1XDCA

Hydrogen bonding in human manganese superoxide dismutase containing 3-fluorotyrosine
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
198
structure length
189
Chain Sequence
KHSLPDLPDGALEPHINAQIMQLHHSKHHAAVNNLNVTEEKQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHALQKNVRPDLKAIWNVINWENVTERMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Hydrogen bonding in human manganese superoxide dismutase containing 3-fluorotyrosine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 59
structure length 189
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1xdcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1xdcA02
2CDYA 1Y67A 1EN5A 4X9QA 1LUWA 1BSMA 2QKCA 3RN4A 4YIOA 1GN6A 4GUNA 2ADPA 1BT8A 1XILA 1MA1A 3C3SA 2QKAA 1XUQA 1MNGA 4JYYA 4BR6A 1PM9A 1EM1A 1N0NA 1ZTEA 3AK2A 3CEIA 5AG2A 3AK3A 3AK1A 3DC5A 1IDSA 1GN2A 3LSUA 3MDSA 1VARA 1QNMA 1I0HA 1GN3A 4JZGA 3KKYA 1JA8A 1EN4A 4FFKA 1GN4A 2CE4A 1I08A 3DC6A 1SZXA 1MMMA 3EVKA 2P4KA 1AP5A 3C3TA 4F6EA 1WB8A 2AW9A 1JR9A 1PL4A 2ADQB 1ZSPA 1WB7A 3IC9A 2GDSA 1AVMA 4E4EA 5A9GA 2RCVA 1P7GA 1XDCA 1D5NA 1EN6A 3BFRA 1KKCA 3QVNA 3OT7A 1AR5A 4YIPA 1LUVA 1BS3A 1AP6A 1IX9A 1XREA 1N0JA 4C7UA 1IXBA 3K9SA 1AR4A 1VEWA 1ZLZA 3TJTA 4JZ2A 1B06A 1MSDA 1ZUQA
chains in the Genus database with same CATH superfamily
4I55A 1KU9A 3SPIA 1EN5A 4JYAB 1BSMA 1XL4A 1RPRA 3OM3B 4JTCB 4YIOA 4DR3B 2QJ1A 3CCRV 2B1GA 3K59A 1Q86W 1DF5A 3F5WC 3ZHRA 3VQXA 5KX5A 4DUZO 3FYIB 2BTQA 3FX7A 4X88A 3AK1A 3CCSV 3S3XA 1HDJA 3APQA 2JEUA 3VQYA 1L0NH 3J7AU 3SPGA 2WLKA 4UCTA 2LGWA 2IH1C 3FB7C 2XT9A 5IY5C 4BW9A 2ZDIA 3UCSC 3OTOB 1MZFA 2LQTA 1FPOA 1Y66A 1AP5A 3SYPA 1W59A 1R3JC 1VQ8V 2IJHA 1KP2A 3ZMUA 1Y74A 5IY5B 2E74B 1YSCA 4X1YA 2UXDO 1IZ3A 5LHHA 1PL4A 3FAVA 2ADQB 5BMVB 4CS4A 1GK9A 1OHHG 4X64O 1OJHA 3K04A 3D3QA 5EC1C 4LF9O 2ZD9A 1XMOO 1IVSA 1AP6A 2Q7HA 5LMNO 3W7WA 1WNSA 4U3JB 3C90A 1N0JA 2IM9A 2P6JA 4HNAB 3K9SA 3CS5A 3SYCA 1AR4A 1VEWA 5IWAO 1H2KA 3B4SA 4JI3O 3QTCA 4UV8A 3F5TA 4B3SB 4UB6Z 4MVQA 1G4YB 3K5NA 3FD9A 4UVBA 3RWRD 1TGOA 4ZOLB 2KG7B 3M99B 1PV0A 5IJ9B 5H5NA 1MSWD 4DV4O 3DXRB 5JJJB 3I55V 2MW2B 1HNXB 1E1RG 4FLVA 3K0DA 4O2AB 4JAVA 4JGSA 4I0XB 4MT8A 3VBBA 5IDJA 3SPCA 2A3QA 1K9MW 1XNRB 1DTOA 3LSUA 2OT5A 1MZEA 3E89A 3RGBA 2QEXV 1F4MA 1QNMA 1K4DC 1R3IC 2FTKA 2XAQA 3BAAA 5LMUB 1S0VA 2LGQA 1GN4A 4P9PA 2IH3C 1YITV 1QVFU 3UT5B 5C8YB 3ASOC 4L8JA 3CJHB 2UXBO 2QWQB 4LNUB 4DV2O 3LDEA 3K58A 3ZRXA 1JVMA 1SQQH 3JAWB 3ASOB 1ORQC 1HR0O 2DQ3A 2WPDG 4DV1B 2UXCO 5GW7A 3ETEA 4YHHO 2E3CA 4DR2O 4CH3A 4JI6O 2UU9O 3ICXA 1K3EA 3H1IH 3JARA 4KXRA 3G6EV 4X1IB 4UCOA 4MTXA 1P7GA 3LSSA 1AI7A 4MSWC 3ZMSA 4WFHA 4CZZA 1JOYA 5KHHA 1JFFA 1MG1A 4O4HA 1AR5A 3ZMVA 3ZN1A 2F43G 3U11A 2UUCO 3D36A 3SJBC 1QLEC 4PDRA 1R6KA 2A79B 4R6ZA 3TETA 2JGDA 1QLNA 3B8MA 3MHSC 2ZXWB 1SESA 2KB1A 3FFQA 1JJ2U 1B06A 2KKWA 3D3IA 4ASUG 2P67A 2ZR2A 4DV7O 4JASA 4QNHB 3ASNB 3SJCC 4U3JA 3CRMA 4CC5A 3SGIA 4X65O 5LXTB 3UQ8A 1R73A 1SRYA 4NXMO 4KUMA 5BY1A 5LL6Y 1I5YA 3HKCB 2W0XA 3HKDB 4NTYA 2KG7A 5IJ9A 3RVYA 2XHBA 2Q69A 2QTOA 1K73W 4EB6B 4LFCO 4J7KA 4TWKA 1H2GA 3OFNG 4QPKA 3JALB 4I0XA 1YCIA 2QR4A 1P4RA 2N04A 5JJEB 3L74H 1IBMB 1SZXA 4DR1O 1EBOA 3ETDA 2HJDA 1QBZA 3KCXA 3ZMTA 4BW5A 1FJGO 4K0KB 1JPXA 4YJ3B 1Q8IA 2A0LA 4DV3O 4WFBV 3ZN0A 2VS0A 4PDMA 1H8HG 2XUMA 2GDSA 2E5LB 1W0JG 3JD1A 4K3AA 5JVDA 4YJ2A 4UV9A 1PNLA 2HJFC 2R70A 1O9HA 1KECA 2ARHA 4LF4B 4WCEV 3OW2U 1XL6A 2WLLA 3B77A 1PPJH 4AQYB 4MVRA 4UFZA 4HAMA 3JCZA 3F7YC 2XASA 1ZL8B 2F1MA 4X1IA 4LF7O 4GYCB 4CH6A 4LF6O 4FFBA 4TUYA 3WB2A 1OCCB 4U7OA 4UB8Z 2QM8A 1R1BA 1VF6C 5LGNA 1FFXA 1N34B 1RSOB 3OMNB 3AG7A 3SR2C 4DR4O 3OD4A 1N33B 4AHCA 1VP7A 3JASB 4LF5O 2OTLV 4JAUA 1VQLV 4J9YB 1SQGA 1MNGA 1IBLB 1X4TA 2OCCB 1FXKC 4F6RB 4I4TB 2OTJV 2UXXA 3AK3A 4J41A 1J5EO 3DC5A 3AG2C 2ZM6O 2ZE7A 4IIJB 3W7XA 2WLMA 1FXKB 1P49A 3E22A 3WFVA 5EYPA 1KUQA 1E1QG 5J2UA 1V54C 2Y69C 3FKSG 1YJWV 4JYBA 3LDDA 2RDCA 3BEHA 1V54B 3UO2A 2Y69B 3G67A 2DWEC 3JALA 3RYHB 4XDKA 2EIKC 4P30A 2EJRA 3BRCA 4DR7O 4MTFA 3L73H 1AJQA 1H2SB 1KB9F 1SF9A 3N2KA 4W4KA 2OCHA 1VQKV 4JI5O 3K06A 3CX5F 3A0BZ 2CAZC 2KSDA 1EZJA 1IX9A 3FYEB 5DECA 2JIZG 4DXWA 1H2LA 2JS3A 1YHQV 4L87A 5IYZB 4Z2WA 5BXZA 1OV9A 5LA6A 1SZTA 1COWG 4ZI7A 4LH6A 5JQGA 2JDIG 4DV0O 4AILC 4OGQB 2ZNIA 2UUAB 4I55B 1FAFA 4GX2A 2ZINA 1GKFA 4UUJC 4U7NA 1BL8A 1KC8W 5LYJA 3U10A 2R72A 4DR5O 5KX5B 4B3MO 4LBEC 3ETGA 3OMIB 4GZRB 3GWKC 2YUAA 4B7KA 4NB5A 3AG4C 4GX1A 2IJKA 1G8MA 5L3FA 4PA3A 3BA8A 3A0HZ 1WA8A 3CCJV 2CE4A 2DOSA 2NLJC 2ZDIC 2DN9A 3OTFA 4I50A 4DUYO 2F66C 1BZKA 1K7DA 3THOA 1MMMA 4QE9A 1W0KG 1N4CA 5B5EZ 1IURA 2YDEA 5J9PC 3IAYA 1R3LC 4B3RB 1U96A 3JCUZ 4X62B 4DV6O 1M56C 3DTUB 1Y74B 4JI8O 1O9GA 4X1YB 5JH7B 3FAVB 1KYOF 1HW7A 3L9DA 4DV5O 2NR5A 1XDCA 1M56B 3RYHA 4FZ1A 4WFAV 2A7WA 4YY3O 2MK3A 1VQOV 2JEXA 3N2GA 2YIDA 3L70H 2QA4V 1R3KC 5E79Z 4K8XA 3CCQV 1DLBA 2ZIOA 4GKJO 3P32A 1IJGA 1ZWIC 1IXBA 2Q0AA 2ZKOA 2ZE8A 3A8TA 5JJNB 1SQBH 1VQ5V 4J9ZB 2PY5A 1Y67A 3CC7V 3R65A 2WLIA 5A2QN 2AHYA 1YF2A 4JI2O 2LW7A 1EZVH 1XILA 4O4JA 1HNZO 2GHYA 1I94O 2D2CB 1YDXA 4EEQA 5FLXN 1KMIZ 4CC6A 4FLZA 3ABMC 3BABA 3SPJA 1X59A 2YXLA 3H1LH 4O2BA 3CEIA 5IYBO 2GBOA 2Q0OC 3VQVA 3ABMB 2LW1A 1S77D 5LBQA 1XMQB 3G4SV 1S72V 3KKYA 1JA8A 5CMUA 3M8AA 2V4DA 4RUFA 1H38A 2QWRB 5EBLC 1NBMG 3K03A 4G28B 3K5MA 4DO2A 1YIJV 4ZHQA 4FLUA 3HKEB 3J81N 2ZT9B 2ZE6A 3QNEA 3MAQA 4OX9O 3X2QB 1NI8A 2EIJC 5KHIA 1VF5B 4LFBO 2Y4TA 4DW1A 1PD3A 1XMOB 1SC5B 1KD1W 3JAKB 1ROPA 5K1XA 1D5AA 1K5QA 2EIJB 3JARB 3ZRVA 2Z3YA 5LOVA 3EFFK 3D36C 4GT1A 4JI3B 3OEHG 1JFFB 5JH7A 4O4HB 3QG5A 1VQMV 4MS2A 1DK1A 2AZ0A 3B40A 2C2AA 2P7TC 3TJTA 2QE7G 3JAMN 1XOUA 2O57A 2W0FC 2YICA 4MW3A 2JGDB 4P2ZA 2CDYA 3K9AA 4ZKIA 2F23A 4BIZA 1N36B 4FLWA 2F95B 3OEEG 1GO3F 2RMKB 4CS2A 2BE3A 4LR3A 3J80N 4DK0A 3K08A 3CYOA 3P30A 5B66Z 3RYFA 3CRCA 1BMFG 2Q4PA 3PJSK 3QO8A 1PM9A 2ODMA 4QJFB 3AK2A 4DRXA 2FYUH 2CTWA 2N74A 1RM1B 4X20A 2F93B 1ENVA 4ABMA 4GKKO 5DEDA 1IBKO 4NXNB 3OTOO 3CCEV 4LH7A 1KP3A 4JTAB 2VQFO 2BSKA 5FPOA 4FFKA 4UCUA 2QTSA 2HHHO 5F2VO 3EXAA 3LUTB 2Q73A 2UXCB 4FLXA 5E1AC 3CRAA 5EBMC 2UU9B 3P3NA 2R9RB 2X6AA 4PI0A 2OIGA 2OWOA 4J42A 4E4EA 1BHBA 2VRZA 2UUCB 5KMGA 2Y4UA 3BY6A 3HKEA 2JJ2G 3BFRA 1M1KW 3QVNA 5JVDB 3HB3B 4YJ2B 2X6BA 1US6A 2R9IA 4WF9V 2DYRC 2GUZA 2LFRA 1Q81W 4B3SO 5CBFA 2WLLB 1QU7A 4JTDB 3G6BA 1VQ4V 4DV7B 2X7RB 5B3SC 1VIBA 4PV1B 3JAKA 2DYRB 1CP9A 3SDLA 2Y0PA 2Z5UA 2V1DA 5JCOA 2RNBA 1HNXO 4FFBB 4TUYB 5B3SB 1FFXB 2GTSA 1XNQO 2ZXWC 2DW4A 2CH7B 2LJ2A 1XNRO 1SQFA 2WA4A 1W2BU 3QF7A 4LFCB 4PDLA 4BR6A 3ASNC 2YI9A 3JD2A 3WG7B 2CTRA 3RT3C 1NS1A 2AZ2A 3APOA 3BCCH 2ZR3A 2IU0A 3AEIA 4AI8A 1NTMH 2ETNA 1QHTA 3ETQA 5JWPA 3STZC 5LP6B 4E2LA 1S3JA 1FD9A 3K57A 4GX0A 1V9PA 1EN4A 4JI0B 1M5IA 1TA8A 3MHHC 4H13B 1VQ6V 5C93A 3E22B 4DV1O 4TV8A 5EYPB 4DV3B 1KKDA 2GV9A 5J2UB 1H8EG 4X66O 4DYLA 1I5XA 2QSAA 2M6YA 2WSSG 1WP8A 1QVGU 4FMTA 2X6CA 3N2KB 1Q7YW 3A0RA 2DYSB 1FXVA 2VWKA 4LF7B 4LF6B 1Q6HA 3CXHF 2Q6AA 1VQPV 3ML0A 3ZBHA 3OUSA 4JI7O 4B7EA 3FB8C 3JD3A 4TV9A 1ZUQA 5LA6B 4ZI7B 4LCUC 4IL6Z 3CCLV 1HNWB 3L72H 4EFBA 5JQGB 5IYCO 2EIMB 1G1XB 5EK0A 4GUNA 3RVZA 2DMXA 2EILB 1OCCC 2HVKC 4KHPO 2WLHA 3CPWU 3B09A 4WFFA 5B1BC 1R6TA 2ZM6B 1H2MA 1BHAA 4O4LB 4FPPA 4GLXA 5LYJB 4I5SA 5AG2A 2JVDA 2HEPA 4D7SA 3JATA 2PYJA 1IDSA 5B1BB 2YXHA 3H1JH 2R9AA 3MDSA 2EINC 4H37A 2CH7A 3P3PA 2OCCC 2Y48A 3ZRWA 2VQEB 3I5DA 1H2NA 1GM7A 4UVCA 4K0KO 2IJIA 2JK5C 5L3EA 3CXCU 2EINB 3VOUA 2PI5A 4JI4B 1H5WA 1I08A 3T4DA 3H9VA 1WA8B 3RYIB 2XAHA 1S5JA 4I50B 4H33A 5LP6A 2E5LO 4TOIA 4UCSA 5L3CA 1WB8A 5LHIA 4IT5A 1Z5VA 1FFTB 1M9NA 2FKXA 5KAIZ 2V7QG 1AROP 4K35A 2QGNA 1K34A 4CH5A 5FNVA 3IC9A 1GH6A 5B1AC 3ABKB 4PJ0Z 3T1CA 4R50A 1JX9A 3E2EA 3ZRSA 3OT7A 5B1AB 4RQEA 3TXQA 1N34O 5ITZA 4I9WA 1XREA 2ITCC 3N2GB 1N32B 1I7FA 1ZLZA 5GTIZ 3UKMA 1FXHA 3OAAG 1YTFD 1T5EA 1YEWA 2P90A 2Q8VA 4LFAO 2RJZA 2WLIB 2ADPA 1GMGA 1MA1A 1Q6UA 4DR5B 1A32A 3CHXA 4FM2A 3S3WA 1OCRB 4LF8B 4MVZA 3CCUV 3E8GA 4O4JB 1WN7A 2CGOA 3IJ4A 1NQTA 3CC2V 4FM0A 1E79G 1UJWB 4O2BB 1THZA 3T2MA 4LWSB 2NNUA 1V55C 1I0HA 2YIBD 4JPRA 4NYKA 3IGAC 4MVMA 4O4LA 1B6QA 1K33A 3LNNA 4UXNA 2ILMA 4Q6GA 4WBNB 5EC2C 3OR6C 2F4VB 4JV5O 2QDOA 2XAJA 3BPZA 1V55B 4IYIA 1XHZA 2YIBA 2PYLA 2YXYA 1L8DA 5J2TA 1JQ0A 4JI8B 3OR7C 4PA4A 3OGCC 3GVMA 1G6UA 2NN4A 1NT2B 1IXMA 3JD4A 5TISZ 4DV5B 4ZHQB 1Y4MA 5H9CA 1JCHA 5CBGA 4PELA 1VF7A 4X8AA 1WB7A 1S5LZ 3RYIA 3VQWA 4YY3B 5IYDO 1BGYH 3CWBH 4PA9A 3RFRA 4PHZA 1VF6A 2HG5C 3ABUA 3E86A 2XOKG 4KP4A 4MTOA 2Q5ZA 2DJVA 4JI1B 4HZ3A 3E35A 3H01A 1GRJA 3CCVV 5LOVB 2JRIA 2G38A 4DR6B 2CUGA 5KA5A 3UO3A 5FPRA 5GONB 5IJ0A 3UM7A 3CCMV 1J95A 3SPHA 3ZHSA 1WPXA 3T1YO 1HNZB 1AJPA 3O65A 4WFGA 1BQZA 3CRQA 2IW5A 5CBHA 2WWWA 3RN4A 2YC0A 3IC7A 4TT3G 4FLYA 1UFIA 3ZHVA 4FLTA 4CS3A 1TUBA 5CA0A 3MD0A 4NKGB 4TQFA 4DK1A 1Q43A 4OPAA 1HP8A 2ITDC 2GTAA 4JYYA 2Q7EA 1U97A 1NVPD 3RYFB 5EIBD 2FMLA 2ZNJA 3ZEDA 5HFMA 1Y76B 4PA7A 4PDVA 4DRXB 3PN1A 4X89A 2CK3G 2AXTZ 2PI4A 4QIWF 1YZBA 2A06H 3K0GA 4DUZB 1VARA 4X20B 3L75H 1FS0G 3RYCA 2UXNA 1XBLA 4FIPC 3K3WA 2ATKC 4PD4F 5H2FZ 2ZCEA 3JSNA 1NTZH 2AHZA 3KDRA 2BSKB 2YS8A 3BVOA 2IU3A 4OX9B 4LWSA 2UUBO 2X0LA 3JD0A 1YVWA 4F6EA 5LGTA 3T1HO 4LFBB 5BR8O 1AR1B 1K92A 4WBNA 1PP9H 2P06A 2EZOA 4EFEA 3KG2A 3DGEA 3HKBA 3Q4HA 3CRRA 1AB3A 2RQ6A 5A9GA 2RCVA 5CB4B 4F4LA 2UXDB 1K5SA 2EJ7A 2QWNB 3LNMB 4GX5A 3X2QC 2CTQA 5KMGB 1AI4A 5IE9A 5KLVH 1WJZA 1TAEA 2E75B 4X64B 4LF9B 3SJAC 4C7UA 2GUZB 1Q5OA 1K4CC 4UCVA 5CA1B 4JYCA 3ZHTA 1WLEA 2YEVA 2QM7A 1YJNV 2FL4A 5JCOC 2K1EA 4MVOA 4QPJA 4N23A 4BIOA 1MSDA 2E76B 1XQ8A 5LMNB 3E83A 4BWAA 3W7TA 2XTAA 2QKCA 1FYJA 2HP8A 1TVKA 4B3TO 5IWAB 4Q20A 4KL1A 4YXWG 3W7SA 5GONA 4JYAO 4NTWA 2QKAA 3GB7C 5EZYB 4D6TH 4HBNA 3F7VC 4GKKB 1XMQO 1SQVH 4DR3O 1JNBA 1IBKB 3OGIB 3QO5A 4DV4B 3TGUH 2VQFB 1OCOC 2PGGA 1BCCH 4EKWA 5B1NA 1VQNV 1AILA 3OMAB 2XNDG 2HHHB 2Q9LA 2LO1A 1AI5A 3H1KH 1OCOB 3T4ZA 2AGAA 1RM1C 2D3OW 1RP3B 4O4IA 5DN6G 1Y76A 1BE3H 2B1IA 2LP7A 1FOUA 2GSMB 1RPOA 1QQCA 2HKOA 4PI2A 5K1PA 3ZS8C 4TV8B 4XDLA 3B8NA 3CD6V 2XAFA 4BIUA 4UCRA 2UXBB 1Q82W 2HFEC 4P9OA 2JGUA 1ZSPA 2H8PC 4DV2B 1Z5WA 5KUMA 1AVMA 3WU2Z 3BA9A 1ZX3A 1HR0B 1XEQA 4YHHB 4DR2B 2WLNA 2Q67A 3CE2A 4JI6B 2B9ZA 1LUVA 2BOCC 1N36O 1NH2B 4BAYA 4ICGA 5CB4A 2IJJA 3JSLA 4JZ2A 2OYQA 4R7CA 4J7JA 1XNQB 5KAFZ 1DGSA 5B1OA 1SKVA 2K9PA 1OCZC 2LFSA 4TV9B 4HYOA 3SYQA 5CA1A 1SQPH 2OIEA 1EFRG 3C3SA 3G71V 1OCZB 1QCEA 5KA6A 4NXNO 1CEZA 1URFA 3FB6C 3TCUA 3NXSA 4FJCC 3ZJZA 4B08A 4X65B 3HPLC 3K5OA 4NXMB 4IYHA 3LSQA 3JATB 3WG7C 5EZYA 1BQ0A 4IHJB 1CPYA 4X66B 3BHPA 1Q3EA 3ZRWB 3ZHQA 1AJNA 5LP6C 3DC6A 2PF4E 3EVKA 3N27A 5LMUO 2YSUB 4ZBMA 2ZIMA 3RW0A 3EHBB 1VMGA 2AW9A 3JYCA 4I9QA 5BMVA 3W7UA 4K8ZA 3ZCCA 2EX3A 1NTKH 1P7BA 4LP8A 4DR1B 4G27B 1FJGB 1QLEB 5FNVB 3AG3C 4NVPA 1D5NA 4NR1A 2JS5A 3WB1A 3KZIZ 1NR1A 1VQ9V 2A9HA 3ZX6A 4JI7B 4HNAA 1M90W 4MVUA 3AG3B 4X1KB 3TK1A 3H1HH 2XAGA 5ITZB 2QM4A 1PNMA 2KQXA 4UVAA 4QE7A 2Z0AA 5H6QA 2DYSC 1NH2D 2CGNA 4ZOLA 4RUEA 4KHPB 1F7YA 2H3OA 3DXRA 4JAAA 3I56V 1K8AW 2WLJA 1FKAO 4O2AA 1BT8A 3QO7A 2QWPB 4KFMA 2EULA 2W6JG 3ABTA 3L71H 1XUQA 2CTPA 3A2FA 3E8FA 2Y0IA 4J7ZA 3D8CA 1LNQA 1NKDA 1YTFB 1EM1A 4DR4B 3CP1A 2EIMC 1YJ9V 4NTXA 4Z1VA 3GWOA 4LF5B 4DW0A 2EILC 4JI0O 1PKXA 3NR7A 3SYOA 1F51A 4W4LA 4PA6A 2QKSA 2PTMA 3UT5A 1CXZB 5C8YA 1GN3A 4JZGA 4N21A 5HFLA 3CJHA 1J5EB 2BCCH 5D5PA 3E8HA 1M93A 5KHJA 1YXBA 4LNUA 3JAWA 2QWOB 4TQDA 4CH4A 1SERA 2HR3A 4IHJA 1IBMO 1JR9A 5J2TB 1D2DA 3ZHUA 2P4VA 4R8CA 1NR7A 1GM9A 1TUEB 2IBZH 3OUFA 1EN6A 3K5LA 5BZBA 1S5HC 4DR7B 1UPGA 1NJIW 4FK5C 2BTOA 1JMKC 5KHKA 1BS3A 3ABKC 4JI5B 4H44B 1HNWO 2DE0X 2PZSA 4LF4O 1Q90D 5LHGA 4MVSA 3B2EE 2Q7GA 5D5QA 4LFAB 4AQYO 5L3DA 1WP7A 1P84F 1SS3A 1M4UA 4X9QA 5IJ0B 4RQFA 4XDJA 3ZMZA 1NZ6A 4X1KA 5LXTA 1GN6A 1DF4A 4D7TA 3K79A 3KCYA 3HKCA 4J10A 3AG2B 3LDCA 4DV0B 1TUBB 2M7WA 5CA0B 5L3BA 5LGUA 1S76D 4RWUA 3HKDA 1N33O 1PL0A 2EZPA 1SETA 4XBFA 3CMAV 2L35A 4OPHA 4OXSA 4EB6A 2BOBC 4LC1A 2VQEO 1SQXH 4WFEA 1MOFA 2WA3A 1M57C 1VQ7V 3AG1C 1OCRC 4JI4O 1GN2A 1IBLO 3G80A 5EIBC 4JV5B 5GTHZ 4U3FH 3R66A 1M57B 4TSFG 3AG1B 4B3MB 1NVPB 5CA3A 3CC4V 3RYCB 2EIKB 4A5UB 4MTGA 1RFYA 4RO2A 4YJ3A 2P4KA 3C3TA 4RAIA 4J11A 5IT9N 4H0LB 2DQ0A 1QR8A 2ZE5A 5EBWC 4DUYB 1L0LH 1NU1H 4G2KA 1ZAUA 1SA0B 4MW8A 2N05A 3HKBB 3Q4HB 5DM6V 1N32O 1XI1A 1L1FA 1KKCA 2DWDC 2PUSA 3IFXA 4DV6B 3E8BA 3O9OA 1ZL8A 1GTOA 3CB2A 5L3GA 4YIPA 1GM8A 3FB5C 3WB0A 1HWYA 2YI8A 3RBZA 3T1YB 2P22C 2ZQMA 1Q6IA 2L6LA 4FM1A 2HVJC 1KQSU 1RSOA 3STLC 1OZ0A 5KHGA 3HR0A 5H6RA 2H94A 2YEVB 4LF8O 1LUWA 1R6NA 3JASA 4GKJB 1Y6XA 2YIAA 2VWJA 1WPBA 2BTQB 3CMEV 4FVMA 2P5OA 1TVKB 4I7ZB 4F6RA 4I4TA 2UUAO 4JI2B 1QR9A 3AG4B 1N0NA 1ZTEA 4IIJA 2HLDG 3U0ZA 1FXKA 3ABLC 1YI2V 1AI6A 2B5UA 1I94B 1JJOA 2F4VO 4JF3A 1MABG 5FL7G 3ZIAG 1Z2GA 4QGPA 1B04A 1K97A 3ABLB 3OE7G 1LR1A 2UUBB 1GAXA 3T1HB 3M7MX 5BR8B 2RN9A 3TXSA 2WAMA 2Q68A 4GCZA 4IGGA 4O4IB 4Z1MG 3SJQC 4ZIBA 4CBCA 3SYAA 4J80A 1B3QA 2W6IG 5CN0A 1PNKA 1F23A 3CSXA 4B3RO 4JI1O 4X62O 4DR6O 1N8RW 5KUKA 2JJ1G 5IYZA 4FZ0A 1XHXA 3DSQA 2FB5A 1KBHA 2EBOA 1F4NA 1SA0A 4B3TB 1WAZA
chains in the Genus database with same CATH topology
2CDYA 1Y67A 1EN5A 4X9QA 1LUWA 1BSMA 2QKCA 3RN4A 4YIOA 1GN6A 4GUNA 2ADPA 1BT8A 1XILA 1MA1A 3C3SA 2QKAA 1XUQA 1MNGA 4JYYA 4BR6A 1PM9A 1EM1A 1N0NA 1ZTEA 3AK2A 3CEIA 5AG2A 3AK3A 3AK1A 3DC5A 1IDSA 1GN2A 3LSUA 3MDSA 1VARA 1QNMA 1I0HA 1GN3A 4JZGA 3KKYA 1JA8A 1EN4A 4FFKA 1GN4A 2CE4A 1I08A 3KDRA 3DC6A 1SZXA 1MMMA 3EVKA 2P4KA 1AP5A 3C3TA 4F6EA 1WB8A 2AW9A 1JR9A 1PL4A 2ADQB 1ZSPA 1WB7A 3IC9A 2GDSA 1AVMA 4E4EA 5A9GA 2RCVA 1P7GA 1XDCA 1D5NA 1EN6A 3BFRA 1KKCA 3QVNA 3OT7A 1AR5A 4YIPA 1LUVA 1BS3A 1AP6A 1IX9A 1XREA 1N0JA 4C7UA 1IXBA 3K9SA 1AR4A 1VEWA 1ZLZA 3TJTA 4JZ2A 1B06A 1MSDA 1ZUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CDY A;  1Y67 A;  1EN5 A;  4X9Q A;  1LUW A;  1BSM A;  2QKC A;  3RN4 A;  4YIO A;  1GN6 A;  4GUN A;  2ADP A;  1BT8 A;  1XIL A;  1MA1 A;  3C3S A;  2QKA A;  1XUQ A;  1MNG A;  4JYY A;  4BR6 A;  1PM9 A;  1EM1 A;  1N0N A;  1ZTE A;  3AK2 A;  3CEI A;  5AG2 A;  3AK3 A;  3AK1 A;  3DC5 A;  1IDS A;  1GN2 A;  3LSU A;  3MDS A;  1VAR A;  1QNM A;  1I0H A;  1GN3 A;  4JZG A;  3KKY A;  1JA8 A;  1EN4 A;  4FFK A;  1GN4 A;  2CE4 A;  1I08 A;  3DC6 A;  1SZX A;  1MMM A;  3EVK A;  2P4K A;  1AP5 A;  3C3T A;  4F6E A;  1WB8 A;  2AW9 A;  1JR9 A;  1PL4 A;  2ADQ B;  1ZSP A;  1WB7 A;  3IC9 A;  2GDS A;  1AVM A;  4E4E A;  5A9G A;  2RCV A;  1P7G A;  1XDC A;  1D5N A;  1EN6 A;  3BFR A;  1KKC A;  3QVN A;  3OT7 A;  1AR5 A;  4YIP A;  1LUV A;  1BS3 A;  1AP6 A;  1IX9 A;  1XRE A;  1N0J A;  4C7U A;  1IXB A;  3K9S A;  1AR4 A;  1VEW A;  1ZLZ A;  3TJT A;  4JZ2 A;  1B06 A;  1MSD A;  1ZUQ A; 
#chains in the Genus database with same CATH topology
 4I55 A;  1KU9 A;  3SPI A;  1EN5 A;  4JYA B;  1BSM A;  1XL4 A;  1RPR A;  3OM3 B;  4JTC B;  4YIO A;  4DR3 B;  2QJ1 A;  3CCR V;  2B1G A;  3K59 A;  1Q86 W;  1DF5 A;  3F5W C;  3ZHR A;  3VQX A;  5KX5 A;  4DUZ O;  3FYI B;  2BTQ A;  3FX7 A;  4X88 A;  3AK1 A;  3CCS V;  3S3X A;  1HDJ A;  3APQ A;  2JEU A;  3VQY A;  1L0N H;  3J7A U;  3SPG A;  2WLK A;  4UCT A;  2LGW A;  2IH1 C;  3FB7 C;  2XT9 A;  5IY5 C;  4BW9 A;  2ZDI A;  3UCS C;  3OTO B;  1MZF A;  2LQT A;  1FPO A;  1Y66 A;  1AP5 A;  3SYP A;  1W59 A;  1R3J C;  1VQ8 V;  2IJH A;  1KP2 A;  3ZMU A;  1Y74 A;  5IY5 B;  2E74 B;  1YSC A;  4X1Y A;  2UXD O;  1IZ3 A;  5LHH A;  1PL4 A;  3FAV A;  2ADQ B;  5BMV B;  4CS4 A;  1GK9 A;  1OHH G;  4X64 O;  1OJH A;  3K04 A;  3D3Q A;  5EC1 C;  4LF9 O;  2ZD9 A;  1XMO O;  1IVS A;  1AP6 A;  2Q7H A;  5LMN O;  3W7W A;  1WNS A;  4U3J B;  3C90 A;  1N0J A;  2IM9 A;  2P6J A;  4HNA B;  3K9S A;  3CS5 A;  3SYC A;  1AR4 A;  1VEW A;  5IWA O;  1H2K A;  3B4S A;  4JI3 O;  3QTC A;  4UV8 A;  3F5T A;  4B3S B;  4UB6 Z;  4MVQ A;  1G4Y B;  3K5N A;  3FD9 A;  4UVB A;  3RWR D;  1TGO A;  4ZOL B;  2KG7 B;  3M99 B;  1PV0 A;  5IJ9 B;  5H5N A;  1MSW D;  4DV4 O;  3DXR B;  5JJJ B;  3I55 V;  2MW2 B;  1HNX B;  1E1R G;  4FLV A;  3K0D A;  4O2A B;  4JAV A;  4JGS A;  4I0X B;  4MT8 A;  3VBB A;  5IDJ A;  3SPC A;  2A3Q A;  1K9M W;  1XNR B;  1DTO A;  3LSU A;  2OT5 A;  1MZE A;  3E89 A;  3RGB A;  2QEX V;  1F4M A;  1QNM A;  1K4D C;  1R3I C;  2FTK A;  2XAQ A;  3BAA A;  5LMU B;  1S0V A;  2LGQ A;  1GN4 A;  4P9P A;  2IH3 C;  1YIT V;  1QVF U;  3UT5 B;  5C8Y B;  3ASO C;  4L8J A;  3CJH B;  2UXB O;  2QWQ B;  4LNU B;  4DV2 O;  3LDE A;  3K58 A;  3ZRX A;  1JVM A;  1SQQ H;  3JAW B;  3ASO B;  1ORQ C;  1HR0 O;  2DQ3 A;  2WPD G;  4DV1 B;  2UXC O;  5GW7 A;  3ETE A;  4YHH O;  2E3C A;  4DR2 O;  4CH3 A;  4JI6 O;  2UU9 O;  3ICX A;  1K3E A;  3H1I H;  3JAR A;  4KXR A;  3G6E V;  4X1I B;  4UCO A;  4MTX A;  1P7G A;  3LSS A;  1AI7 A;  4MSW C;  3ZMS A;  4WFH A;  4CZZ A;  1JOY A;  5KHH A;  1JFF A;  1MG1 A;  4O4H A;  1AR5 A;  3ZMV A;  3ZN1 A;  2F43 G;  3U11 A;  2UUC O;  3D36 A;  3SJB C;  1QLE C;  4PDR A;  1R6K A;  2A79 B;  4R6Z A;  3TET A;  2JGD A;  1QLN A;  3B8M A;  3MHS C;  2ZXW B;  1SES A;  2KB1 A;  3FFQ A;  1JJ2 U;  1B06 A;  2KKW A;  3D3I A;  4ASU G;  2P67 A;  2ZR2 A;  4DV7 O;  4JAS A;  4QNH B;  3ASN B;  3SJC C;  4U3J A;  3CRM A;  4CC5 A;  3SGI A;  4X65 O;  5LXT B;  3UQ8 A;  1R73 A;  1SRY A;  4NXM O;  4KUM A;  5BY1 A;  5LL6 Y;  1I5Y A;  3HKC B;  2W0X A;  3HKD B;  4NTY A;  2KG7 A;  5IJ9 A;  3RVY A;  2XHB A;  2Q69 A;  2QTO A;  1K73 W;  4EB6 B;  4LFC O;  4J7K A;  4TWK A;  1H2G A;  3OFN G;  4QPK A;  3JAL B;  4I0X A;  1YCI A;  2QR4 A;  1P4R A;  2N04 A;  5JJE B;  3L74 H;  1IBM B;  1SZX A;  4DR1 O;  1EBO A;  3ETD A;  2HJD A;  1QBZ A;  3KCX A;  3ZMT A;  4BW5 A;  1FJG O;  4K0K B;  1JPX A;  4YJ3 B;  1Q8I A;  2A0L A;  4DV3 O;  4WFB V;  3ZN0 A;  2VS0 A;  4PDM A;  1H8H G;  2XUM A;  2GDS A;  2E5L B;  1W0J G;  3JD1 A;  4K3A A;  5JVD A;  4YJ2 A;  4UV9 A;  1PNL A;  2HJF C;  2R70 A;  1O9H A;  1KEC A;  2ARH A;  4LF4 B;  4WCE V;  3OW2 U;  1XL6 A;  2WLL A;  3B77 A;  1PPJ H;  4AQY B;  4MVR A;  4UFZ A;  4HAM A;  3JCZ A;  3F7Y C;  2XAS A;  1ZL8 B;  2F1M A;  4X1I A;  4LF7 O;  4GYC B;  4CH6 A;  4LF6 O;  4FFB A;  4TUY A;  3WB2 A;  1OCC B;  4U7O A;  4UB8 Z;  2QM8 A;  1R1B A;  1VF6 C;  5LGN A;  1FFX A;  1N34 B;  1RSO B;  3OMN B;  3AG7 A;  3SR2 C;  4DR4 O;  3OD4 A;  1N33 B;  4AHC A;  1VP7 A;  3JAS B;  4LF5 O;  2OTL V;  4JAU A;  1VQL V;  4J9Y B;  1SQG A;  1MNG A;  1IBL B;  1X4T A;  2OCC B;  1FXK C;  4F6R B;  4I4T B;  2OTJ V;  2UXX A;  3AK3 A;  4J41 A;  1J5E O;  3DC5 A;  3AG2 C;  2ZM6 O;  2ZE7 A;  4IIJ B;  3W7X A;  2WLM A;  1FXK B;  1P49 A;  3E22 A;  3WFV A;  5EYP A;  1KUQ A;  1E1Q G;  5J2U A;  1V54 C;  2Y69 C;  3FKS G;  1YJW V;  4JYB A;  3LDD A;  2RDC A;  3BEH A;  1V54 B;  3UO2 A;  2Y69 B;  3G67 A;  2DWE C;  3JAL A;  3RYH B;  4XDK A;  2EIK C;  4P30 A;  2EJR A;  3BRC A;  4DR7 O;  4MTF A;  3L73 H;  1AJQ A;  1H2S B;  1KB9 F;  1SF9 A;  3N2K A;  4W4K A;  2OCH A;  1VQK V;  4JI5 O;  3K06 A;  3CX5 F;  3A0B Z;  2CAZ C;  2KSD A;  1EZJ A;  1IX9 A;  3FYE B;  5DEC A;  2JIZ G;  4DXW A;  1H2L A;  2JS3 A;  1YHQ V;  4L87 A;  5IYZ B;  4Z2W A;  5BXZ A;  1OV9 A;  5LA6 A;  1SZT A;  1COW G;  4ZI7 A;  4LH6 A;  5JQG A;  2JDI G;  4DV0 O;  4AIL C;  4OGQ B;  2ZNI A;  2UUA B;  4I55 B;  1FAF A;  4GX2 A;  2ZIN A;  1GKF A;  4UUJ C;  4U7N A;  1BL8 A;  1KC8 W;  5LYJ A;  3U10 A;  2R72 A;  4DR5 O;  5KX5 B;  4B3M O;  4LBE C;  3ETG A;  3OMI B;  4GZR B;  3GWK C;  2YUA A;  4B7K A;  4NB5 A;  3AG4 C;  4GX1 A;  2IJK A;  1G8M A;  5L3F A;  4PA3 A;  3BA8 A;  3A0H Z;  1WA8 A;  3CCJ V;  2CE4 A;  2DOS A;  2NLJ C;  2ZDI C;  2DN9 A;  3OTF A;  4I50 A;  4DUY O;  2F66 C;  1BZK A;  1K7D A;  3THO A;  1MMM A;  4QE9 A;  1W0K G;  1N4C A;  5B5E Z;  1IUR A;  2YDE A;  5J9P C;  3IAY A;  1R3L C;  4B3R B;  1U96 A;  3JCU Z;  4X62 B;  4DV6 O;  1M56 C;  3DTU B;  1Y74 B;  4JI8 O;  1O9G A;  4X1Y B;  5JH7 B;  3FAV B;  1KYO F;  1HW7 A;  3L9D A;  4DV5 O;  2NR5 A;  1XDC A;  1M56 B;  3RYH A;  4FZ1 A;  4WFA V;  2A7W A;  4YY3 O;  2MK3 A;  1VQO V;  2JEX A;  3N2G A;  2YID A;  3L70 H;  2QA4 V;  1R3K C;  5E79 Z;  4K8X A;  3CCQ V;  1DLB A;  2ZIO A;  4GKJ O;  3P32 A;  1IJG A;  1ZWI C;  1IXB A;  2Q0A A;  2ZKO A;  2ZE8 A;  3A8T A;  5JJN B;  1SQB H;  1VQ5 V;  4J9Z B;  2PY5 A;  1Y67 A;  3CC7 V;  3R65 A;  2WLI A;  5A2Q N;  2AHY A;  1YF2 A;  4JI2 O;  2LW7 A;  1EZV H;  1XIL A;  4O4J A;  1HNZ O;  2GHY A;  1I94 O;  2D2C B;  1YDX A;  4EEQ A;  5FLX N;  1KMI Z;  4CC6 A;  4FLZ A;  3ABM C;  3BAB A;  3SPJ A;  1X59 A;  2YXL A;  3H1L H;  4O2B A;  3CEI A;  5IYB O;  2GBO A;  2Q0O C;  3VQV A;  3ABM B;  2LW1 A;  1S77 D;  5LBQ A;  1XMQ B;  3G4S V;  1S72 V;  3KKY A;  1JA8 A;  5CMU A;  3M8A A;  2V4D A;  4RUF A;  1H38 A;  2QWR B;  5EBL C;  1NBM G;  3K03 A;  4G28 B;  3K5M A;  4DO2 A;  1YIJ V;  4ZHQ A;  4FLU A;  3HKE B;  3J81 N;  2ZT9 B;  2ZE6 A;  3QNE A;  3MAQ A;  4OX9 O;  3X2Q B;  1NI8 A;  2EIJ C;  5KHI A;  1VF5 B;  4LFB O;  2Y4T A;  4DW1 A;  1PD3 A;  1XMO B;  1SC5 B;  1KD1 W;  3JAK B;  1ROP A;  5K1X A;  1D5A A;  1K5Q A;  2EIJ B;  3JAR B;  3ZRV A;  2Z3Y A;  5LOV A;  3EFF K;  3D36 C;  4GT1 A;  4JI3 B;  3OEH G;  1JFF B;  5JH7 A;  4O4H B;  3QG5 A;  1VQM V;  4MS2 A;  1DK1 A;  2AZ0 A;  3B40 A;  2C2A A;  2P7T C;  3TJT A;  2QE7 G;  3JAM N;  1XOU A;  2O57 A;  2W0F C;  2YIC A;  4MW3 A;  2JGD B;  4P2Z A;  2CDY A;  3K9A A;  4ZKI A;  2F23 A;  4BIZ A;  1N36 B;  4FLW A;  2F95 B;  3OEE G;  1GO3 F;  2RMK B;  4CS2 A;  2BE3 A;  4LR3 A;  3J80 N;  4DK0 A;  3K08 A;  3CYO A;  3P30 A;  5B66 Z;  3RYF A;  3CRC A;  1BMF G;  2Q4P A;  3PJS K;  3QO8 A;  1PM9 A;  2ODM A;  4QJF B;  3AK2 A;  4DRX A;  2FYU H;  2CTW A;  2N74 A;  1RM1 B;  4X20 A;  2F93 B;  1ENV A;  4ABM A;  4GKK O;  5DED A;  1IBK O;  4NXN B;  3OTO O;  3CCE V;  4LH7 A;  1KP3 A;  4JTA B;  2VQF O;  2BSK A;  5FPO A;  4FFK A;  4UCU A;  2QTS A;  2HHH O;  5F2V O;  3EXA A;  3LUT B;  2Q73 A;  2UXC B;  4FLX A;  5E1A C;  3CRA A;  5EBM C;  2UU9 B;  3P3N A;  2R9R B;  2X6A A;  4PI0 A;  2OIG A;  2OWO A;  4J42 A;  4E4E A;  1BHB A;  2VRZ A;  2UUC B;  5KMG A;  2Y4U A;  3BY6 A;  3HKE A;  2JJ2 G;  3BFR A;  1M1K W;  3QVN A;  5JVD B;  3HB3 B;  4YJ2 B;  2X6B A;  1US6 A;  2R9I A;  4WF9 V;  2DYR C;  2GUZ A;  2LFR A;  1Q81 W;  4B3S O;  5CBF A;  2WLL B;  1QU7 A;  4JTD B;  3G6B A;  1VQ4 V;  4DV7 B;  2X7R B;  5B3S C;  1VIB A;  4PV1 B;  3JAK A;  2DYR B;  1CP9 A;  3SDL A;  2Y0P A;  2Z5U A;  2V1D A;  5JCO A;  2RNB A;  1HNX O;  4FFB B;  4TUY B;  5B3S B;  1FFX B;  2GTS A;  1XNQ O;  2ZXW C;  2DW4 A;  2CH7 B;  2LJ2 A;  1XNR O;  1SQF A;  2WA4 A;  1W2B U;  3QF7 A;  4LFC B;  4PDL A;  4BR6 A;  3ASN C;  2YI9 A;  3JD2 A;  3WG7 B;  2CTR A;  3RT3 C;  1NS1 A;  2AZ2 A;  3APO A;  3BCC H;  2ZR3 A;  2IU0 A;  3AEI A;  4AI8 A;  1NTM H;  2ETN A;  1QHT A;  3ETQ A;  5JWP A;  3STZ C;  5LP6 B;  4E2L A;  1S3J A;  1FD9 A;  3K57 A;  4GX0 A;  1V9P A;  1EN4 A;  4JI0 B;  1M5I A;  1TA8 A;  3MHH C;  4H13 B;  1VQ6 V;  5C93 A;  3E22 B;  4DV1 O;  4TV8 A;  5EYP B;  4DV3 B;  1KKD A;  2GV9 A;  5J2U B;  1H8E G;  4X66 O;  4DYL A;  1I5X A;  2QSA A;  2M6Y A;  2WSS G;  1WP8 A;  1QVG U;  4FMT A;  2X6C A;  3N2K B;  1Q7Y W;  3A0R A;  2DYS B;  1FXV A;  2VWK A;  4LF7 B;  4LF6 B;  1Q6H A;  3CXH F;  2Q6A A;  1VQP V;  3ML0 A;  3ZBH A;  3OUS A;  4JI7 O;  4B7E A;  3FB8 C;  3JD3 A;  4TV9 A;  1ZUQ A;  5LA6 B;  4ZI7 B;  4LCU C;  4IL6 Z;  3CCL V;  1HNW B;  3L72 H;  4EFB A;  5JQG B;  5IYC O;  2EIM B;  1G1X B;  5EK0 A;  4GUN A;  3RVZ A;  2DMX A;  2EIL B;  1OCC C;  2HVK C;  4KHP O;  2WLH A;  3CPW U;  3B09 A;  4WFF A;  5B1B C;  1R6T A;  2ZM6 B;  1H2M A;  1BHA A;  4O4L B;  4FPP A;  4GLX A;  5LYJ B;  4I5S A;  5AG2 A;  2JVD A;  2HEP A;  4D7S A;  3JAT A;  2PYJ A;  1IDS A;  5B1B B;  2YXH A;  3H1J H;  2R9A A;  3MDS A;  2EIN C;  4H37 A;  2CH7 A;  3P3P A;  2OCC C;  2Y48 A;  3ZRW A;  2VQE B;  3I5D A;  1H2N A;  1GM7 A;  4UVC A;  4K0K O;  2IJI A;  2JK5 C;  5L3E A;  3CXC U;  2EIN B;  3VOU A;  2PI5 A;  4JI4 B;  1H5W A;  1I08 A;  3T4D A;  3H9V A;  1WA8 B;  3RYI B;  2XAH A;  1S5J A;  4I50 B;  4H33 A;  5LP6 A;  2E5L O;  4TOI A;  4UCS A;  5L3C A;  1WB8 A;  5LHI A;  4IT5 A;  1Z5V A;  1FFT B;  1M9N A;  2FKX A;  5KAI Z;  2V7Q G;  1ARO P;  4K35 A;  2QGN A;  1K34 A;  4CH5 A;  5FNV A;  3IC9 A;  1GH6 A;  5B1A C;  3ABK B;  4PJ0 Z;  3T1C A;  4R50 A;  1JX9 A;  3E2E A;  3ZRS A;  3OT7 A;  5B1A B;  4RQE A;  3TXQ A;  1N34 O;  5ITZ A;  4I9W A;  1XRE A;  2ITC C;  3N2G B;  1N32 B;  1I7F A;  1ZLZ A;  5GTI Z;  3UKM A;  1FXH A;  3OAA G;  1YTF D;  1T5E A;  1YEW A;  2P90 A;  2Q8V A;  4LFA O;  2RJZ A;  2WLI B;  2ADP A;  1GMG A;  1MA1 A;  1Q6U A;  4DR5 B;  1A32 A;  3CHX A;  4FM2 A;  3S3W A;  1OCR B;  4LF8 B;  4MVZ A;  3CCU V;  3E8G A;  4O4J B;  1WN7 A;  2CGO A;  3IJ4 A;  1NQT A;  3CC2 V;  4FM0 A;  1E79 G;  1UJW B;  4O2B B;  1THZ A;  3T2M A;  4LWS B;  2NNU A;  1V55 C;  1I0H A;  2YIB D;  4JPR A;  4NYK A;  3IGA C;  4MVM A;  4O4L A;  1B6Q A;  1K33 A;  3LNN A;  4UXN A;  2ILM A;  4Q6G A;  4WBN B;  5EC2 C;  3OR6 C;  2F4V B;  4JV5 O;  2QDO A;  2XAJ A;  3BPZ A;  1V55 B;  4IYI A;  1XHZ A;  2YIB A;  2PYL A;  2YXY A;  1L8D A;  5J2T A;  1JQ0 A;  4JI8 B;  3OR7 C;  4PA4 A;  3OGC C;  3GVM A;  1G6U A;  2NN4 A;  1NT2 B;  1IXM A;  3JD4 A;  5TIS Z;  4DV5 B;  4ZHQ B;  1Y4M A;  5H9C A;  1JCH A;  5CBG A;  4PEL A;  1VF7 A;  4X8A A;  1WB7 A;  1S5L Z;  3RYI A;  3VQW A;  4YY3 B;  5IYD O;  1BGY H;  3CWB H;  4PA9 A;  3RFR A;  4PHZ A;  1VF6 A;  2HG5 C;  3ABU A;  3E86 A;  2XOK G;  4KP4 A;  4MTO A;  2Q5Z A;  2DJV A;  4JI1 B;  4HZ3 A;  3E35 A;  3H01 A;  1GRJ A;  3CCV V;  5LOV B;  2JRI A;  2G38 A;  4DR6 B;  2CUG A;  5KA5 A;  3UO3 A;  5FPR A;  5GON B;  5IJ0 A;  3UM7 A;  3CCM V;  1J95 A;  3SPH A;  3ZHS A;  1WPX A;  3T1Y O;  1HNZ B;  1AJP A;  3O65 A;  4WFG A;  1BQZ A;  3CRQ A;  2IW5 A;  5CBH A;  2WWW A;  3RN4 A;  2YC0 A;  3IC7 A;  4TT3 G;  4FLY A;  1UFI A;  3ZHV A;  4FLT A;  4CS3 A;  1TUB A;  5CA0 A;  3MD0 A;  4NKG B;  4TQF A;  4DK1 A;  1Q43 A;  4OPA A;  1HP8 A;  2ITD C;  2GTA A;  4JYY A;  2Q7E A;  1U97 A;  1NVP D;  3RYF B;  5EIB D;  2FML A;  2ZNJ A;  3ZED A;  5HFM A;  1Y76 B;  4PA7 A;  4PDV A;  4DRX B;  3PN1 A;  4X89 A;  2CK3 G;  2AXT Z;  2PI4 A;  4QIW F;  1YZB A;  2A06 H;  3K0G A;  4DUZ B;  1VAR A;  4X20 B;  3L75 H;  1FS0 G;  3RYC A;  2UXN A;  1XBL A;  4FIP C;  3K3W A;  2ATK C;  4PD4 F;  5H2F Z;  2ZCE A;  3JSN A;  1NTZ H;  2AHZ A;  3KDR A;  2BSK B;  2YS8 A;  3BVO A;  2IU3 A;  4OX9 B;  4LWS A;  2UUB O;  2X0L A;  3JD0 A;  1YVW A;  4F6E A;  5LGT A;  3T1H O;  4LFB B;  5BR8 O;  1AR1 B;  1K92 A;  4WBN A;  1PP9 H;  2P06 A;  2EZO A;  4EFE A;  3KG2 A;  3DGE A;  3HKB A;  3Q4H A;  3CRR A;  1AB3 A;  2RQ6 A;  5A9G A;  2RCV A;  5CB4 B;  4F4L A;  2UXD B;  1K5S A;  2EJ7 A;  2QWN B;  3LNM B;  4GX5 A;  3X2Q C;  2CTQ A;  5KMG B;  1AI4 A;  5IE9 A;  5KLV H;  1WJZ A;  1TAE A;  2E75 B;  4X64 B;  4LF9 B;  3SJA C;  4C7U A;  2GUZ B;  1Q5O A;  1K4C C;  4UCV A;  5CA1 B;  4JYC A;  3ZHT A;  1WLE A;  2YEV A;  2QM7 A;  1YJN V;  2FL4 A;  5JCO C;  2K1E A;  4MVO A;  4QPJ A;  4N23 A;  4BIO A;  1MSD A;  2E76 B;  1XQ8 A;  5LMN B;  3E83 A;  4BWA A;  3W7T A;  2XTA A;  2QKC A;  1FYJ A;  2HP8 A;  1TVK A;  4B3T O;  5IWA B;  4Q20 A;  4KL1 A;  4YXW G;  3W7S A;  5GON A;  4JYA O;  4NTW A;  2QKA A;  3GB7 C;  5EZY B;  4D6T H;  4HBN A;  3F7V C;  4GKK B;  1XMQ O;  1SQV H;  4DR3 O;  1JNB A;  1IBK B;  3OGI B;  3QO5 A;  4DV4 B;  3TGU H;  2VQF B;  1OCO C;  2PGG A;  1BCC H;  4EKW A;  5B1N A;  1VQN V;  1AIL A;  3OMA B;  2XND G;  2HHH B;  2Q9L A;  2LO1 A;  1AI5 A;  3H1K H;  1OCO B;  3T4Z A;  2AGA A;  1RM1 C;  2D3O W;  1RP3 B;  4O4I A;  5DN6 G;  1Y76 A;  1BE3 H;  2B1I A;  2LP7 A;  1FOU A;  2GSM B;  1RPO A;  1QQC A;  2HKO A;  4PI2 A;  5K1P A;  3ZS8 C;  4TV8 B;  4XDL A;  3B8N A;  3CD6 V;  2XAF A;  4BIU A;  4UCR A;  2UXB B;  1Q82 W;  2HFE C;  4P9O A;  2JGU A;  1ZSP A;  2H8P C;  4DV2 B;  1Z5W A;  5KUM A;  1AVM A;  3WU2 Z;  3BA9 A;  1ZX3 A;  1HR0 B;  1XEQ A;  4YHH B;  4DR2 B;  2WLN A;  2Q67 A;  3CE2 A;  4JI6 B;  2B9Z A;  1LUV A;  2BOC C;  1N36 O;  1NH2 B;  4BAY A;  4ICG A;  5CB4 A;  2IJJ A;  3JSL A;  4JZ2 A;  2OYQ A;  4R7C A;  4J7J A;  1XNQ B;  5KAF Z;  1DGS A;  5B1O A;  1SKV A;  2K9P A;  1OCZ C;  2LFS A;  4TV9 B;  4HYO A;  3SYQ A;  5CA1 A;  1SQP H;  2OIE A;  1EFR G;  3C3S A;  3G71 V;  1OCZ B;  1QCE A;  5KA6 A;  4NXN O;  1CEZ A;  1URF A;  3FB6 C;  3TCU A;  3NXS A;  4FJC C;  3ZJZ A;  4B08 A;  4X65 B;  3HPL C;  3K5O A;  4NXM B;  4IYH A;  3LSQ A;  3JAT B;  3WG7 C;  5EZY A;  1BQ0 A;  4IHJ B;  1CPY A;  4X66 B;  3BHP A;  1Q3E A;  3ZRW B;  3ZHQ A;  1AJN A;  5LP6 C;  3DC6 A;  2PF4 E;  3EVK A;  3N27 A;  5LMU O;  2YSU B;  4ZBM A;  2ZIM A;  3RW0 A;  3EHB B;  1VMG A;  2AW9 A;  3JYC A;  4I9Q A;  5BMV A;  3W7U A;  4K8Z A;  3ZCC A;  2EX3 A;  1NTK H;  1P7B A;  4LP8 A;  4DR1 B;  4G27 B;  1FJG B;  1QLE B;  5FNV B;  3AG3 C;  4NVP A;  1D5N A;  4NR1 A;  2JS5 A;  3WB1 A;  3KZI Z;  1NR1 A;  1VQ9 V;  2A9H A;  3ZX6 A;  4JI7 B;  4HNA A;  1M90 W;  4MVU A;  3AG3 B;  4X1K B;  3TK1 A;  3H1H H;  2XAG A;  5ITZ B;  2QM4 A;  1PNM A;  2KQX A;  4UVA A;  4QE7 A;  2Z0A A;  5H6Q A;  2DYS C;  1NH2 D;  2CGN A;  4ZOL A;  4RUE A;  4KHP B;  1F7Y A;  2H3O A;  3DXR A;  4JAA A;  3I56 V;  1K8A W;  2WLJ A;  1FKA O;  4O2A A;  1BT8 A;  3QO7 A;  2QWP B;  4KFM A;  2EUL A;  2W6J G;  3ABT A;  3L71 H;  1XUQ A;  2CTP A;  3A2F A;  3E8F A;  2Y0I A;  4J7Z A;  3D8C A;  1LNQ A;  1NKD A;  1YTF B;  1EM1 A;  4DR4 B;  3CP1 A;  2EIM C;  1YJ9 V;  4NTX A;  4Z1V A;  3GWO A;  4LF5 B;  4DW0 A;  2EIL C;  4JI0 O;  1PKX A;  3NR7 A;  3SYO A;  1F51 A;  4W4L A;  4PA6 A;  2QKS A;  2PTM A;  3UT5 A;  1CXZ B;  5C8Y A;  1GN3 A;  4JZG A;  4N21 A;  5HFL A;  3CJH A;  1J5E B;  2BCC H;  5D5P A;  3E8H A;  1M93 A;  5KHJ A;  1YXB A;  4LNU A;  3JAW A;  2QWO B;  4TQD A;  4CH4 A;  1SER A;  2HR3 A;  4IHJ A;  1IBM O;  1JR9 A;  5J2T B;  1D2D A;  3ZHU A;  2P4V A;  4R8C A;  1NR7 A;  1GM9 A;  1TUE B;  2IBZ H;  3OUF A;  1EN6 A;  3K5L A;  5BZB A;  1S5H C;  4DR7 B;  1UPG A;  1NJI W;  4FK5 C;  2BTO A;  1JMK C;  5KHK A;  1BS3 A;  3ABK C;  4JI5 B;  4H44 B;  1HNW O;  2DE0 X;  2PZS A;  4LF4 O;  1Q90 D;  5LHG A;  4MVS A;  3B2E E;  2Q7G A;  5D5Q A;  4LFA B;  4AQY O;  5L3D A;  1WP7 A;  1P84 F;  1SS3 A;  1M4U A;  4X9Q A;  5IJ0 B;  4RQF A;  4XDJ A;  3ZMZ A;  1NZ6 A;  4X1K A;  5LXT A;  1GN6 A;  1DF4 A;  4D7T A;  3K79 A;  3KCY A;  3HKC A;  4J10 A;  3AG2 B;  3LDC A;  4DV0 B;  1TUB B;  2M7W A;  5CA0 B;  5L3B A;  5LGU A;  1S76 D;  4RWU A;  3HKD A;  1N33 O;  1PL0 A;  2EZP A;  1SET A;  4XBF A;  3CMA V;  2L35 A;  4OPH A;  4OXS A;  4EB6 A;  2BOB C;  4LC1 A;  2VQE O;  1SQX H;  4WFE A;  1MOF A;  2WA3 A;  1M57 C;  1VQ7 V;  3AG1 C;  1OCR C;  4JI4 O;  1GN2 A;  1IBL O;  3G80 A;  5EIB C;  4JV5 B;  5GTH Z;  4U3F H;  3R66 A;  1M57 B;  4TSF G;  3AG1 B;  4B3M B;  1NVP B;  5CA3 A;  3CC4 V;  3RYC B;  2EIK B;  4A5U B;  4MTG A;  1RFY A;  4RO2 A;  4YJ3 A;  2P4K A;  3C3T A;  4RAI A;  4J11 A;  5IT9 N;  4H0L B;  2DQ0 A;  1QR8 A;  2ZE5 A;  5EBW C;  4DUY B;  1L0L H;  1NU1 H;  4G2K A;  1ZAU A;  1SA0 B;  4MW8 A;  2N05 A;  3HKB B;  3Q4H B;  5DM6 V;  1N32 O;  1XI1 A;  1L1F A;  1KKC A;  2DWD C;  2PUS A;  3IFX A;  4DV6 B;  3E8B A;  3O9O A;  1ZL8 A;  1GTO A;  3CB2 A;  5L3G A;  4YIP A;  1GM8 A;  3FB5 C;  3WB0 A;  1HWY A;  2YI8 A;  3RBZ A;  3T1Y B;  2P22 C;  2ZQM A;  1Q6I A;  2L6L A;  4FM1 A;  2HVJ C;  1KQS U;  1RSO A;  3STL C;  1OZ0 A;  5KHG A;  3HR0 A;  5H6R A;  2H94 A;  2YEV B;  4LF8 O;  1LUW A;  1R6N A;  3JAS A;  4GKJ B;  1Y6X A;  2YIA A;  2VWJ A;  1WPB A;  2BTQ B;  3CME V;  4FVM A;  2P5O A;  1TVK B;  4I7Z B;  4F6R A;  4I4T A;  2UUA O;  4JI2 B;  1QR9 A;  3AG4 B;  1N0N A;  1ZTE A;  4IIJ A;  2HLD G;  3U0Z A;  1FXK A;  3ABL C;  1YI2 V;  1AI6 A;  2B5U A;  1I94 B;  1JJO A;  2F4V O;  4JF3 A;  1MAB G;  5FL7 G;  3ZIA G;  1Z2G A;  4QGP A;  1B04 A;  1K97 A;  3ABL B;  3OE7 G;  1LR1 A;  2UUB B;  1GAX A;  3T1H B;  3M7M X;  5BR8 B;  2RN9 A;  3TXS A;  2WAM A;  2Q68 A;  4GCZ A;  4IGG A;  4O4I B;  4Z1M G;  3SJQ C;  4ZIB A;  4CBC A;  3SYA A;  4J80 A;  1B3Q A;  2W6I G;  5CN0 A;  1PNK A;  1F23 A;  3CSX A;  4B3R O;  4JI1 O;  4X62 O;  4DR6 O;  1N8R W;  5KUK A;  2JJ1 G;  5IYZ A;  4FZ0 A;  1XHX A;  3DSQ A;  2FB5 A;  1KBH A;  2EBO A;  1F4N A;  1SA0 A;  4B3T B;  1WAZ A; 
#chains in the Genus database with same CATH homology
 2CDY A;  1Y67 A;  1EN5 A;  4X9Q A;  1LUW A;  1BSM A;  2QKC A;  3RN4 A;  4YIO A;  1GN6 A;  4GUN A;  2ADP A;  1BT8 A;  1XIL A;  1MA1 A;  3C3S A;  2QKA A;  1XUQ A;  1MNG A;  4JYY A;  4BR6 A;  1PM9 A;  1EM1 A;  1N0N A;  1ZTE A;  3AK2 A;  3CEI A;  5AG2 A;  3AK3 A;  3AK1 A;  3DC5 A;  1IDS A;  1GN2 A;  3LSU A;  3MDS A;  1VAR A;  1QNM A;  1I0H A;  1GN3 A;  4JZG A;  3KKY A;  1JA8 A;  1EN4 A;  4FFK A;  1GN4 A;  2CE4 A;  1I08 A;  3KDR A;  3DC6 A;  1SZX A;  1MMM A;  3EVK A;  2P4K A;  1AP5 A;  3C3T A;  4F6E A;  1WB8 A;  2AW9 A;  1JR9 A;  1PL4 A;  2ADQ B;  1ZSP A;  1WB7 A;  3IC9 A;  2GDS A;  1AVM A;  4E4E A;  5A9G A;  2RCV A;  1P7G A;  1XDC A;  1D5N A;  1EN6 A;  3BFR A;  1KKC A;  3QVN A;  3OT7 A;  1AR5 A;  4YIP A;  1LUV A;  1BS3 A;  1AP6 A;  1IX9 A;  1XRE A;  1N0J A;  4C7U A;  1IXB A;  3K9S A;  1AR4 A;  1VEW A;  1ZLZ A;  3TJT A;  4JZ2 A;  1B06 A;  1MSD A;  1ZUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...