA 5GONA 2YEVB 4F6EA 3JARB 2Q69A 2F66C 4LWSB 4TWKA 4FM1A 4LFAO 1SQPH 4NXNO 2G38A 1WP8A 2R9RB 3D3QA 5CBGA 2GUZB 3ZRVA 1FJGO 2VWKA 3LSQA 1RSOA 1GM9A 5BR8B 3RN4A 3ZS8C 2UUBB 2AZ2A 2IU0A 3ZRXA 5JVDA 5B1NA 2WAMA 4FZ1A 4DR5O 1ZTEA 5LOVB 2Y0IA 1G4YB 1XNQB 2UUCO 4ZI7B 1H5WA 3FAVA 2QR4A 3OR6C 5B1AC 3QVNA 1CXZB 1HNZO 3WU2Z 2Q7HA 2Q67A 4I9WA 1NU1H 3SYOA 3L71H 2VWJA 2O57A 3K58A 4BW5A 2PYJA 3AK1A 5L3DA 4LF8B 4F6RB 2IJHA 1KQSU 1K4CC 3JATA 1U96A 4X1KB 5H6QA 2ETNA 2X6BA 4JI3B 3S3WA 5LMNB 4AHCA 4LH6A 2WLKA 1ZUQA 3ZMSA 2BCCH 4R50A 3SPHA 3E22A 1ORQC 3ASOC 4BIUA 4DR2O 3LSUA 1M4UA 1NVPB 2QTSA 3ABKC 1RSOB 3JD2A 3QF7A 3BVOA 2NR5A 3IC7A 2EIKC 4DR4O 1ZX3A 1TUEB 3M99B 4HNAA 2CTWA 2DWDC 1HNXB 5FPRA 4EFEA 4PI2A 5IJ0A 4JAUA 3P3NA 1S3JA 2AW9A 3DC6A 1M57C 1QLEB 5JVDB 4Q6GA 2MW2B 1S77D 4F4LA 3R66A 1SQBH 4JI6O 2CUGA 2GTSA 4KL1A 2F4VB 4IHJB 1I0HA 1AR1B 2ITCC 2BTOA 1XMQO 4O4IA 1SS3A 2DMXA 1S76D 3RYIB 2HEPA 2WLLB 3J81N 1OZ0A 2FYUH 4J7JA 2XAHA 4JI2O 1YHQV 2P06A 4P30A 3VQYA 1YJ9V 1VQ4V 3M8AA 4EFBA 4U7NA 3SDLA 4I0XA 1N34O 3RYCA 5KHIA 3ZIAG 3JATB 4UB6Z 2WSSG 1AROP 1VF5B 2CDYA 3VQVA 1FS0G 1XL4A 2Y4UA 2ZM6O 2R9IA 1QVGU 1FXKC 3LUTB 5IY5B 1MSWD 1GKFA 3E22B 2WLHA 4UVCA 4CZZA 4PA3A 3T4DA 3OGCC 1Q82W 4B3MO 3VBBA 1R6TA 2Q8VA 4ZIBA 3D36C 2PF4E 4LR3A 3P32A 2LW1A 2QWOB 5HFLA 3VQXA 4MTGA 1DF4A 5IJ0B 5FPOA 2Q6AA 3IFXA 1E79G 1XILA 4RAIA 1U97A 3B77A 3TCUA 2L6LA 5A9GA 4YIOA 3ZN0A 1NKDA 2DQ0A 1EZJA 1D2DA 4DV1B 1Y67A 3HB3B 3ABTA 3CRRA 1V54C 4LH7A 3RVZA 4NKGB 2R9AA 4O4IB 2E5LB 5LGTA 1IXMA 1XMOB 3HPLC 3RYFA 1HP8A 1YF2A 4DW0A 3ETDA 2GV9A 1GMGA 4Z2WA 3MHSC 4PDRA 5KAFZ 1WA8B 4BAYA 4CC5A 4DUZO 2ZIMA 2EILC 3ZCCA 1Y74A 3OTOB 1MSDA 2BOCC 2IJKA 4DV2B 1P49A 3EVKA 2IH1C 1IDSA 4JPRA 5L3EA 3J7AU 4X62O 4L87A 4DR1B 1VF6A 4B3RO 1X59A 4JYYA 2DJVA 4B7EA 1QR9A 1R6NA 4LF9B 3N27A 1EBOA 1EN5A 2Q0OC 2EIMB 4WFHA 1VQ8V 3CE2A 4X1YA 4I9QA 1TUBA 1K4DC 4J7KA 3T1YB 1EZVH 2KG7A 1VIBA 2RCVA 1QQCA 1AI5A 1QR8A 3ABLB 2ZQMA 2N05A 3RYHA 5DN6G 2UXNA 3E86A 4UCVA 3ZJZA 1SZTA 5JCOC 4DUYO 4G27B 2M6YA 1YITV 2L35A 1Q8IA 1VQOV 4TV9A 1NBMG 3D8CA 3AEIA 2EZOA 1I94O 3GWOA 1V9PA 4B7KA 4JI7O 2ILMA 3RYFB 3QTCA 2UXDB 1G8MA 3OEHG 3CCEV 3WB1A 2QKSA 3AG4B 5DEDA 4JI1B 2E74B 1I5YA 1Y74B 1PNKA 2XNDG 1SETA 4O2BA 1G1XB 1KBHA 4FLWA 2LO1A 3WG7C 2D2CB 3CCRV 1WAZA 4W4LA 4OGQB 1XNRO 4JYAO 1FFTB 3KCYA 4PDLA 1IBLB 5LMUO 1N36B 4MVRA 4X8AA 4DV6B 5KAIZ 3AG3C 1N32O 3E2EA 4PD4F 4B3TB 3QO8A 1WNSA 4LF6B 2ZR3A 1Z5WA 4X1YB 2CGNA 3UO3A 1V55C 4H13B 1URFA 3K06A 5CA0B 4HBNA 1BZKA 1AI4A 1R3LC 3JSNA 4ICGA 1W0KG 5IWAO 2WLJA 3ABUA 1L8DA 1R3KC 2QEXV 2JDIG 1B6QA 3BHPA 1JX9A 3X2QC 1B04A 1AILA 4DYLA 3Q4HB 3FFQA 1TVKA 3JALB 4R8CA 4UCTA 4X65O 1FPOA 1R1BA 3K08A 5TISZ 3B8NA 4K35A 2UXBO 2V4DA 5B3SC 4LCUC 4PELA 4YXWG 1NZ6A 3E8FA 5IYCO 3VQWA 3CS5A 5JJNB 5LXTA 2Y69B 3U10A 3QO5A 4IGGA 3T4ZA 5LA6B 2UUAB 2EX3A 4O2BB 2QSAA 3VOUA 5KHJA 1YI2V 1H2KA 3BRCA 2ZE7A 4XDLA 3KZIZ 1QVFU 4RQEA 2YIDA 3OR7C 1LNQA 1BQ0A 2HG5C 3ETQA 1KP3A 3APOA 1Q90D 1G6UA 4I55B 2YXYA 1K5QA 3H9VA 2A3QA 4PA4A 1OCRC 2X6CA 2NN4A 5A2QN 4QNHB 5JH7A 4XBFA 2HVKC 4PHZA 3QNEA 4KP4A 3OM3B 1RPRA 3DXRA 5BMVA 4IYHA 2LQTA 2PGGA 5B1BC 2F23A 4O2AA 3CCLV 4QGPA 2P90A 1NR1A 4GX5A 2BOBC 3K57A 4YHHO 3C90A 4K3AA 1N33B 4GKJB 2YEVA 4NTYA 2W6IG 2A7WA 4JI4B 3JARA 5B66Z 5E79Z 4LF7B 2RN9A 2JS5A 4GCZA 4J9YB 1AI6A 4U3JA 2AGAA 1XHXA 2DYSC 2YS8A 3OE7G 3STLC 3G4SV 1ROPA 2GUZA 4LFAB 2HVJC 1VEWA 3B4SA 5EBMC 4NXNB 4CS2A 2GDSA 4RUFA 2GSMB 1FJGB 3SPGA 5IY5C 1FXVA 2YXHA 4EB6A 1VARA 3WB0A 4AQYO 3K5LA 4LF5O 1YDXA 4W4KA 2ZXWC 2JK5C 4UV9A 2RQ6A 2A79B 2DE0X 3TGUH 1VQ9V 4ZHQB 2DQ3A 1GN6A 4ZI7A 1BE3H 1QBZA 1TGOA 2X7RB 5F2VO 3AK2A 4DR5B 3H01A 2FB5A 2NNUA 1I7FA 4HZ3A 3TK1A 2UUCB 2ADPA 3K03A 3CCJV 5BY1A 5JH7B 4AI8A 3CXCU 1HNZB 4GX0A 3FB7C 3DXRB 4UVAA 5BMVB 4JASA 3CCMV 4GX1A 4F6RA 1T5EA 2UXXA 2OCHA 4R7CA 1IBMB 2OIEA 4UCSA 1O9GA 3JD1A 4DV4O 1D5AA 3K5NA 1M56B 3ZHQA 1KUQA 2DWEC 1F51A 1N0NA 2PYLA 2WA3A 1XQ8A 2IJJA 3APQA 1KP2A 2HJFC 1VQPV 1GN3A 3CD6V 2QM4A 1S0VA 4D7SA 1F7YA 5EIBC 4U3JB 3EFFK 5DM6V 1PP9H 2EIJC 3LSSA 2ZD9A 1P7BA 3ASNC 3KDRA 2D3OW 1WJZA 3K0DA 1YZBA 3CEIA 2HHHO 4FLUA 2ADQB 2IM9A 2P22C 3JD0A 3KKYA 4DR2B 3C3TA 3K9SA 4P9OA 5DECA 4GT1A 3JAWA 4UXNA 4EB6B 3AG1B 4CH4A 3O9OA 1N0JA 4DR4B 3TXSA 5H5NA 4EKWA 1PL4A 4ZOLB 4OPHA 2VQEO 3ABMB 1QHTA 2KSDA 3UQ8A 1K92A 4G2KA 4J80A 2VQFO 1HR0O 1MG1A 4IHJA 4JI6B 1VQLV 2ARHA 4JYBA 2CTQA 5C8YA 2AZ0A 3JAMN 4TUYA 3RYIA 2WLLA 2K1EA 3ZMUA 4H0LB 1PNMA 4ASUG 5J9PC 3JASA 1ZLZA 1XMQB 3I5DA 3L74H 1M1KW 5LP6B 2JGUA 4X9QA 1L0LH 2CH7B 2OCCB 1IBMO 4JI2B 4FLZA 3FB6C 5JQGB 1AI7A 4KHPO 5H9CA 1VP7A 4FLXA 4U7OA 3W7WA 1XEQA 2UU9O 2YICA 2BE3A 2Q7GA 1N34B 1Z5VA 1IURA 4ZBMA 1UFIA 3HKEA 4A5UB 3CHXA 3OAAG 3E8BA 4K8XA 4WFEA 2ZM6B 5JWPA 3A2FA 4LFBO 1GRJA 3E83A 3SPJA 3QG5A 1M93A 3P30A 5CB4A 2PI4A 2GHYA 5IE9A 3OD4A 4B3MB 1OCCC 2QA4V 1AB3A 3CRQA 3JAWB 4DR6O 3CXHF 1OCOB 4BW9A 1AP5A 1VF6C 3BEHA 2OTLV 2ZDIA 1ZSPA 1W59A 3EHBB 1IJGA 2HR3A 3HKBB 4MVUA 4LBEC 1GO3F 4N23A 4FZ0A 4DV5O 5LHHA 4WBNB 4TSFG 1SQQH 5C8YB 2ITDC 2JJ2G 4TUYB 3G6EV 3OUSA 1VQKV 4GKKO 1VQMV 3JASB 3UCSC 4FM2A 5IYDO 4DR3O 1K33A 1JVMA 1RM1B 2XAGA 3NR7A 5L3BA 1FXHA 3SYCA 4NB5A 3B09A 1WA8A 3JD4A 2LP7A 2FMLA 2UXCO 2EJ7A 5KLVH 1SQXH 2ZINA 1NTKH 4CH6A 1K97A 1R3JC 5LBQA 5H2FZ 4DUZB 4UCUA 4XDJA 5EBLC 4QJFB 4MW3A 3HKEB 4QPJA 1NJIW 2E76B 1MZEA 5H6RA 3K5OA 1BHBA 1BHAA 3SGIA 2Z3YA 4X62B 5CB4B 2ZE6A 4B3RB 1KMIZ 3CYOA 1W0JG 4DV3O 2DYRC 1H2SB 2V7QG 3GVMA 3CRCA 3K59A 5D5QA 2QDOA 4OX9O 3M7MX 2N04A 4JV5O 1SZXA 5EYPA
chains in the Genus database with same CATH topology
1MMMA 1N0NA 1GN3A 1AR5A 1AP5A 1MSDA 3OT7A 1ZTEA 3AK3A 3EVKA 4YIPA 3KDRA 1ZSPA 1IDSA 1EN4A 3CEIA 1EM1A 2CE4A 1I08A 2ADQB 1EN6A 1AR4A 3MDSA 1PM9A 3KKYA 1AP6A 3C3TA 3K9SA 1P7GA 4JYYA 1B06A 1WB7A 3QVNA 1LUVA 1GN2A 4JZ2A 2CDYA 1N0JA 1XUQA 1EN5A 4E4EA 1PL4A 5AG2A 1MA1A 1VEWA 4FFKA 3AK1A 2GDSA 4GUNA 1QNMA 1MNGA 2RCVA 1VARA 1XREA 3TJTA 3BFRA 1WB8A 1IXBA 3DC5A 1KKCA 1ZUQA 1ZLZA 1IX9A 1XDCA 4BR6A 2QKCA 1D5NA 1GN6A 1XILA 4X9QA 1JA8A 3AK2A 3LSUA 1LUWA 4C7UA 5A9GA 4YIOA 2QKAA 2ADPA 4F6EA 1Y67A 1BSMA 1AVMA 1JR9A 1GN4A 3IC9A 2AW9A 3DC6A 1BT8A 3C3SA 1BS3A 3RN4A 2P4KA 4JZGA 1SZXA 1I0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMM A;  1N0N A;  1GN3 A;  1AR5 A;  1AP5 A;  1MSD A;  3OT7 A;  1ZTE A;  3AK3 A;  3EVK A;  4YIP A;  1ZSP A;  1IDS A;  1EN4 A;  3CEI A;  1EM1 A;  2CE4 A;  1I08 A;  2ADQ B;  1EN6 A;  1AR4 A;  3MDS A;  1PM9 A;  3KKY A;  1AP6 A;  3C3T A;  3K9S A;  1P7G A;  4JYY A;  1B06 A;  1WB7 A;  3QVN A;  1LUV A;  1GN2 A;  4JZ2 A;  2CDY A;  1N0J A;  1XUQ A;  1EN5 A;  4E4E A;  1PL4 A;  5AG2 A;  1MA1 A;  1VEW A;  4FFK A;  3AK1 A;  2GDS A;  4GUN A;  1QNM A;  1MNG A;  2RCV A;  1VAR A;  1XRE A;  3TJT A;  3BFR A;  1WB8 A;  1IXB A;  3DC5 A;  1KKC A;  1ZUQ A;  1ZLZ A;  1IX9 A;  1XDC A;  4BR6 A;  2QKC A;  1D5N A;  1GN6 A;  1XIL A;  4X9Q A;  1JA8 A;  3AK2 A;  3LSU A;  1LUW A;  4C7U A;  5A9G A;  4YIO A;  2QKA A;  2ADP A;  4F6E A;  1Y67 A;  1BSM A;  1AVM A;  1JR9 A;  1GN4 A;  3IC9 A;  2AW9 A;  3DC6 A;  1BT8 A;  3C3S A;  1BS3 A;  3RN4 A;  2P4K A;  4JZG A;  1SZX A;  1I0H A; 
#chains in the Genus database with same CATH topology
 2OT5 A;  1J95 A;  3BAB A;  3PJS K;  4DV0 O;  2WLM A;  2JRI A;  4FLT A;  1JCH A;  5L3C A;  3CPW U;  1N8R W;  3DSQ A;  1L1F A;  2Z0A A;  1YVW A;  3UO2 A;  3I56 V;  4I4T A;  4X66 O;  2XUM A;  1IBK O;  4DUY B;  2Y0P A;  3K0G A;  4KFM A;  2VS0 A;  4QE9 A;  4HAM A;  1GH6 A;  2QWR B;  1AP6 A;  4Z1M G;  1B3Q A;  2P4V A;  1I94 B;  2HP8 A;  1K3E A;  4NR1 A;  4JI7 B;  1LUV A;  2QM8 A;  5J2T A;  2EIN B;  1JFF A;  4B3S O;  4MS2 A;  2XHB A;  2E75 B;  2RDC A;  4WFF A;  2P7T C;  2ZT9 B;  4DV7 O;  3H1K H;  4X20 B;  1WB8 A;  1YIJ V;  1XNR B;  4JYA B;  2XTA A;  2XAQ A;  3BY6 A;  1XL6 A;  5FLX N;  5LMU B;  3H1H H;  1GM7 A;  1NT2 B;  1N32 B;  4C7U A;  3BCC H;  2X0L A;  5CA0 A;  3THO A;  2W6J G;  5FL7 G;  1FFX A;  2YC0 A;  2H8P C;  4GLX A;  2ZIO A;  1GAX A;  5KHG A;  5EYP B;  2QE7 G;  4QIW F;  3CSX A;  3FYE B;  5IWA B;  3CB2 A;  2DW4 A;  2HLD G;  3Q4H A;  3LNN A;  1BS3 A;  4I4T B;  3JAL A;  2Y4T A;  4LC1 A;  5K1X A;  2ZKO A;  2LFR A;  3AG7 A;  4TOI A;  2F1M A;  4X65 B;  5EIB D;  3FX7 A;  3HKD A;  4I7Z B;  1M56 C;  2UXB B;  5BXZ A;  4X88 A;  5J2T B;  1KEC A;  1FD9 A;  1YSC A;  4OPA A;  2BTQ B;  5LA6 A;  3A8T A;  2XAF A;  1GM8 A;  1JFF B;  4RUE A;  3JCZ A;  1VF7 A;  1I08 A;  5LHI A;  3FB8 C;  3CC4 V;  3MDS A;  1PM9 A;  1PNL A;  5KUK A;  4IYI A;  1M9N A;  2XOK G;  1WB7 A;  1FXK A;  1Q7Y W;  4JZ2 A;  4PJ0 Z;  2F93 B;  1Q6I A;  3ASO B;  1MAB G;  1X4T A;  2B1I A;  3LNM B;  4I55 A;  3CC7 V;  1NI8 A;  4FFK A;  3ZBH A;  1WN7 A;  3ABM C;  3BPZ A;  5KHK A;  3K3W A;  2YIB D;  3W7U A;  4RQF A;  4J42 A;  2A9H A;  1SQV H;  1ZWI C;  1XRE A;  3TJT A;  1NTZ H;  1FFX B;  5JJE B;  1KKC A;  2QKC A;  3CME V;  1QLN A;  3DTU B;  1COW G;  1VQN V;  4UVB A;  2EJR A;  1H2M A;  4FLV A;  1O9H A;  2ZNI A;  3FYI B;  4YY3 O;  2QKA A;  2OCC C;  3FB5 C;  4YHH B;  5EBW C;  1K8A W;  1XI1 A;  2ATK C;  4CH5 A;  1SQG A;  1BSM A;  1TAE A;  1JR9 A;  1GN4 A;  3F7V C;  3L72 H;  3T1H O;  3HKD B;  3JYC A;  2PZS A;  2JIZ G;  1BL8 A;  2YI8 A;  4DRX A;  3RFR A;  3OGI B;  1DTO A;  5LL6 Y;  1K73 W;  4JTA B;  1JNB A;  4IIJ B;  3L75 H;  3HR0 A;  1FXK B;  4AQY B;  4LF5 B;  4ZHQ A;  1YTF B;  1KU9 A;  2HJD A;  4PI0 A;  1AJN A;  2HFE C;  3AK3 A;  3LDC A;  3U11 A;  1BCC H;  2JJ1 G;  1QLE C;  4J11 A;  4FJC C;  2H3O A;  1AR4 A;  2IW5 A;  1S5J A;  3MD0 A;  4IT5 A;  1SES A;  4E2L A;  5D5P A;  4B08 A;  5LGU A;  2X6A A;  1FOU A;  1XUQ A;  2EUL A;  2OWO A;  3A0H Z;  1A32 A;  2N74 A;  5AG2 A;  4DXW A;  2QM7 A;  4CH3 A;  4LF4 O;  2GTA A;  3CCS V;  4P9P A;  4MT8 A;  1UJW B;  2JGD B;  1PKX A;  2W0F C;  4MVZ A;  3QO7 A;  1V54 B;  2KQX A;  4TV8 A;  4DV4 B;  3HKC A;  2VRZ A;  2Q73 A;  2EZP A;  3DC5 A;  4WF9 V;  3E8H A;  4QPK A;  4BWA A;  3E89 A;  4X64 O;  1JA8 A;  3SYA A;  2BSK B;  3BA8 A;  2ZCE A;  3E8G A;  1P4R A;  1J5E O;  3SPI A;  1UPG A;  2FL4 A;  4DRX B;  4PA7 A;  2HHH B;  5KHH A;  4KUM A;  4UFZ A;  4MTF A;  1AVM A;  4ZOL A;  4ZKI A;  1KYO F;  2YDE A;  4J9Z B;  1GK9 A;  5J2U A;  3G6B A;  2PY5 A;  1ZAU A;  2VQE B;  5GTI Z;  3R65 A;  2P4K A;  2ZE5 A;  1Y4M A;  4O4H B;  2WPD G;  3CC2 V;  2PUS A;  2Q68 A;  2VQF B;  1HR0 B;  3CRM A;  3H1J H;  3ZN1 A;  1BGY H;  5KMG A;  5LP6 A;  1XBL A;  2CH7 A;  4JYC A;  3K04 A;  3AG2 B;  3CWB H;  1EN4 A;  2QGN A;  5JQG A;  1QU7 A;  2JS3 A;  2LGQ A;  3SJQ C;  2H94 A;  1SRY A;  4KHP B;  1SC5 B;  1GN2 A;  1ZL8 A;  3OTF A;  4NTW A;  3ZRW A;  1NH2 D;  1H2L A;  4TV8 B;  2B9Z A;  2QTO A;  2UU9 B;  3HKC B;  4UV8 A;  4BIO A;  1K34 A;  1MA1 A;  4JAA A;  3N2K A;  2LW7 A;  2C2A A;  3MAQ A;  4LFB B;  5EC1 C;  1KB9 F;  1H8H G;  2WLN A;  2F43 G;  4NXM O;  4FLY A;  1OHH G;  5BZB A;  2CK3 G;  3WG7 B;  1D5N A;  4DR6 B;  3TXQ A;  4QE7 A;  2EIM C;  5J2U B;  3K9A A;  4FVM A;  3HKB A;  4NTX A;  4J7Z A;  1ENV A;  1JQ0 A;  2AHY A;  2QWN B;  3JSL A;  2LFS A;  1W2B U;  4I50 A;  4Z1V A;  4WBN A;  2FTK A;  3AG3 B;  1F4M A;  2Q7E A;  1JMK C;  4DR7 O;  3OEE G;  4X1I B;  5IJ9 A;  3ABL C;  2CAZ C;  4JI5 O;  1CEZ A;  2XAS A;  4X89 A;  4G28 B;  5KMG B;  2GBO A;  4DV5 B;  1S5L Z;  3K79 A;  1V55 B;  5KX5 A;  1Q5O A;  4J10 A;  4GKK B;  3MHH C;  3ML0 A;  2AHZ A;  4DR3 B;  1HNW O;  5GW7 A;  1Y76 A;  4LFC O;  4PA6 A;  3RBZ A;  4DO2 A;  1SER A;  1L0N H;  2YI9 A;  2RNB A;  3X2Q B;  2UXC B;  1AJQ A;  3BA9 A;  4JI0 O;  1ZL8 B;  1N4C A;  3ZRW B;  4K0K O;  3JD3 A;  1IVS A;  4Q20 A;  4DK0 A;  2QWP B;  1KD1 W;  3N2K B;  4MTX A;  3AG4 C;  3ZHV A;  5HFM A;  5B3S B;  4DW1 A;  4WFB V;  2B5U A;  1SKV A;  4WFG A;  2ZR2 A;  5GON B;  1H8E G;  2WA4 A;  4GZR B;  2YXL A;  1Q3E A;  4JTD B;  2CTR A;  3OUF A;  4ABM A;  4JF3 A;  4I5S A;  4L8J A;  5BR8 O;  1M90 W;  1QCE A;  4DV3 B;  5CMU A;  2UUB O;  4H37 A;  1WPX A;  3E35 A;  1XHZ A;  5EC2 C;  4OX9 B;  1JJO A;  3G80 A;  4JV5 B;  2JVD A;  1Q6H A;  3ETG A;  4UCR A;  4I50 B;  3ETE A;  3KCX A;  4DV0 B;  3SJC C;  1XNQ O;  1OCR B;  4TQD A;  5IJ9 B;  2FKX A;  2OTJ V;  1RPO A;  4X66 B;  1IBK B;  2JEU A;  3STZ C;  5KX5 B;  3H1I H;  5EZY A;  2LJ2 A;  4FM0 A;  5CBF A;  3ZMT A;  3FAV B;  4PDM A;  1F4N A;  5B1B B;  3ZRS A;  1Y76 B;  1DF5 A;  1K9M W;  2JEX A;  2DN9 A;  4MVO A;  1OJH A;  1OV9 A;  3WB2 A;  3F5T A;  1KC8 W;  4LF8 O;  4TQF A;  3T2M A;  2ODM A;  1R73 A;  3IAY A;  4B3S B;  1P84 F;  3W7X A;  1US6 A;  1NVP D;  2Y69 C;  4DK1 A;  4JI3 O;  5LMN O;  3I55 V;  2DYS B;  3CCV V;  1FKA O;  4X20 A;  4OXS A;  2A0L A;  4DV7 B;  3ZHR A;  4O4L A;  1NQT A;  5K1P A;  3W7T A;  2KB1 A;  2IH3 C;  3SPC A;  4D7T A;  4EEQ A;  1VMG A;  1EM1 A;  3B2E E;  1CP9 A;  2ZXW B;  3N2G A;  3GB7 C;  1VQ7 V;  1HNX O;  4FMT A;  3A0B Z;  1AJP A;  1YJW V;  4YJ3 A;  4HNA B;  2E3C A;  1PL0 A;  4BIZ A;  4MVM A;  1Q81 W;  4CBC A;  2YIB A;  2YUA A;  1OCZ B;  2F4V O;  1QNM A;  4N21 A;  1MNG A;  4JAV A;  5EZY B;  1YCI A;  3SYP A;  3BFR A;  1Q43 A;  4LNU A;  4RO2 A;  3JAK A;  5B1O A;  2BTQ A;  1MOF A;  1H2G A;  1DGS A;  1DK1 A;  1R3I C;  5KA6 A;  1PV0 A;  1CPY A;  1THZ A;  4XDK A;  4I0X B;  4P2Z A;  4FPP A;  3RYC B;  2EIJ B;  3CJH A;  5CA1 A;  3ASN B;  5LGN A;  5JJJ B;  1BT8 A;  3C3S A;  4O4L B;  1K5S A;  4K8Z A;  4JTC B;  4KXR A;  4TT3 G;  4JZG A;  2CTP A;  2Q4P A;  4GYC B;  3SYQ A;  2YSU B;  3KG2 A;  5CN0 A;  1Y6X A;  1WPB A;  3N2G B;  2NLJ C;  1AR5 A;  4FFB A;  3CRA A;  5IYZ A;  4YJ3 B;  3OT7 A;  2R72 A;  5KA5 A;  3SJA C;  1JPX A;  2IBZ H;  3RT3 C;  3F5W C;  5B1A B;  3ZED A;  5IT9 N;  1SQF A;  4D6T H;  2RMK B;  4CS3 A;  1WLE A;  4DV1 O;  3AG2 C;  1DLB A;  2EBO A;  1B06 A;  4WCE V;  1JOY A;  5ITZ A;  3TET A;  4YY3 B;  2A06 H;  4YJ2 A;  3BAA A;  5LYJ A;  4E4E A;  4LNU B;  3T1C A;  2RJZ A;  2E5L O;  2YIA A;  4MTO A;  3JAK B;  1XMO O;  3T1H B;  1HW7 A;  5L3G A;  1WP7 A;  3OW2 U;  3ZMZ A;  4GUN A;  3IGA C;  4IIJ A;  2KKW A;  2OIG A;  3A0R A;  4WFA V;  3OTO O;  1IXB A;  2R70 A;  4DV2 O;  4UCO A;  1XOU A;  3CJH B;  5CA1 B;  3AG1 C;  1HWY A;  3ABK B;  5IDJ A;  3B8M A;  3JCU Z;  3D36 A;  4DR1 O;  2EIK B;  1M5I A;  1OCC B;  1BMF G;  4LF9 O;  3P3P A;  2Q5Z A;  3UKM A;  3ZHU A;  3GWK C;  4CS4 A;  1M57 B;  3H1L H;  1E1Q G;  3IC9 A;  4UUJ C;  3L70 H;  1VQ5 V;  4FFB B;  5IYZ B;  3T1Y O;  3ZX6 A;  1EFR G;  2JGD A;  5C93 A;  1FAF A;  1KKD A;  4FIP C;  5LP6 C;  1TUB B;  4LF4 B;  2ZE8 A;  3F7Y C;  1MMM A;  2Z5U A;  2KG7 B;  3SR2 C;  5E1A C;  3RW0 A;  3SJB C;  2DOS A;  5ITZ B;  3LDD A;  3DGE A;  4R6Z A;  3RYH B;  1JJ2 U;  1NR7 A;  1H2N A;  2K9P A;  3CMA V;  4J41 A;  4H44 B;  1E1R G;  2BSK A;  4YJ2 B;  3B40 A;  3ZMV A;  5LYJ B;  4YIP A;  3G67 A;  4TV9 B;  4X64 B;  1P7G A;  4JGS A;  4CC6 A;  2UXD O;  1J5E B;  3ZHS A;  5FNV A;  1VQ6 V;  1I5X A;  1R6K A;  3OFN G;  4JI1 O;  1NS1 A;  2WLI A;  4JI8 B;  3RVY A;  5LHG A;  1RFY A;  4MVQ A;  2M7W A;  1SA0 A;  1OCO C;  4O4H A;  3D3I A;  1FYJ A;  4IL6 Z;  2Q0A A;  5IYB O;  5CA3 A;  1RP3 B;  1IBL O;  1YXB A;  3ICX A;  2QJ1 A;  2DYR B;  4NVP A;  1N36 O;  3L9D A;  1PPJ H;  4DV6 O;  4HYO A;  5EK0 A;  4PV1 B;  2P67 A;  1IX9 A;  4BR6 A;  4GX2 A;  4B3T O;  2P6J A;  4LF6 O;  4O4J A;  3O65 A;  3EXA A;  3OMN B;  3UT5 A;  3UM7 A;  1LUW A;  2IJI A;  1Q86 W;  5JCO A;  5CBH A;  3IJ4 A;  1RM1 C;  3NXS A;  1BQZ A;  2MK3 A;  4AIL C;  3J80 N;  5KUM A;  3K5M A;  3CCU V;  4NYK A;  1S72 V;  3OMA B;  3FKS G;  3ZHT A;  2AXT Z;  4H33 A;  1H38 A;  1PD3 A;  5L3F A;  2V1D A;  3W7S A;  1F23 A;  1NTM H;  4MW8 A;  1K7D A;  4U3F H;  4RWU A;  1TVK B;  2W0X A;  2ZNJ A;  4LWS A;  2EIL B;  3CP1 A;  1NH2 B;  2P5O A;  5FNV B;  4JI8 O;  2B1G A;  3G71 V;  4NXM B;  1S5H C;  1Z2G A;  1YTF D;  5B5E Z;  2PI5 A;  2WLI B;  2UUA O;  5LXT B;  2CE4 A;  1EN6 A;  2PTM A;  1LR1 A;  1SA0 B;  3RGB A;  3L73 H;  2ZDI C;  3OMI B;  1HDJ A;  4X1I A;  3PN1 A;  5LOV A;  3LDE A;  3CX5 F;  2Y48 A;  3RWR D;  3WFV A;  2XT9 A;  2WWW A;  3FD9 A;  1YEW A;  1SF9 A;  4DR7 B;  4JI5 B;  2QWQ B;  2HKO A;  4MVS A;  1Y66 A;  2F95 B;  4O4J B;  1GTO A;  1TA8 A;  4PDV A;  3U0Z A;  3UT5 B;  1OCZ C;  4MSW C;  3S3X A;  2CGO A;  1HNW B;  2LGW A;  4LFC B;  1IZ3 A;  1YJN V;  2IU3 A;  1XDC A;  4PA9 A;  4UB8 Z;  4LP8 A;  2EIN C;  4JI0 B;  4O2A B;  1N33 O;  4GKJ O;  4K0K B;  4FK5 C;  2XAJ A;  5GTH Z;  4JI4 O;  2OYQ A;  4X1K A;  1Q6U A;  1MZF A;  4LF7 O;  3CCQ V;  2Q9L A;  5GON A;  2YEV B;  4F6E A;  3JAR B;  2Q69 A;  2F66 C;  4LWS B;  4TWK A;  4FM1 A;  4LFA O;  1SQP H;  4NXN O;  2G38 A;  1WP8 A;  2R9R B;  3D3Q A;  5CBG A;  2GUZ B;  3ZRV A;  1FJG O;  2VWK A;  3LSQ A;  1RSO A;  1GM9 A;  5BR8 B;  3RN4 A;  3ZS8 C;  2UUB B;  2AZ2 A;  2IU0 A;  3ZRX A;  5JVD A;  5B1N A;  2WAM A;  4FZ1 A;  4DR5 O;  1ZTE A;  5LOV B;  2Y0I A;  1G4Y B;  1XNQ B;  2UUC O;  4ZI7 B;  1H5W A;  3FAV A;  2QR4 A;  3OR6 C;  5B1A C;  3QVN A;  1CXZ B;  1HNZ O;  3WU2 Z;  2Q7H A;  2Q67 A;  4I9W A;  1NU1 H;  3SYO A;  3L71 H;  2VWJ A;  2O57 A;  3K58 A;  4BW5 A;  2PYJ A;  3AK1 A;  5L3D A;  4LF8 B;  4F6R B;  2IJH A;  1KQS U;  1K4C C;  3JAT A;  1U96 A;  4X1K B;  5H6Q A;  2ETN A;  2X6B A;  4JI3 B;  3S3W A;  5LMN B;  4AHC A;  4LH6 A;  2WLK A;  1ZUQ A;  3ZMS A;  2BCC H;  4R50 A;  3SPH A;  3E22 A;  1ORQ C;  3ASO C;  4BIU A;  4DR2 O;  3LSU A;  1M4U A;  1NVP B;  2QTS A;  3ABK C;  1RSO B;  3JD2 A;  3QF7 A;  3BVO A;  2NR5 A;  3IC7 A;  2EIK C;  4DR4 O;  1ZX3 A;  1TUE B;  3M99 B;  4HNA A;  2CTW A;  2DWD C;  1HNX B;  5FPR A;  4EFE A;  4PI2 A;  5IJ0 A;  4JAU A;  3P3N A;  1S3J A;  2AW9 A;  3DC6 A;  1M57 C;  1QLE B;  5JVD B;  4Q6G A;  2MW2 B;  1S77 D;  4F4L A;  3R66 A;  1SQB H;  4JI6 O;  2CUG A;  2GTS A;  4KL1 A;  2F4V B;  4IHJ B;  1I0H A;  1AR1 B;  2ITC C;  2BTO A;  1XMQ O;  4O4I A;  1SS3 A;  2DMX A;  1S76 D;  3RYI B;  2HEP A;  2WLL B;  3J81 N;  1OZ0 A;  2FYU H;  4J7J A;  2XAH A;  4JI2 O;  1YHQ V;  2P06 A;  4P30 A;  3VQY A;  1YJ9 V;  1VQ4 V;  3M8A A;  4EFB A;  4U7N A;  3SDL A;  4I0X A;  1N34 O;  3RYC A;  5KHI A;  3ZIA G;  3JAT B;  4UB6 Z;  2WSS G;  1ARO P;  1VF5 B;  2CDY A;  3VQV A;  1FS0 G;  1XL4 A;  2Y4U A;  2ZM6 O;  2R9I A;  1QVG U;  1FXK C;  3LUT B;  5IY5 B;  1MSW D;  1GKF A;  3E22 B;  2WLH A;  4UVC A;  4CZZ A;  4PA3 A;  3T4D A;  3OGC C;  1Q82 W;  4B3M O;  3VBB A;  1R6T A;  2Q8V A;  4ZIB A;  3D36 C;  2PF4 E;  4LR3 A;  3P32 A;  2LW1 A;  2QWO B;  5HFL A;  3VQX A;  4MTG A;  1DF4 A;  5IJ0 B;  5FPO A;  2Q6A A;  3IFX A;  1E79 G;  1XIL A;  4RAI A;  1U97 A;  3B77 A;  3TCU A;  2L6L A;  5A9G A;  4YIO A;  3ZN0 A;  1NKD A;  2DQ0 A;  1EZJ A;  1D2D A;  4DV1 B;  1Y67 A;  3HB3 B;  3ABT A;  3CRR A;  1V54 C;  4LH7 A;  3RVZ A;  4NKG B;  2R9A A;  4O4I B;  2E5L B;  5LGT A;  1IXM A;  1XMO B;  3HPL C;  3RYF A;  1HP8 A;  1YF2 A;  4DW0 A;  3ETD A;  2GV9 A;  1GMG A;  4Z2W A;  3MHS C;  4PDR A;  5KAF Z;  1WA8 B;  4BAY A;  4CC5 A;  4DUZ O;  2ZIM A;  2EIL C;  3ZCC A;  1Y74 A;  3OTO B;  1MSD A;  2BOC C;  2IJK A;  4DV2 B;  1P49 A;  3EVK A;  2IH1 C;  1IDS A;  4JPR A;  5L3E A;  3J7A U;  4X62 O;  4L87 A;  4DR1 B;  1VF6 A;  4B3R O;  1X59 A;  4JYY A;  2DJV A;  4B7E A;  1QR9 A;  1R6N A;  4LF9 B;  3N27 A;  1EBO A;  1EN5 A;  2Q0O C;  2EIM B;  4WFH A;  1VQ8 V;  3CE2 A;  4X1Y A;  4I9Q A;  1TUB A;  1K4D C;  4J7K A;  3T1Y B;  1EZV H;  2KG7 A;  1VIB A;  2RCV A;  1QQC A;  1AI5 A;  1QR8 A;  3ABL B;  2ZQM A;  2N05 A;  3RYH A;  5DN6 G;  2UXN A;  3E86 A;  4UCV A;  3ZJZ A;  1SZT A;  5JCO C;  4DUY O;  4G27 B;  2M6Y A;  1YIT V;  2L35 A;  1Q8I A;  1VQO V;  4TV9 A;  1NBM G;  3D8C A;  3AEI A;  2EZO A;  1I94 O;  3GWO A;  1V9P A;  4B7K A;  4JI7 O;  2ILM A;  3RYF B;  3QTC A;  2UXD B;  1G8M A;  3OEH G;  3CCE V;  3WB1 A;  2QKS A;  3AG4 B;  5DED A;  4JI1 B;  2E74 B;  1I5Y A;  1Y74 B;  1PNK A;  2XND G;  1SET A;  4O2B A;  1G1X B;  1KBH A;  4FLW A;  2LO1 A;  3WG7 C;  2D2C B;  3CCR V;  1WAZ A;  4W4L A;  4OGQ B;  1XNR O;  4JYA O;  1FFT B;  3KCY A;  4PDL A;  1IBL B;  5LMU O;  1N36 B;  4MVR A;  4X8A A;  4DV6 B;  5KAI Z;  3AG3 C;  1N32 O;  3E2E A;  4PD4 F;  4B3T B;  3QO8 A;  1WNS A;  4LF6 B;  2ZR3 A;  1Z5W A;  4X1Y B;  2CGN A;  3UO3 A;  1V55 C;  4H13 B;  1URF A;  3K06 A;  5CA0 B;  4HBN A;  1BZK A;  1AI4 A;  1R3L C;  3JSN A;  4ICG A;  1W0K G;  5IWA O;  2WLJ A;  3ABU A;  1L8D A;  1R3K C;  2QEX V;  2JDI G;  1B6Q A;  3BHP A;  1JX9 A;  3X2Q C;  1B04 A;  1AIL A;  4DYL A;  3Q4H B;  3FFQ A;  1TVK A;  3JAL B;  4R8C A;  4UCT A;  4X65 O;  1FPO A;  1R1B A;  3K08 A;  5TIS Z;  3B8N A;  4K35 A;  2UXB O;  2V4D A;  5B3S C;  4LCU C;  4PEL A;  4YXW G;  1NZ6 A;  3E8F A;  5IYC O;  3VQW A;  3CS5 A;  5JJN B;  5LXT A;  2Y69 B;  3U10 A;  3QO5 A;  4IGG A;  3T4Z A;  5LA6 B;  2UUA B;  2EX3 A;  4O2B B;  2QSA A;  3VOU A;  5KHJ A;  1YI2 V;  1H2K A;  3BRC A;  2ZE7 A;  4XDL A;  3KZI Z;  1QVF U;  4RQE A;  2YID A;  3OR7 C;  1LNQ A;  1BQ0 A;  2HG5 C;  3ETQ A;  1KP3 A;  3APO A;  1Q90 D;  1G6U A;  4I55 B;  2YXY A;  1K5Q A;  3H9V A;  2A3Q A;  4PA4 A;  1OCR C;  2X6C A;  2NN4 A;  5A2Q N;  4QNH B;  5JH7 A;  4XBF A;  2HVK C;  4PHZ A;  3QNE A;  4KP4 A;  3OM3 B;  1RPR A;  3DXR A;  5BMV A;  4IYH A;  2LQT A;  2PGG A;  5B1B C;  2F23 A;  4O2A A;  3CCL V;  4QGP A;  2P90 A;  1NR1 A;  4GX5 A;  2BOB C;  3K57 A;  4YHH O;  3C90 A;  4K3A A;  1N33 B;  4GKJ B;  2YEV A;  4NTY A;  2W6I G;  2A7W A;  4JI4 B;  3JAR A;  5B66 Z;  5E79 Z;  4LF7 B;  2RN9 A;  2JS5 A;  4GCZ A;  4J9Y B;  1AI6 A;  4U3J A;  2AGA A;  1XHX A;  2DYS C;  2YS8 A;  3OE7 G;  3STL C;  3G4S V;  1ROP A;  2GUZ A;  4LFA B;  2HVJ C;  1VEW A;  3B4S A;  5EBM C;  4NXN B;  4CS2 A;  2GDS A;  4RUF A;  2GSM B;  1FJG B;  3SPG A;  5IY5 C;  1FXV A;  2YXH A;  4EB6 A;  1VAR A;  3WB0 A;  4AQY O;  3K5L A;  4LF5 O;  1YDX A;  4W4K A;  2ZXW C;  2JK5 C;  4UV9 A;  2RQ6 A;  2A79 B;  2DE0 X;  3TGU H;  1VQ9 V;  4ZHQ B;  2DQ3 A;  1GN6 A;  4ZI7 A;  1BE3 H;  1QBZ A;  1TGO A;  2X7R B;  5F2V O;  3AK2 A;  4DR5 B;  3H01 A;  2FB5 A;  2NNU A;  1I7F A;  4HZ3 A;  3TK1 A;  2UUC B;  2ADP A;  3K03 A;  3CCJ V;  5BY1 A;  5JH7 B;  4AI8 A;  3CXC U;  1HNZ B;  4GX0 A;  3FB7 C;  3DXR B;  4UVA A;  5BMV B;  4JAS A;  3CCM V;  4GX1 A;  4F6R A;  1T5E A;  2UXX A;  2OCH A;  4R7C A;  1IBM B;  2OIE A;  4UCS A;  1O9G A;  3JD1 A;  4DV4 O;  1D5A A;  3K5N A;  1M56 B;  3ZHQ A;  1KUQ A;  2DWE C;  1F51 A;  1N0N A;  2PYL A;  2WA3 A;  1XQ8 A;  2IJJ A;  3APQ A;  1KP2 A;  2HJF C;  1VQP V;  1GN3 A;  3CD6 V;  2QM4 A;  1S0V A;  4D7S A;  1F7Y A;  5EIB C;  4U3J B;  3EFF K;  5DM6 V;  1PP9 H;  2EIJ C;  3LSS A;  2ZD9 A;  1P7B A;  3ASN C;  3KDR A;  2D3O W;  1WJZ A;  3K0D A;  1YZB A;  3CEI A;  2HHH O;  4FLU A;  2ADQ B;  2IM9 A;  2P22 C;  3JD0 A;  3KKY A;  4DR2 B;  3C3T A;  3K9S A;  4P9O A;  5DEC A;  4GT1 A;  3JAW A;  4UXN A;  4EB6 B;  3AG1 B;  4CH4 A;  3O9O A;  1N0J A;  4DR4 B;  3TXS A;  5H5N A;  4EKW A;  1PL4 A;  4ZOL B;  4OPH A;  2VQE O;  3ABM B;  1QHT A;  2KSD A;  3UQ8 A;  1K92 A;  4G2K A;  4J80 A;  2VQF O;  1HR0 O;  1MG1 A;  4IHJ A;  4JI6 B;  1VQL V;  2ARH A;  4JYB A;  2CTQ A;  5C8Y A;  2AZ0 A;  3JAM N;  4TUY A;  3RYI A;  2WLL A;  2K1E A;  3ZMU A;  4H0L B;  1PNM A;  4ASU G;  5J9P C;  3JAS A;  1ZLZ A;  1XMQ B;  3I5D A;  3L74 H;  1M1K W;  5LP6 B;  2JGU A;  4X9Q A;  1L0L H;  2CH7 B;  2OCC B;  1IBM O;  4JI2 B;  4FLZ A;  3FB6 C;  5JQG B;  1AI7 A;  4KHP O;  5H9C A;  1VP7 A;  4FLX A;  4U7O A;  3W7W A;  1XEQ A;  2UU9 O;  2YIC A;  2BE3 A;  2Q7G A;  1N34 B;  1Z5V A;  1IUR A;  4ZBM A;  1UFI A;  3HKE A;  4A5U B;  3CHX A;  3OAA G;  3E8B A;  4K8X A;  4WFE A;  2ZM6 B;  5JWP A;  3A2F A;  4LFB O;  1GRJ A;  3E83 A;  3SPJ A;  3QG5 A;  1M93 A;  3P30 A;  5CB4 A;  2PI4 A;  2GHY A;  5IE9 A;  3OD4 A;  4B3M B;  1OCC C;  2QA4 V;  1AB3 A;  3CRQ A;  3JAW B;  4DR6 O;  3CXH F;  1OCO B;  4BW9 A;  1AP5 A;  1VF6 C;  3BEH A;  2OTL V;  2ZDI A;  1ZSP A;  1W59 A;  3EHB B;  1IJG A;  2HR3 A;  3HKB B;  4MVU A;  4LBE C;  1GO3 F;  4N23 A;  4FZ0 A;  4DV5 O;  5LHH A;  4WBN B;  4TSF G;  1SQQ H;  5C8Y B;  2ITD C;  2JJ2 G;  4TUY B;  3G6E V;  3OUS A;  1VQK V;  4GKK O;  1VQM V;  3JAS B;  3UCS C;  4FM2 A;  5IYD O;  4DR3 O;  1K33 A;  1JVM A;  1RM1 B;  2XAG A;  3NR7 A;  5L3B A;  1FXH A;  3SYC A;  4NB5 A;  3B09 A;  1WA8 A;  3JD4 A;  2LP7 A;  2FML A;  2UXC O;  2EJ7 A;  5KLV H;  1SQX H;  2ZIN A;  1NTK H;  4CH6 A;  1K97 A;  1R3J C;  5LBQ A;  5H2F Z;  4DUZ B;  4UCU A;  4XDJ A;  5EBL C;  4QJF B;  4MW3 A;  3HKE B;  4QPJ A;  1NJI W;  2E76 B;  1MZE A;  5H6R A;  3K5O A;  1BHB A;  1BHA A;  3SGI A;  2Z3Y A;  4X62 B;  5CB4 B;  2ZE6 A;  4B3R B;  1KMI Z;  3CYO A;  1W0J G;  4DV3 O;  2DYR C;  1H2S B;  2V7Q G;  3GVM A;  3CRC A;  3K59 A;  5D5Q A;  2QDO A;  4OX9 O;  3M7M X;  2N04 A;  4JV5 O;  1SZX A;  5EYP A; 
#chains in the Genus database with same CATH homology
 1MMM A;  1N0N A;  1GN3 A;  1AR5 A;  1AP5 A;  1MSD A;  3OT7 A;  1ZTE A;  3AK3 A;  3EVK A;  4YIP A;  3KDR A;  1ZSP A;  1IDS A;  1EN4 A;  3CEI A;  1EM1 A;  2CE4 A;  1I08 A;  2ADQ B;  1EN6 A;  1AR4 A;  3MDS A;  1PM9 A;  3KKY A;  1AP6 A;  3C3T A;  3K9S A;  1P7G A;  4JYY A;  1B06 A;  1WB7 A;  3QVN A;  1LUV A;  1GN2 A;  4JZ2 A;  2CDY A;  1N0J A;  1XUQ A;  1EN5 A;  4E4E A;  1PL4 A;  5AG2 A;  1MA1 A;  1VEW A;  4FFK A;  3AK1 A;  2GDS A;  4GUN A;  1QNM A;  1MNG A;  2RCV A;  1VAR A;  1XRE A;  3TJT A;  3BFR A;  1WB8 A;  1IXB A;  3DC5 A;  1KKC A;  1ZUQ A;  1ZLZ A;  1IX9 A;  1XDC A;  4BR6 A;  2QKC A;  1D5N A;  1GN6 A;  1XIL A;  4X9Q A;  1JA8 A;  3AK2 A;  3LSU A;  1LUW A;  4C7U A;  5A9G A;  4YIO A;  2QKA A;  2ADP A;  4F6E A;  1Y67 A;  1BSM A;  1AVM A;  1JR9 A;  1GN4 A;  3IC9 A;  2AW9 A;  3DC6 A;  1BT8 A;  3C3S A;  1BS3 A;  3RN4 A;  2P4K A;  4JZG A;  1SZX A;  1I0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...