1XDCA

Hydrogen bonding in human manganese superoxide dismutase containing 3-fluorotyrosine
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
198
structure length
189
Chain Sequence
KHSLPDLPDGALEPHINAQIMQLHHSKHHAAVNNLNVTEEKQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHALQKNVRPDLKAIWNVINWENVTERMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Hydrogen bonding in human manganese superoxide dismutase containing 3-fluorotyrosine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 59
structure length 189
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1xdcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1xdcA02
1SZXA 3TJTA 1PM9A 4BR6A 3QVNA 1MNGA 2CE4A 3LSUA 1BT8A 1B06A 1XDCA 3CEIA 3OT7A 1EN4A 3C3SA 1AR5A 3MDSA 2P4KA 3AK2A 2QKCA 1ZTEA 1AR4A 1GN6A 1GN3A 1P7GA 1N0JA 3K9SA 1N0NA 1AVMA 1MSDA 1MA1A 5AG2A 1JA8A 1IX9A 1VARA 4JZ2A 4YIPA 4X9QA 3BFRA 2RCVA 3AK3A 1AP5A 1Y67A 1AP6A 2GDSA 4FFKA 2ADPA 1EN6A 3DC5A 1I08A 1D5NA 1ZLZA 2ADQB 1I0HA 1XILA 1WB7A 4E4EA 2QKAA 1GN4A 1EM1A 4YIOA 3RN4A 1IXBA 1GN2A 1XUQA 1PL4A 3IC9A 1IDSA 1XREA 2AW9A 3KKYA 4JZGA 3DC6A 3C3TA 1ZSPA 1KKCA 4F6EA 1VEWA 4GUNA 2CDYA 1JR9A 1WB8A 1LUVA 1BSMA 1BS3A 5A9GA 1MMMA 3AK1A 4C7UA 4JYYA 1LUWA 1ZUQA 3EVKA 1QNMA 1EN5A
chains in the Genus database with same CATH superfamily
2F1MA 4J9YB 4PDVA 1XOUA 2HEPA 2DYRC 1JFFB 3BCCH 4GKKO 4PJ0Z 2QSAA 4HAMA 5BR8B 2DWDC 2QWRB 2EULA 3RYIA 4DV5O 4X65O 1KC8W 2YIDA 1AILA 4B7KA 1GM7A 1IVSA 1JQ0A 3JSNA 1QQCA 2VQFO 3E8GA 1YSCA 3QF7A 4X20A 3FAVA 1VQLV 1ENVA 3WU2Z 2GUZA 5JJJB 2Y69B 1HNWB 3TXSA 3BY6A 2ZCEA 1Y66A 2JJ1G 4R50A 1JVMA 1KQSU 1S72V 2QM4A 3C90A 4IT5A 4B3RO 3OFNG 4Z2WA 2ETNA 3AG2C 1QVGU 2W6JG 3X2QC 1VQPV 1B3QA 4QPJA 4O4JB 2R72A 5B1AC 5JJEB 2EIMB 3SPGA 4RQEA 2YUAA 5EYPB 4JYCA 5FNVB 4TQFA 2HJDA 2Q8VA 4O2AA 1HNXO 2ZDIA 2E76B 2Y4UA 3PJSK 2QEXV 3ZN1A 2LFSA 1K5QA 1AI6A 3T1YO 4WF9V 2Q5ZA 3ZRVA 2QM7A 2XAGA 1HW7A 2CAZC 4FJCC 2QTSA 1FYJA 3OGIB 1SQPH 3QO7A 2P06A 3VQWA 2BSKB 1Q6IA 3SYQA 2Y48A 1N33B 1RM1B 4ZI7A 2F4VB 4KXRA 2UXCO 4DR7O 1FFXB 3LSQA 3ZHQA 4MVMA 2PGGA 4J7ZA 1SESA 1VQNV 2JEUA 2DQ3A 2OYQA 2XHBA 2DE0X 1R6KA 2P4KA 4OXSA 3BPZA 1OHHG 5EIBD 3SYPA 1IJGA 4EB6A 3W7TA 4YHHB 5EBWC 1XMOO 1QHTA 1NI8A 3HKDA 3L71H 4DV6O 5AG2A 2Q73A 1P49A 3ABTA 4DV0B 3FYEB 3ETEA 1NVPD 4E2LA 2A3QA 2XOKG 1GTOA 4I9QA 2EIKB 2PF4E 2QKSA 1SQQH 1P7BA 1OCZB 3CCUV 1YF2A 3ICXA 2OT5A 2P4VA 4CS2A 4KFMA 3DC5A 1SC5B 1N4CA 4Q6GA 3CJHB 5KX5B 2L35A 1BCCH 1K3EA 1ZLZA 1I0HA 1OCCC 4XDLA 1FXHA 1WB7A 3ABLC 4DV3B 4DR1B 5CA3A 1WNSA 3ABUA 5LMNO 1Z5VA 3HKEA 5E1AC 4O4HB 3G67A 4JI5O 5LHGA 4O4IA 3FFQA 5JH7A 3RYHA 3IC9A 1IBLB 4LF9O 4DUZO 1XREA 4NXNO 5FPRA 5FL7G 3B4SA 1VEWA 2FKXA 1I7FA 4YJ3A 3IFXA 2IJJA 4TQDA 2DYSB 1YEWA 4FZ0A 1VF5B 5GTHZ 5IY5B 3J81N 1Q3EA 4MW3A 1IBKB 4B3TB 1TAEA 4RUFA 3OW2U 4FLTA 2PY5A 3CCQV 3LDCA 3ABMB 5H9CA 2Q7EA 3OUSA 5IWAB 3RVZA 1BT8A 4JYAB 3CE2A 3RVYA 3G71V 1RSOA 3HKCA 1KU9A 5GONA 4H13B 2FL4A 1XMQB 1GN6A 1GN3A 4J11A 1N0JA 3VBBA 2E5LB 4TT3G 5KMGA 4LFCB 1S77D 1XQ8A 3N2GB 2WA3A 4DR2O 3BRCA 3ASOC 1Y76A 4BIZA 4IIJB 1AP6A 4DV7O 2OIEA 4DV1B 4TV8A 1S3JA 1H2KA 4RWUA 3GB7C 3LUTB 4CH3A 4Z1VA 4JI4O 2IM9A 2Q0OC 1WP7A 5KLVH 4X62B 3F5WC 3TK1A 3TETA 5B1BC 1GN4A 4R7CA 5BMVB 2CH7A 3K57A 1PPJH 3SPJA 2UXXA 1AI4A 4JI3O 3JD4A 5LA6B 3LNMB 3OTFA 1HWYA 2WLIA 5BY1A 4OX9O 3JAWB 4NXMB 3AEIA 1JR9A 5KA5A 4LF6O 5DM6V 3T1HO 1QLEC 1MMMA 4JAUA 4N23A 2YI8A 1SQBH 4JI5B 5L3FA 2QWPB 4XDKA 1WA8B 4LFBO 1ZUQA 3NR7A 2Q67A 4LFAO 3BAAA 5LP6B 2LW1A 1SZXA 3LDEA 1NU1H 1PM9A 5H6RA 2R9IA 3W7SA 4CBCA 1U97A 1XHZA 1V55B 5E79Z 4LBEC 1KECA 1X59A 2XUMA 3ABKB 4JI7O 2BOCC 2N74A 2KB1A 3AK2A 4ASUG 1CEZA 5B3SB 4B08A 2NLJC 4U7OA 1SQXH 1XNRB 2UXNA 4UCRA 2VWJA 3HKEB 3JCZA 5IYDO 1YZBA 4FM2A 4X64O 3L9DA 3K79A 3OR7C 4O4IB 1AP5A 5B1OA 5JH7B 4AQYO 1SA0B 5LOVA 2JVDA 1L0LH 2GDSA 2RQ6A 1WN7A 1VQ4V 2CK3G 3QO8A 3A0HZ 4NR1A 1QR8A 4NB5A 4YJ3B 3QTCA 4UV9A 2HKOA 1ORQC 1KBHA 4NYKA 1FXKB 1UJWB 3E2EA 1AROP 4E4EA 1JFFA 4LNUB 1YHQV 3FB7C 1H38A 1FJGO 5BZBA 1QVFU 5KHKA 2AW9A 2JS3A 2EJ7A 3HKCB 2XAFA 2EIJC 4B3SO 4FLXA 3BHPA 3JALA 5L3EA 1BHAA 3JCUZ 1K9MW 3AK1A 4PA9A 3G80A 1VF7A 1IBMO 1SRYA 4TWKA 4X66O 2BTOA 2IU0A 5KHJA 5LBQA 1QNMA 5HFLA 3BA8A 1SQVH 1CP9A 2B5UA 2HLDG 1A32A 1K4CC 3OT7A 1ZX3A 5BR8O 4TV8B 4O4JA 4FZ1A 2B1GA 5FNVA 4G2KA 4G28B 4YY3B 3E22A 2CUGA 1PD3A 2H8PC 4PA7A 1WJZA 2IU3A 2YDEA 2FB5A 2N05A 2Q6AA 2ITCC 4WFBV 2ZT9B 1K5SA 1U96A 2RCVA 2V7QG 2YEVB 2HHHB 1LNQA 2OIGA 2Q4PA 2GSMB 4UVBA 1HNWO 4MVQA 2LGWA 4J9ZB 2BSKA 2AXTZ 2GTAA 1GMGA 3M99B 2QWNB 2WLIB 5H5NA 3L72H 1H2MA 4EFEA 3H1HH 3AG1B 1XILA 3CSXA 1FFXA 3MHSC 2VS0A 3CYOA 2UU9B 1NH2D 2D3OW 4CC6A 1IXBA 5L3BA 5EIBC 1MZFA 2QTOA 1GKFA 4JZGA 1K73W 2ZD9A 5LYJA 3HR0A 4K8ZA 3RYCB 3G6EV 4UCSA 1WB8A 2BTQB 3PN1A 1BSMA 3CCVV 2WAMA 1VQ5V 4A5UB 4BW5A 2A9HA 5CBGA 4WBNB 3ASNC 4C7UA 1N33O 4O4LA 1LUWA 2XASA 2F4VO 1I94B 1XL6A 3L73H 4RUEA 1NVPB 1NT2B 2X7RB 3LSUA 5KX5A 1OCOC 3OE7G 1B06A 1XDCA 1DTOA 2WA4A 3H1JH 1AR5A 4F4LA 4MW8A 3ZN0A 3RWRD 4PELA 1AR4A 3CD6V 4YHHO 4YJ2B 3CXHF 4PDMA 4K35A 4JAAA 4XDJA 1G8MA 4FMTA 5HFMA 2AZ0A 2F23A 1KUQA 4DV0O 2ZE6A 2RJZA 3JARA 1YTFB 4ABMA 1GM8A 2E74B 3ZX6A 3T2MA 1L8DA 1ZAUA 1CPYA 3K9AA 4I5SA 5C8YB 5KUMA 1MABG 1SF9A 1S76D 1M56B 5L3CA 1NR1A 1Q82W 2DWEC 4K0KB 2Y69C 4R8CA 2EZOA 2A7WA 3E8FA 1D5NA 4FK5C 2XAQA 2ILMA 3JALB 2ZE8A 2ZXWC 5CA0A 2MK3A 1R3LC 4DV3O 4DR1O 5L3DA 1VMGA 1QCEA 2JEXA 5IT9N 3JD3A 3CC2V 5A2QN 4YIOA 1KP3A 2EIMC 3CS5A 1F4NA 1SQFA 2AHYA 3P32A 1IBLO 3OMNB 1M57B 4U3FH 1E1QG 1R3KC 3BVOA 1Q43A 1AI7A 2JRIA 1NKDA 3JATB 4TV9B 4JI0B 4B3MB 1TGOA 1VF6A 3B8MA 3N2GA 2IBZH 3R65A 2WLLA 4JI1B 1IBKO 3E22B 2Z3YA 2ITDC 4IIJA 3U10A 4B3TO 5LMUO 2P6JA 4JYYA 4DR5B 2EINB 2M6YA 4MS2A 4O2BB 2KSDA 1EZJA 1JNBA 2X6BA 1K34A 5IWAO 1O9HA 4JYAO 4UUJC 1YVWA 1B04A 4JI8B 2OTLV 1AB3A 4DV4B 5EK0A 4DUYB 1M5IA 1XMQO 4QGPA 4DR3B 5LGTA 2E5LO 4WFHA 1DGSA 2OCHA 2ZM6B 3E8BA 3RBZA 3SJAC 4WFFA 5BMVA 1MSDA 4LFCO 1N32B 3ZMVA 1JA8A 5JVDA 5K1PA 1K33A 2OCCB 5LA6A 2ZIMA 3K03A 4X9QA 4WFEA 1EFRG 5CBFA 3JAWA 4JI2B 2PTMA 4CH5A 4DV1O 1EZVH 2DOSA 4JGSA 5LYJB 1Q86W 5KHIA 3R66A 5J2UB 2EIKC 4H37A 3VQYA 4P9OA 1KMIZ 1K4DC 1OCZC 1JMKC 2XAHA 4IGGA 4H0LB 1WA8A 1TA8A 1YJWV 1QR9A 4W4LA 1W59A 1XNQB 5LP6A 4X62O 5J2TB 1PL0A 1FAFA 1Q81W 4X1KA 5H2FZ 2CTWA 2F95B 3K5MA 4O4LB 4UCUA 4DXWA 2V4DA 2OTJV 1NBMG 1E1RG 1IDSA 3OR6C 3OTOB 4J7KA 4CH6A 2IH1C 1WLEA 5JQGA 3Q4HA 4F6EA 3I56V 3D36A 4NXMO 3I5DA 1RP3B 3MHHC 2KQXA 3ZMUA 1YTFD 1TUEB 3AG4B 2A79B 3RYFA 1J5EB 5CN0A 2UUAB 1KB9F 4KHPB 1P84F 1SA0A 3ZEDA 3THOA 2DYSC 4DV2B 3JARB 4LWSA 5IY5C 2PUSA 2QA4V 1XL4A 1R73A 1EN4A 2L6LA 5K1XA 1HP8A 4JF3A 3ABMC 3FB6C 5B5EZ 4PV1B 1FXKA 3SJQC 2ZNJA 2ODMA 3L70H 5CA0B 5LMUB 4LNUA 4LF8B 2IW5A 2JIZG 4JASA 4J80A 1SS3A 1H8EG 1XNRO 2GV9A 2WLKA 1BGYH 2NR5A 1HR0O 3FD9A 2ZR3A 4DRXA 3EFFK 1VIBA 1VF6C 2FMLA 1HDJA 2EZPA 3O9OA 4FLWA 2ZDIC 1US6A 3SPIA 1IXMA 2R70A 2ADQB 3E86A 1WPBA 2WLLB 3FB5C 3MD0A 4UV8A 3CCLV 3A0BZ 3JD2A 1L1FA 4CZZA 4I4TA 5IDJA 4IHJA 5KHHA 2VRZA 3UO2A 1S0VA 1N36B 4P30A 2JJ2G 4JYBA 1E79G 2PYLA 3D3IA 3KDRA 2K9PA 2G38A 4IL6Z 4CS3A 3EHBB 4HNAB 5IYZB 4EKWA 1K8AW 3KCXA 2YEVA 1KKDA 4J7JA 4GKJB 5JVDB 4ZOLB 2LQTA 3JSLA 3TJTA 1S5JA 3K5LA 2Z0AA 4BR6A 3SYCA 3TXQA 2F93B 1K7DA 5LP6C 4I55B 1EBOA 3ETQA 1YI2V 1ZTEA 4G27B 1V55C 4YY3O 3STZC 4UB6Z 4I9WA 3ABKC 3B8NA 4AI8A 5B3SC 1IX9A 3U11A 4X1KB 4ZHQA 1F7YA 4MVUA 2HHHO 1NH2B 3RYCA 1VP7A 5JCOA 5CMUA 3H9VA 2BTQA 4MVOA 1BQ0A 5JQGB 3Q4HB 1GRJA 1GO3F 4WBNA 3WG7B 1QLNA 3G4SV 2HG5C 3RYFB 1HR0B 4DR4O 3P3PA 1M9NA 3DTUB 1O9GA 2UU9O 4FIPC 4LWSB 1Q6UA 3WB2A 3T1CA 1LR1A 1FXKC 4TSFG 1RFYA 2DQ0A 3CP1A 2CTPA 4YJ2A 2EJRA 5CA1B 2LO1A 5ITZB 2WWWA 2LP7A 5LXTA 4MTXA 4LCUC 5EZYA 2BOBC 2EILB 4ZIBA 1NTZH 2W0XA 1SQGA 3NXSA 5C8YA 1Q7YW 1I94O 1NTKH 1EN5A 4QPKA 2HP8A 1BQZA 3ZS8C 1YDXA 4DRXB 1TVKA 4PA3A 1ZL8B 3WB0A 3MDSA 3ZRWB 1UPGA 2KG7B 4X1IA 2IH3C 3B77A 4QE7A 1BMFG 4HBNA 1FPOA 2UUBB 1FS0G 3OEHG 1VQOV 4GYCB 3DSQA 1V54B 2AGAA 5CB4B 3CHXA 3UQ8A 4J42A 1DLBA 1FXVA 4I4TB 4IHJB 4WCEV 1HNZB 2NNUA 1YXBA 4TV9A 3JATA 3M8AA 3CXCU 2IJIA 1VQ7V 2EIJB 1IZ3A 4K0KO 1AI5A 5GTIZ 1GM9A 1PNKA 1CXZB 3SYAA 2ZIOA 3JAMN 3U0ZA 4P9PA 2HJFC 4BWAA 1M90W 4O2BA 2KKWA 4PA6A 3AG1C 2QKAA 3STLC 2Q68A 3SYOA 4R6ZA 2ZE7A 3CB2A 1GH6A 3RN4A 3SDLA 1GAXA 1K92A 2E75B 3OEEG 2R9AA 4IYHA 1XI1A 1NQTA 3MAQA 3KKYA 3H1IH 4D6TH 3C3TA 4X88A 2RN9A 3E89A 1WPXA 1W0KG 2CDYA 1M1KW 4JI0O 4B3MO 2C2AA 2Q7GA 4MVRA 1OJHA 3WB1A 2B9ZA 5DEDA 4DR4B 2QJ1A 1M93A 4JI1O 3J80N 3ZMSA 5JCOC 1PNLA 2H3OA 4I50A 4ZBMA 1JX9A 2Q0AA 3A2FA 3IJ4A 5EC2C 4DR5O 3JASA 4N21A 3S3WA 4ZHQB 3G6BA 1Q90D 1YIJV 4DK0A 1TUBB 3OD4A 5J2UA 1MOFA 1PNMA 3AG3B 4D7SA 2PI5A 3CEIA 4XBFA 4JI8O 3SPHA 2JGDA 2BCCH 2IJKA 3W7UA 4DV4O 4DUYO 5KUKA 4NTWA 1DF5A 5J2TA 5B66Z 3VQXA 4OPHA 4DR3O 2XT9A 5L3GA 1Q6HA 3OMAB 2ZM6O 4I0XB 1X4TA 3IAYA 4FFBB 4JTAB 1N32O 2LW7A 3ZHSA 4H44B 1PKXA 3DXRA 4PDLA 4YIPA 3JD1A 2Q7HA 1PP9H 1XHXA 2CGOA 4Z1MG 4JI2O 2NN4A 1OCRB 1Y67A 3T4DA 1XBLA 2HFEC 3J7AU 1R6TA 2VQEB 3E8HA 4I7ZB 5DECA 4PA4A 3P30A 1M56C 4L8JA 2Q9LA 2P5OA 3OAAG 4JTDB 4LF7B 1XNQO 3IGAC 2QM8A 5LXTB 5EZYB 2RNBA 4FPPA 2GBOA 2P22C 3CCSV 1V9PA 3APOA 1GN2A 2EX3A 1PL4A 4JI6B 3K08A 1R1BA 2O57A 2OWOA 3OTOO 3DC6A 4LF4B 1TVKB 1ZSPA 3RW0A 5IJ0A 2UUCO 3N2KA 3CCRV 2W6IG 1SETA 2UXDB 1M57C 4FLUA 1Z5WA 3CWBH 5D5QA 4KP4A 1BS3A 4UCVA 4U3JB 4X1IB 1KP2A 4X1YB 4MTFA 5CBHA 1J5EO 2UUAO 2V1DA 4KHPO 3ML0A 5EC1C 4JV5B 4DV2O 2DYRB 2HR3A 3S3XA 3K59A 1Z2GA 3LDDA 3UM7A 3ETGA 3SR2C 2EINC 3F7VC 3TGUH 1Y74A 1NS1A 3UT5B 1F4MA 5JWPA 1UFIA 3SGIA 2ZXWB 2Y0IA 5H6QA 3ZRXA 4F6RA 2QWQB 1FKAO 1AJPA 1N0NA 4LF8O 3QO5A 4EEQA 1Y6XA 4KUMA 4DR6B 1NR7A 3ZHTA 1BZKA 1VARA 4JZ2A 4X89A 4TUYA 1RM1C 1BHBA 1H2GA 3ZHVA 3DGEA 2UXBB 3SPCA 2YXHA 1FOUA 2OCCC 1YJ9V 3AG2B 4NTYA 3X2QB 3CPWU 5B1AB 1D5AA 4HNAA 5IYZA 1RPOA 2PI4A 4RO2A 2PYJA 1NTMH 3LSSA 5IJ9B 1GK9A 4B7EA 4ZOLA 4HZ3A 4I50B 4IYIA 1WAZA 1N34B 1MSWD 3JASB 3ZHRA 2JK5C 4QNHB 3ZBHA 4I55A 4OPAA 3CMAV 1N36O 4BIUA 3KCYA 4FM0A 4P2ZA 1SERA 2JGDB 2YXYA 1URFA 2QDOA 3BA9A 4L87A 3JYCA 3A0RA 1QU7A 3ZMTA 4NVPA 4PI2A 4GKJO 3FX7A 3CCMV 1OV9A 3AG4C 2DJVA 3L74H 3DXRB 2Q69A 3E35A 1JOYA 3QNEA 3KG2A 2YC0A 3F5TA 3LNNA 2UUCB 3W7XA 1MNGA 1VQ9V 4GKKB 4FM1A 1OZ0A 3RFRA 2QKCA 4DV5B 4X65B 1T5EA 3H01A 2IJHA 2N04A 1H8HG 2QR4A 1M4UA 1FFTB 3M7MX 5LHHA 3B09A 1AVMA 3JAKB 4PI0A 4KL1A 4WFGA 2VQFB 1G1XB 1VQKV 1SZTA 4AILC 1IURA 3RT3C 2YIBD 2MW2B 3A8TA 2A0LA 3CMEV 4GT1A 5CA1A 1MZEA 2YIAA 4FFKA 2WLJA 5ITZA 4GZRB 1OCCB 5IJ0B 3CCJV 3HKBA 1AR1B 3ABLB 3N2KB 1I08A 2ZR2A 1W2BU 4B3RB 2QWOB 3CRMA 1N8RW 3SJBC 5LHIA 4TOIA 2ZE5A 3UKMA 3RYIB 4BW9A 2YSUB 1W0JG 3H1KH 2P67A 1HNXB 3VOUA 4GX1A 1BL8A 1ZL8A 2A06H 4JTCB 4X20B 5EBLC 3ZRWA 1COWG 4J10A 3HB3B 1K97A 3FAVB 3B40A 3T1YB 2KG7A 1Y4MA 4X8AA 3CCEV 4AHCA 2GUZB 4UVAA 3K58A 1H2SB 3UO3A 1Y74B 3GVMA 1VQ6V 2AHZA 5FLXN 5KAFZ 1I5YA 5A9GA 5CB4A 2WLHA 1J95A 4F6RB 1P4RA 3APQA 3K0GA 4QE9A 2DW4A 4WFAV 1JJ2U 5EBMC 2XTAA 1S5HC 4GCZA 4PDRA 4TUYB 2UXCB 4MVSA 4DR7B 2DMXA 2RMKB 4O2AB 1H2NA 3GWKC 1AJQA 5F2VO 2YXLA 1B6QA 2H94A 4H33A 2F66C 1NJIW 2X6CA 2QE7G 4UFZA 4YXWG 4DK1A 1P7GA 1XMOB 3ASOB 3T4ZA 2UUBO 3L75H 2CTQA 2XNDG 3OMIB 2ZINA 3ZHUA 4DV6B 1VQMV 5DN6G 2ZQMA 4D7TA 3BFRA 3AK3A 2ZKOA 1HNZO 3E83A 3K5NA 4DW1A 4ZI7B 1BE3H 2AZ2A 5GW7A 4GX5A 2E3CA 2K1EA 1YCIA 2QGNA 2VWKA 5B1BB 3D36C 2XAJA 4EB6B 1TUBA 3K0DA 5LMNB 1JPXA 3WG7C 3HKDB 2LFRA 1Q5OA 1JCHA 4J41A 2HVJC 1XUQA 4K3AA 4ZKIA 3ZJZA 1Q8IA 4LF9B 4DUZB 4NXNB 2Y4TA 1WP8A 4LF5O 1QLEB 1RPRA 4GUNA 4I0XA 1FD9A 1AJNA 4QJFB 4FFBA 1DK1A 4UVCA 5LGNA 1KYOF 4MTOA 1R3JC 2P7TC 4MT8A 1ROPA 4LH7A 3IC7A 5C93A 3CRCA 2JGUA 3FKSG 2YICA 2HVKC 2GTSA 2ZNIA 1R3IC 3GWOA 4BIOA 1THZA 3D3QA 2EILC 5D5PA 2B1IA 3OM3B 3K5OA 4W4KA 5KAIZ 1L0NH 2BE3A 2EBOA 3F7YC 4LR3A 3RYHB 2RDCA 3HKBB 5J9PC 3QG5A 2F43G 5FPOA 4HYOA 3ZIAG 1G6UA 4OGQB 4PD4F 5KA6A 1F51A 3CRRA 4QIWF 4DR2B 4BAYA 2YIBA 4FVMA 1H2LA 2WLMA 1V54C 4DV7B 3BEHA 3AG7A 1ZWIC 4UXNA 1EN6A 3OGCC 4JPRA 1QBZA 1NZ6A 4U3JA 4X1YA 2VQEO 2W0FC 3ETDA 3KZIZ 1RSOB 2P90A 4JI4B 5GONB 4UCTA 4LF7O 1PV0A 3BABA 1G4YB 4DYLA 4LH6A 3W7WA 3O65A 3ZRSA 5KMGB 4RQFA 3P3NA 3UT5A 4UCOA 2CTRA 4JI6O 4JI3B 4LF4O 1Y76B 4U7NA 1KKCA 1YITV 1F23A 4CC5A 4GLXA 4OX9B 2UXDO 4ICGA 2GHYA 2FYUH 4LF6B 3CC4V 3UCSC 3T1HB 2WLNA 5EYPA 2ATKC 5BXZA 3VQVA 2JDIG 3D8CA 4JV5O 2LGQA 4LFBB 2X6AA 3EVKA 1XEQA 3B2EE 3WFVA 1VQ8V 4LFAB 1R6NA 2FTKA 3FB8C 4NTXA 4LF5B 3QVNA 2CE4A 1I5XA 1KD1W 3OUFA 2CH7B 3C3SA 4JI7B 5IJ9A 5IYCO 3AG3C 3K9SA 3I55V 4GX2A 3H1LH 1YJNV 2YI9A 3SJCC 4MVZA 3JD0A 1S5LZ 3K06A 1H5WA 1MA1A 4DR6O 2ARHA 3EXAA 3N27A 5LGUA 4UB8Z 4DO2A 5IE9A 4FLVA 5TISZ 4X64B 2UXBO 4AQYB 4NKGB 4DW0A 2JS5A 2LJ2A 2Y0PA 2ADPA 4PHZA 1OCRC 4MSWC 3ZMZA 3CRQA 3ZCCA 4FLYA 4JAVA 2X0LA 4Q20A 1MG1A 3FYIB 1N34O 4EFBA 1EM1A 1FJGB 3K04A 3HPLC 5B1NA 2Z5UA 4CS4A 2DN9A 5LL6Y 2YS8A 4GX0A 3CJHA 5KHGA 4K8XA 3JAKA 5IYBO 5LOVB 1JJOA 4B3SB 3K3WA 2WPDG 2PZSA 1LUVA 3ASNB 5JJNB 3CX5F 1SKVA 3CC7V 1DF4A 2WSSG 2CGNA 2R9RB 4LC1A 4FLZA 1IBMB 2M7WA 4MTGA 3CRAA 4O4HA 1OCOB 4LP8A 4CH4A 4X66B 1D2DA 3RGBA 3TCUA 4RAIA 2D2CB
chains in the Genus database with same CATH topology
1SZXA 3TJTA 1PM9A 4BR6A 3QVNA 1MNGA 2CE4A 3LSUA 1BT8A 1B06A 1XDCA 3CEIA 3OT7A 1EN4A 3C3SA 1AR5A 3MDSA 2P4KA 3AK2A 2QKCA 1ZTEA 1AR4A 1GN6A 1GN3A 1P7GA 1N0JA 3K9SA 1N0NA 1AVMA 1MSDA 1MA1A 5AG2A 1JA8A 1IX9A 1VARA 4JZ2A 4YIPA 4X9QA 3BFRA 2RCVA 3AK3A 1AP5A 1Y67A 1AP6A 2GDSA 4FFKA 2ADPA 1EN6A 3DC5A 1I08A 1D5NA 1ZLZA 2ADQB 1I0HA 1XILA 1WB7A 4E4EA 2QKAA 1GN4A 1EM1A 4YIOA 3RN4A 1IXBA 1GN2A 1XUQA 1PL4A 3IC9A 1IDSA 1XREA 2AW9A 3KKYA 4JZGA 3DC6A 3C3TA 1ZSPA 1KKCA 4F6EA 1VEWA 4GUNA 2CDYA 1JR9A 1WB8A 1LUVA 1BSMA 1BS3A 5A9GA 3KDRA 1MMMA 3AK1A 4C7UA 4JYYA 1LUWA 1ZUQA 3EVKA 1QNMA 1EN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZX A;  3TJT A;  1PM9 A;  4BR6 A;  3QVN A;  1MNG A;  2CE4 A;  3LSU A;  1BT8 A;  1B06 A;  1XDC A;  3CEI A;  3OT7 A;  1EN4 A;  3C3S A;  1AR5 A;  3MDS A;  2P4K A;  3AK2 A;  2QKC A;  1ZTE A;  1AR4 A;  1GN6 A;  1GN3 A;  1P7G A;  1N0J A;  3K9S A;  1N0N A;  1AVM A;  1MSD A;  1MA1 A;  5AG2 A;  1JA8 A;  1IX9 A;  1VAR A;  4JZ2 A;  4YIP A;  4X9Q A;  3BFR A;  2RCV A;  3AK3 A;  1AP5 A;  1Y67 A;  1AP6 A;  2GDS A;  4FFK A;  2ADP A;  1EN6 A;  3DC5 A;  1I08 A;  1D5N A;  1ZLZ A;  2ADQ B;  1I0H A;  1XIL A;  1WB7 A;  4E4E A;  2QKA A;  1GN4 A;  1EM1 A;  4YIO A;  3RN4 A;  1IXB A;  1GN2 A;  1XUQ A;  1PL4 A;  3IC9 A;  1IDS A;  1XRE A;  2AW9 A;  3KKY A;  4JZG A;  3DC6 A;  3C3T A;  1ZSP A;  1KKC A;  4F6E A;  1VEW A;  4GUN A;  2CDY A;  1JR9 A;  1WB8 A;  1LUV A;  1BSM A;  1BS3 A;  5A9G A;  1MMM A;  3AK1 A;  4C7U A;  4JYY A;  1LUW A;  1ZUQ A;  3EVK A;  1QNM A;  1EN5 A; 
#chains in the Genus database with same CATH topology
 2F1M A;  4J9Y B;  4PDV A;  1XOU A;  2HEP A;  2DYR C;  1JFF B;  3BCC H;  4GKK O;  4PJ0 Z;  2QSA A;  4HAM A;  5BR8 B;  2DWD C;  2QWR B;  2EUL A;  3RYI A;  4DV5 O;  4X65 O;  1KC8 W;  2YID A;  1AIL A;  4B7K A;  1GM7 A;  1IVS A;  1JQ0 A;  3JSN A;  1QQC A;  2VQF O;  3E8G A;  1YSC A;  3QF7 A;  4X20 A;  3FAV A;  1VQL V;  1ENV A;  3WU2 Z;  2GUZ A;  5JJJ B;  2Y69 B;  1HNW B;  3TXS A;  3BY6 A;  2ZCE A;  1Y66 A;  2JJ1 G;  4R50 A;  1JVM A;  1KQS U;  1S72 V;  2QM4 A;  3C90 A;  4IT5 A;  4B3R O;  3OFN G;  4Z2W A;  2ETN A;  3AG2 C;  1QVG U;  2W6J G;  3X2Q C;  1VQP V;  1B3Q A;  4QPJ A;  4O4J B;  2R72 A;  5B1A C;  5JJE B;  2EIM B;  3SPG A;  4RQE A;  2YUA A;  5EYP B;  4JYC A;  5FNV B;  4TQF A;  2HJD A;  2Q8V A;  4O2A A;  1HNX O;  2ZDI A;  2E76 B;  2Y4U A;  3PJS K;  2QEX V;  3ZN1 A;  2LFS A;  1K5Q A;  1AI6 A;  3T1Y O;  4WF9 V;  2Q5Z A;  3ZRV A;  2QM7 A;  2XAG A;  1HW7 A;  2CAZ C;  4FJC C;  2QTS A;  1FYJ A;  3OGI B;  1SQP H;  3QO7 A;  2P06 A;  3VQW A;  2BSK B;  1Q6I A;  3SYQ A;  2Y48 A;  1N33 B;  1RM1 B;  4ZI7 A;  2F4V B;  4KXR A;  2UXC O;  4DR7 O;  1FFX B;  3LSQ A;  3ZHQ A;  4MVM A;  2PGG A;  4J7Z A;  1SES A;  1VQN V;  2JEU A;  2DQ3 A;  2OYQ A;  2XHB A;  2DE0 X;  1R6K A;  2P4K A;  4OXS A;  3BPZ A;  1OHH G;  5EIB D;  3SYP A;  1IJG A;  4EB6 A;  3W7T A;  4YHH B;  5EBW C;  1XMO O;  1QHT A;  1NI8 A;  3HKD A;  3L71 H;  4DV6 O;  5AG2 A;  2Q73 A;  1P49 A;  3ABT A;  4DV0 B;  3FYE B;  3ETE A;  1NVP D;  4E2L A;  2A3Q A;  2XOK G;  1GTO A;  4I9Q A;  2EIK B;  2PF4 E;  2QKS A;  1SQQ H;  1P7B A;  1OCZ B;  3CCU V;  1YF2 A;  3ICX A;  2OT5 A;  2P4V A;  4CS2 A;  4KFM A;  3DC5 A;  1SC5 B;  1N4C A;  4Q6G A;  3CJH B;  5KX5 B;  2L35 A;  1BCC H;  1K3E A;  1ZLZ A;  1I0H A;  1OCC C;  4XDL A;  1FXH A;  1WB7 A;  3ABL C;  4DV3 B;  4DR1 B;  5CA3 A;  1WNS A;  3ABU A;  5LMN O;  1Z5V A;  3HKE A;  5E1A C;  4O4H B;  3G67 A;  4JI5 O;  5LHG A;  4O4I A;  3FFQ A;  5JH7 A;  3RYH A;  3IC9 A;  1IBL B;  4LF9 O;  4DUZ O;  1XRE A;  4NXN O;  5FPR A;  5FL7 G;  3B4S A;  1VEW A;  2FKX A;  1I7F A;  4YJ3 A;  3IFX A;  2IJJ A;  4TQD A;  2DYS B;  1YEW A;  4FZ0 A;  1VF5 B;  5GTH Z;  5IY5 B;  3J81 N;  1Q3E A;  4MW3 A;  1IBK B;  4B3T B;  1TAE A;  4RUF A;  3OW2 U;  4FLT A;  2PY5 A;  3CCQ V;  3LDC A;  3ABM B;  5H9C A;  2Q7E A;  3OUS A;  5IWA B;  3RVZ A;  1BT8 A;  4JYA B;  3CE2 A;  3RVY A;  3G71 V;  1RSO A;  3HKC A;  1KU9 A;  5GON A;  4H13 B;  2FL4 A;  1XMQ B;  1GN6 A;  1GN3 A;  4J11 A;  1N0J A;  3VBB A;  2E5L B;  4TT3 G;  5KMG A;  4LFC B;  1S77 D;  1XQ8 A;  3N2G B;  2WA3 A;  4DR2 O;  3BRC A;  3ASO C;  1Y76 A;  4BIZ A;  4IIJ B;  1AP6 A;  4DV7 O;  2OIE A;  4DV1 B;  4TV8 A;  1S3J A;  1H2K A;  4RWU A;  3GB7 C;  3LUT B;  4CH3 A;  4Z1V A;  4JI4 O;  2IM9 A;  2Q0O C;  1WP7 A;  5KLV H;  4X62 B;  3F5W C;  3TK1 A;  3TET A;  5B1B C;  1GN4 A;  4R7C A;  5BMV B;  2CH7 A;  3K57 A;  1PPJ H;  3SPJ A;  2UXX A;  1AI4 A;  4JI3 O;  3JD4 A;  5LA6 B;  3LNM B;  3OTF A;  1HWY A;  2WLI A;  5BY1 A;  4OX9 O;  3JAW B;  4NXM B;  3AEI A;  1JR9 A;  5KA5 A;  4LF6 O;  5DM6 V;  3T1H O;  1QLE C;  1MMM A;  4JAU A;  4N23 A;  2YI8 A;  1SQB H;  4JI5 B;  5L3F A;  2QWP B;  4XDK A;  1WA8 B;  4LFB O;  1ZUQ A;  3NR7 A;  2Q67 A;  4LFA O;  3BAA A;  5LP6 B;  2LW1 A;  1SZX A;  3LDE A;  1NU1 H;  1PM9 A;  5H6R A;  2R9I A;  3W7S A;  4CBC A;  1U97 A;  1XHZ A;  1V55 B;  5E79 Z;  4LBE C;  1KEC A;  1X59 A;  2XUM A;  3ABK B;  4JI7 O;  2BOC C;  2N74 A;  2KB1 A;  3AK2 A;  4ASU G;  1CEZ A;  5B3S B;  4B08 A;  2NLJ C;  4U7O A;  1SQX H;  1XNR B;  2UXN A;  4UCR A;  2VWJ A;  3HKE B;  3JCZ A;  5IYD O;  1YZB A;  4FM2 A;  4X64 O;  3L9D A;  3K79 A;  3OR7 C;  4O4I B;  1AP5 A;  5B1O A;  5JH7 B;  4AQY O;  1SA0 B;  5LOV A;  2JVD A;  1L0L H;  2GDS A;  2RQ6 A;  1WN7 A;  1VQ4 V;  2CK3 G;  3QO8 A;  3A0H Z;  4NR1 A;  1QR8 A;  4NB5 A;  4YJ3 B;  3QTC A;  4UV9 A;  2HKO A;  1ORQ C;  1KBH A;  4NYK A;  1FXK B;  1UJW B;  3E2E A;  1ARO P;  4E4E A;  1JFF A;  4LNU B;  1YHQ V;  3FB7 C;  1H38 A;  1FJG O;  5BZB A;  1QVF U;  5KHK A;  2AW9 A;  2JS3 A;  2EJ7 A;  3HKC B;  2XAF A;  2EIJ C;  4B3S O;  4FLX A;  3BHP A;  3JAL A;  5L3E A;  1BHA A;  3JCU Z;  1K9M W;  3AK1 A;  4PA9 A;  3G80 A;  1VF7 A;  1IBM O;  1SRY A;  4TWK A;  4X66 O;  2BTO A;  2IU0 A;  5KHJ A;  5LBQ A;  1QNM A;  5HFL A;  3BA8 A;  1SQV H;  1CP9 A;  2B5U A;  2HLD G;  1A32 A;  1K4C C;  3OT7 A;  1ZX3 A;  5BR8 O;  4TV8 B;  4O4J A;  4FZ1 A;  2B1G A;  5FNV A;  4G2K A;  4G28 B;  4YY3 B;  3E22 A;  2CUG A;  1PD3 A;  2H8P C;  4PA7 A;  1WJZ A;  2IU3 A;  2YDE A;  2FB5 A;  2N05 A;  2Q6A A;  2ITC C;  4WFB V;  2ZT9 B;  1K5S A;  1U96 A;  2RCV A;  2V7Q G;  2YEV B;  2HHH B;  1LNQ A;  2OIG A;  2Q4P A;  2GSM B;  4UVB A;  1HNW O;  4MVQ A;  2LGW A;  4J9Z B;  2BSK A;  2AXT Z;  2GTA A;  1GMG A;  3M99 B;  2QWN B;  2WLI B;  5H5N A;  3L72 H;  1H2M A;  4EFE A;  3H1H H;  3AG1 B;  1XIL A;  3CSX A;  1FFX A;  3MHS C;  2VS0 A;  3CYO A;  2UU9 B;  1NH2 D;  2D3O W;  4CC6 A;  1IXB A;  5L3B A;  5EIB C;  1MZF A;  2QTO A;  1GKF A;  4JZG A;  1K73 W;  2ZD9 A;  5LYJ A;  3HR0 A;  4K8Z A;  3RYC B;  3G6E V;  4UCS A;  1WB8 A;  2BTQ B;  3PN1 A;  1BSM A;  3CCV V;  2WAM A;  1VQ5 V;  4A5U B;  4BW5 A;  2A9H A;  5CBG A;  4WBN B;  3ASN C;  4C7U A;  1N33 O;  4O4L A;  1LUW A;  2XAS A;  2F4V O;  1I94 B;  1XL6 A;  3L73 H;  4RUE A;  1NVP B;  1NT2 B;  2X7R B;  3LSU A;  5KX5 A;  1OCO C;  3OE7 G;  1B06 A;  1XDC A;  1DTO A;  2WA4 A;  3H1J H;  1AR5 A;  4F4L A;  4MW8 A;  3ZN0 A;  3RWR D;  4PEL A;  1AR4 A;  3CD6 V;  4YHH O;  4YJ2 B;  3CXH F;  4PDM A;  4K35 A;  4JAA A;  4XDJ A;  1G8M A;  4FMT A;  5HFM A;  2AZ0 A;  2F23 A;  1KUQ A;  4DV0 O;  2ZE6 A;  2RJZ A;  3JAR A;  1YTF B;  4ABM A;  1GM8 A;  2E74 B;  3ZX6 A;  3T2M A;  1L8D A;  1ZAU A;  1CPY A;  3K9A A;  4I5S A;  5C8Y B;  5KUM A;  1MAB G;  1SF9 A;  1S76 D;  1M56 B;  5L3C A;  1NR1 A;  1Q82 W;  2DWE C;  4K0K B;  2Y69 C;  4R8C A;  2EZO A;  2A7W A;  3E8F A;  1D5N A;  4FK5 C;  2XAQ A;  2ILM A;  3JAL B;  2ZE8 A;  2ZXW C;  5CA0 A;  2MK3 A;  1R3L C;  4DV3 O;  4DR1 O;  5L3D A;  1VMG A;  1QCE A;  2JEX A;  5IT9 N;  3JD3 A;  3CC2 V;  5A2Q N;  4YIO A;  1KP3 A;  2EIM C;  3CS5 A;  1F4N A;  1SQF A;  2AHY A;  3P32 A;  1IBL O;  3OMN B;  1M57 B;  4U3F H;  1E1Q G;  1R3K C;  3BVO A;  1Q43 A;  1AI7 A;  2JRI A;  1NKD A;  3JAT B;  4TV9 B;  4JI0 B;  4B3M B;  1TGO A;  1VF6 A;  3B8M A;  3N2G A;  2IBZ H;  3R65 A;  2WLL A;  4JI1 B;  1IBK O;  3E22 B;  2Z3Y A;  2ITD C;  4IIJ A;  3U10 A;  4B3T O;  5LMU O;  2P6J A;  4JYY A;  4DR5 B;  2EIN B;  2M6Y A;  4MS2 A;  4O2B B;  2KSD A;  1EZJ A;  1JNB A;  2X6B A;  1K34 A;  5IWA O;  1O9H A;  4JYA O;  4UUJ C;  1YVW A;  1B04 A;  4JI8 B;  2OTL V;  1AB3 A;  4DV4 B;  5EK0 A;  4DUY B;  1M5I A;  1XMQ O;  4QGP A;  4DR3 B;  5LGT A;  2E5L O;  4WFH A;  1DGS A;  2OCH A;  2ZM6 B;  3E8B A;  3RBZ A;  3SJA C;  4WFF A;  5BMV A;  1MSD A;  4LFC O;  1N32 B;  3ZMV A;  1JA8 A;  5JVD A;  5K1P A;  1K33 A;  2OCC B;  5LA6 A;  2ZIM A;  3K03 A;  4X9Q A;  4WFE A;  1EFR G;  5CBF A;  3JAW A;  4JI2 B;  2PTM A;  4CH5 A;  4DV1 O;  1EZV H;  2DOS A;  4JGS A;  5LYJ B;  1Q86 W;  5KHI A;  3R66 A;  5J2U B;  2EIK C;  4H37 A;  3VQY A;  4P9O A;  1KMI Z;  1K4D C;  1OCZ C;  1JMK C;  2XAH A;  4IGG A;  4H0L B;  1WA8 A;  1TA8 A;  1YJW V;  1QR9 A;  4W4L A;  1W59 A;  1XNQ B;  5LP6 A;  4X62 O;  5J2T B;  1PL0 A;  1FAF A;  1Q81 W;  4X1K A;  5H2F Z;  2CTW A;  2F95 B;  3K5M A;  4O4L B;  4UCU A;  4DXW A;  2V4D A;  2OTJ V;  1NBM G;  1E1R G;  1IDS A;  3OR6 C;  3OTO B;  4J7K A;  4CH6 A;  2IH1 C;  1WLE A;  5JQG A;  3Q4H A;  4F6E A;  3I56 V;  3D36 A;  4NXM O;  3I5D A;  1RP3 B;  3MHH C;  2KQX A;  3ZMU A;  1YTF D;  1TUE B;  3AG4 B;  2A79 B;  3RYF A;  1J5E B;  5CN0 A;  2UUA B;  1KB9 F;  4KHP B;  1P84 F;  1SA0 A;  3ZED A;  3THO A;  2DYS C;  4DV2 B;  3JAR B;  4LWS A;  5IY5 C;  2PUS A;  2QA4 V;  1XL4 A;  1R73 A;  1EN4 A;  2L6L A;  5K1X A;  1HP8 A;  4JF3 A;  3ABM C;  3FB6 C;  5B5E Z;  4PV1 B;  1FXK A;  3SJQ C;  2ZNJ A;  2ODM A;  3L70 H;  5CA0 B;  5LMU B;  4LNU A;  4LF8 B;  2IW5 A;  2JIZ G;  4JAS A;  4J80 A;  1SS3 A;  1H8E G;  1XNR O;  2GV9 A;  2WLK A;  1BGY H;  2NR5 A;  1HR0 O;  3FD9 A;  2ZR3 A;  4DRX A;  3EFF K;  1VIB A;  1VF6 C;  2FML A;  1HDJ A;  2EZP A;  3O9O A;  4FLW A;  2ZDI C;  1US6 A;  3SPI A;  1IXM A;  2R70 A;  2ADQ B;  3E86 A;  1WPB A;  2WLL B;  3FB5 C;  3MD0 A;  4UV8 A;  3CCL V;  3A0B Z;  3JD2 A;  1L1F A;  4CZZ A;  4I4T A;  5IDJ A;  4IHJ A;  5KHH A;  2VRZ A;  3UO2 A;  1S0V A;  1N36 B;  4P30 A;  2JJ2 G;  4JYB A;  1E79 G;  2PYL A;  3D3I A;  3KDR A;  2K9P A;  2G38 A;  4IL6 Z;  4CS3 A;  3EHB B;  4HNA B;  5IYZ B;  4EKW A;  1K8A W;  3KCX A;  2YEV A;  1KKD A;  4J7J A;  4GKJ B;  5JVD B;  4ZOL B;  2LQT A;  3JSL A;  3TJT A;  1S5J A;  3K5L A;  2Z0A A;  4BR6 A;  3SYC A;  3TXQ A;  2F93 B;  1K7D A;  5LP6 C;  4I55 B;  1EBO A;  3ETQ A;  1YI2 V;  1ZTE A;  4G27 B;  1V55 C;  4YY3 O;  3STZ C;  4UB6 Z;  4I9W A;  3ABK C;  3B8N A;  4AI8 A;  5B3S C;  1IX9 A;  3U11 A;  4X1K B;  4ZHQ A;  1F7Y A;  4MVU A;  2HHH O;  1NH2 B;  3RYC A;  1VP7 A;  5JCO A;  5CMU A;  3H9V A;  2BTQ A;  4MVO A;  1BQ0 A;  5JQG B;  3Q4H B;  1GRJ A;  1GO3 F;  4WBN A;  3WG7 B;  1QLN A;  3G4S V;  2HG5 C;  3RYF B;  1HR0 B;  4DR4 O;  3P3P A;  1M9N A;  3DTU B;  1O9G A;  2UU9 O;  4FIP C;  4LWS B;  1Q6U A;  3WB2 A;  3T1C A;  1LR1 A;  1FXK C;  4TSF G;  1RFY A;  2DQ0 A;  3CP1 A;  2CTP A;  4YJ2 A;  2EJR A;  5CA1 B;  2LO1 A;  5ITZ B;  2WWW A;  2LP7 A;  5LXT A;  4MTX A;  4LCU C;  5EZY A;  2BOB C;  2EIL B;  4ZIB A;  1NTZ H;  2W0X A;  1SQG A;  3NXS A;  5C8Y A;  1Q7Y W;  1I94 O;  1NTK H;  1EN5 A;  4QPK A;  2HP8 A;  1BQZ A;  3ZS8 C;  1YDX A;  4DRX B;  1TVK A;  4PA3 A;  1ZL8 B;  3WB0 A;  3MDS A;  3ZRW B;  1UPG A;  2KG7 B;  4X1I A;  2IH3 C;  3B77 A;  4QE7 A;  1BMF G;  4HBN A;  1FPO A;  2UUB B;  1FS0 G;  3OEH G;  1VQO V;  4GYC B;  3DSQ A;  1V54 B;  2AGA A;  5CB4 B;  3CHX A;  3UQ8 A;  4J42 A;  1DLB A;  1FXV A;  4I4T B;  4IHJ B;  4WCE V;  1HNZ B;  2NNU A;  1YXB A;  4TV9 A;  3JAT A;  3M8A A;  3CXC U;  2IJI A;  1VQ7 V;  2EIJ B;  1IZ3 A;  4K0K O;  1AI5 A;  5GTI Z;  1GM9 A;  1PNK A;  1CXZ B;  3SYA A;  2ZIO A;  3JAM N;  3U0Z A;  4P9P A;  2HJF C;  4BWA A;  1M90 W;  4O2B A;  2KKW A;  4PA6 A;  3AG1 C;  2QKA A;  3STL C;  2Q68 A;  3SYO A;  4R6Z A;  2ZE7 A;  3CB2 A;  1GH6 A;  3RN4 A;  3SDL A;  1GAX A;  1K92 A;  2E75 B;  3OEE G;  2R9A A;  4IYH A;  1XI1 A;  1NQT A;  3MAQ A;  3KKY A;  3H1I H;  4D6T H;  3C3T A;  4X88 A;  2RN9 A;  3E89 A;  1WPX A;  1W0K G;  2CDY A;  1M1K W;  4JI0 O;  4B3M O;  2C2A A;  2Q7G A;  4MVR A;  1OJH A;  3WB1 A;  2B9Z A;  5DED A;  4DR4 B;  2QJ1 A;  1M93 A;  4JI1 O;  3J80 N;  3ZMS A;  5JCO C;  1PNL A;  2H3O A;  4I50 A;  4ZBM A;  1JX9 A;  2Q0A A;  3A2F A;  3IJ4 A;  5EC2 C;  4DR5 O;  3JAS A;  4N21 A;  3S3W A;  4ZHQ B;  3G6B A;  1Q90 D;  1YIJ V;  4DK0 A;  1TUB B;  3OD4 A;  5J2U A;  1MOF A;  1PNM A;  3AG3 B;  4D7S A;  2PI5 A;  3CEI A;  4XBF A;  4JI8 O;  3SPH A;  2JGD A;  2BCC H;  2IJK A;  3W7U A;  4DV4 O;  4DUY O;  5KUK A;  4NTW A;  1DF5 A;  5J2T A;  5B66 Z;  3VQX A;  4OPH A;  4DR3 O;  2XT9 A;  5L3G A;  1Q6H A;  3OMA B;  2ZM6 O;  4I0X B;  1X4T A;  3IAY A;  4FFB B;  4JTA B;  1N32 O;  2LW7 A;  3ZHS A;  4H44 B;  1PKX A;  3DXR A;  4PDL A;  4YIP A;  3JD1 A;  2Q7H A;  1PP9 H;  1XHX A;  2CGO A;  4Z1M G;  4JI2 O;  2NN4 A;  1OCR B;  1Y67 A;  3T4D A;  1XBL A;  2HFE C;  3J7A U;  1R6T A;  2VQE B;  3E8H A;  4I7Z B;  5DEC A;  4PA4 A;  3P30 A;  1M56 C;  4L8J A;  2Q9L A;  2P5O A;  3OAA G;  4JTD B;  4LF7 B;  1XNQ O;  3IGA C;  2QM8 A;  5LXT B;  5EZY B;  2RNB A;  4FPP A;  2GBO A;  2P22 C;  3CCS V;  1V9P A;  3APO A;  1GN2 A;  2EX3 A;  1PL4 A;  4JI6 B;  3K08 A;  1R1B A;  2O57 A;  2OWO A;  3OTO O;  3DC6 A;  4LF4 B;  1TVK B;  1ZSP A;  3RW0 A;  5IJ0 A;  2UUC O;  3N2K A;  3CCR V;  2W6I G;  1SET A;  2UXD B;  1M57 C;  4FLU A;  1Z5W A;  3CWB H;  5D5Q A;  4KP4 A;  1BS3 A;  4UCV A;  4U3J B;  4X1I B;  1KP2 A;  4X1Y B;  4MTF A;  5CBH A;  1J5E O;  2UUA O;  2V1D A;  4KHP O;  3ML0 A;  5EC1 C;  4JV5 B;  4DV2 O;  2DYR B;  2HR3 A;  3S3X A;  3K59 A;  1Z2G A;  3LDD A;  3UM7 A;  3ETG A;  3SR2 C;  2EIN C;  3F7V C;  3TGU H;  1Y74 A;  1NS1 A;  3UT5 B;  1F4M A;  5JWP A;  1UFI A;  3SGI A;  2ZXW B;  2Y0I A;  5H6Q A;  3ZRX A;  4F6R A;  2QWQ B;  1FKA O;  1AJP A;  1N0N A;  4LF8 O;  3QO5 A;  4EEQ A;  1Y6X A;  4KUM A;  4DR6 B;  1NR7 A;  3ZHT A;  1BZK A;  1VAR A;  4JZ2 A;  4X89 A;  4TUY A;  1RM1 C;  1BHB A;  1H2G A;  3ZHV A;  3DGE A;  2UXB B;  3SPC A;  2YXH A;  1FOU A;  2OCC C;  1YJ9 V;  3AG2 B;  4NTY A;  3X2Q B;  3CPW U;  5B1A B;  1D5A A;  4HNA A;  5IYZ A;  1RPO A;  2PI4 A;  4RO2 A;  2PYJ A;  1NTM H;  3LSS A;  5IJ9 B;  1GK9 A;  4B7E A;  4ZOL A;  4HZ3 A;  4I50 B;  4IYI A;  1WAZ A;  1N34 B;  1MSW D;  3JAS B;  3ZHR A;  2JK5 C;  4QNH B;  3ZBH A;  4I55 A;  4OPA A;  3CMA V;  1N36 O;  4BIU A;  3KCY A;  4FM0 A;  4P2Z A;  1SER A;  2JGD B;  2YXY A;  1URF A;  2QDO A;  3BA9 A;  4L87 A;  3JYC A;  3A0R A;  1QU7 A;  3ZMT A;  4NVP A;  4PI2 A;  4GKJ O;  3FX7 A;  3CCM V;  1OV9 A;  3AG4 C;  2DJV A;  3L74 H;  3DXR B;  2Q69 A;  3E35 A;  1JOY A;  3QNE A;  3KG2 A;  2YC0 A;  3F5T A;  3LNN A;  2UUC B;  3W7X A;  1MNG A;  1VQ9 V;  4GKK B;  4FM1 A;  1OZ0 A;  3RFR A;  2QKC A;  4DV5 B;  4X65 B;  1T5E A;  3H01 A;  2IJH A;  2N04 A;  1H8H G;  2QR4 A;  1M4U A;  1FFT B;  3M7M X;  5LHH A;  3B09 A;  1AVM A;  3JAK B;  4PI0 A;  4KL1 A;  4WFG A;  2VQF B;  1G1X B;  1VQK V;  1SZT A;  4AIL C;  1IUR A;  3RT3 C;  2YIB D;  2MW2 B;  3A8T A;  2A0L A;  3CME V;  4GT1 A;  5CA1 A;  1MZE A;  2YIA A;  4FFK A;  2WLJ A;  5ITZ A;  4GZR B;  1OCC B;  5IJ0 B;  3CCJ V;  3HKB A;  1AR1 B;  3ABL B;  3N2K B;  1I08 A;  2ZR2 A;  1W2B U;  4B3R B;  2QWO B;  3CRM A;  1N8R W;  3SJB C;  5LHI A;  4TOI A;  2ZE5 A;  3UKM A;  3RYI B;  4BW9 A;  2YSU B;  1W0J G;  3H1K H;  2P67 A;  1HNX B;  3VOU A;  4GX1 A;  1BL8 A;  1ZL8 A;  2A06 H;  4JTC B;  4X20 B;  5EBL C;  3ZRW A;  1COW G;  4J10 A;  3HB3 B;  1K97 A;  3FAV B;  3B40 A;  3T1Y B;  2KG7 A;  1Y4M A;  4X8A A;  3CCE V;  4AHC A;  2GUZ B;  4UVA A;  3K58 A;  1H2S B;  3UO3 A;  1Y74 B;  3GVM A;  1VQ6 V;  2AHZ A;  5FLX N;  5KAF Z;  1I5Y A;  5A9G A;  5CB4 A;  2WLH A;  1J95 A;  4F6R B;  1P4R A;  3APQ A;  3K0G A;  4QE9 A;  2DW4 A;  4WFA V;  1JJ2 U;  5EBM C;  2XTA A;  1S5H C;  4GCZ A;  4PDR A;  4TUY B;  2UXC B;  4MVS A;  4DR7 B;  2DMX A;  2RMK B;  4O2A B;  1H2N A;  3GWK C;  1AJQ A;  5F2V O;  2YXL A;  1B6Q A;  2H94 A;  4H33 A;  2F66 C;  1NJI W;  2X6C A;  2QE7 G;  4UFZ A;  4YXW G;  4DK1 A;  1P7G A;  1XMO B;  3ASO B;  3T4Z A;  2UUB O;  3L75 H;  2CTQ A;  2XND G;  3OMI B;  2ZIN A;  3ZHU A;  4DV6 B;  1VQM V;  5DN6 G;  2ZQM A;  4D7T A;  3BFR A;  3AK3 A;  2ZKO A;  1HNZ O;  3E83 A;  3K5N A;  4DW1 A;  4ZI7 B;  1BE3 H;  2AZ2 A;  5GW7 A;  4GX5 A;  2E3C A;  2K1E A;  1YCI A;  2QGN A;  2VWK A;  5B1B B;  3D36 C;  2XAJ A;  4EB6 B;  1TUB A;  3K0D A;  5LMN B;  1JPX A;  3WG7 C;  3HKD B;  2LFR A;  1Q5O A;  1JCH A;  4J41 A;  2HVJ C;  1XUQ A;  4K3A A;  4ZKI A;  3ZJZ A;  1Q8I A;  4LF9 B;  4DUZ B;  4NXN B;  2Y4T A;  1WP8 A;  4LF5 O;  1QLE B;  1RPR A;  4GUN A;  4I0X A;  1FD9 A;  1AJN A;  4QJF B;  4FFB A;  1DK1 A;  4UVC A;  5LGN A;  1KYO F;  4MTO A;  1R3J C;  2P7T C;  4MT8 A;  1ROP A;  4LH7 A;  3IC7 A;  5C93 A;  3CRC A;  2JGU A;  3FKS G;  2YIC A;  2HVK C;  2GTS A;  2ZNI A;  1R3I C;  3GWO A;  4BIO A;  1THZ A;  3D3Q A;  2EIL C;  5D5P A;  2B1I A;  3OM3 B;  3K5O A;  4W4K A;  5KAI Z;  1L0N H;  2BE3 A;  2EBO A;  3F7Y C;  4LR3 A;  3RYH B;  2RDC A;  3HKB B;  5J9P C;  3QG5 A;  2F43 G;  5FPO A;  4HYO A;  3ZIA G;  1G6U A;  4OGQ B;  4PD4 F;  5KA6 A;  1F51 A;  3CRR A;  4QIW F;  4DR2 B;  4BAY A;  2YIB A;  4FVM A;  1H2L A;  2WLM A;  1V54 C;  4DV7 B;  3BEH A;  3AG7 A;  1ZWI C;  4UXN A;  1EN6 A;  3OGC C;  4JPR A;  1QBZ A;  1NZ6 A;  4U3J A;  4X1Y A;  2VQE O;  2W0F C;  3ETD A;  3KZI Z;  1RSO B;  2P90 A;  4JI4 B;  5GON B;  4UCT A;  4LF7 O;  1PV0 A;  3BAB A;  1G4Y B;  4DYL A;  4LH6 A;  3W7W A;  3O65 A;  3ZRS A;  5KMG B;  4RQF A;  3P3N A;  3UT5 A;  4UCO A;  2CTR A;  4JI6 O;  4JI3 B;  4LF4 O;  1Y76 B;  4U7N A;  1KKC A;  1YIT V;  1F23 A;  4CC5 A;  4GLX A;  4OX9 B;  2UXD O;  4ICG A;  2GHY A;  2FYU H;  4LF6 B;  3CC4 V;  3UCS C;  3T1H B;  2WLN A;  5EYP A;  2ATK C;  5BXZ A;  3VQV A;  2JDI G;  3D8C A;  4JV5 O;  2LGQ A;  4LFB B;  2X6A A;  3EVK A;  1XEQ A;  3B2E E;  3WFV A;  1VQ8 V;  4LFA B;  1R6N A;  2FTK A;  3FB8 C;  4NTX A;  4LF5 B;  3QVN A;  2CE4 A;  1I5X A;  1KD1 W;  3OUF A;  2CH7 B;  3C3S A;  4JI7 B;  5IJ9 A;  5IYC O;  3AG3 C;  3K9S A;  3I55 V;  4GX2 A;  3H1L H;  1YJN V;  2YI9 A;  3SJC C;  4MVZ A;  3JD0 A;  1S5L Z;  3K06 A;  1H5W A;  1MA1 A;  4DR6 O;  2ARH A;  3EXA A;  3N27 A;  5LGU A;  4UB8 Z;  4DO2 A;  5IE9 A;  4FLV A;  5TIS Z;  4X64 B;  2UXB O;  4AQY B;  4NKG B;  4DW0 A;  2JS5 A;  2LJ2 A;  2Y0P A;  2ADP A;  4PHZ A;  1OCR C;  4MSW C;  3ZMZ A;  3CRQ A;  3ZCC A;  4FLY A;  4JAV A;  2X0L A;  4Q20 A;  1MG1 A;  3FYI B;  1N34 O;  4EFB A;  1EM1 A;  1FJG B;  3K04 A;  3HPL C;  5B1N A;  2Z5U A;  4CS4 A;  2DN9 A;  5LL6 Y;  2YS8 A;  4GX0 A;  3CJH A;  5KHG A;  4K8X A;  3JAK A;  5IYB O;  5LOV B;  1JJO A;  4B3S B;  3K3W A;  2WPD G;  2PZS A;  1LUV A;  3ASN B;  5JJN B;  3CX5 F;  1SKV A;  3CC7 V;  1DF4 A;  2WSS G;  2CGN A;  2R9R B;  4LC1 A;  4FLZ A;  1IBM B;  2M7W A;  4MTG A;  3CRA A;  4O4H A;  1OCO B;  4LP8 A;  4CH4 A;  4X66 B;  1D2D A;  3RGB A;  3TCU A;  4RAI A;  2D2C B; 
#chains in the Genus database with same CATH homology
 1SZX A;  3TJT A;  1PM9 A;  4BR6 A;  3QVN A;  1MNG A;  2CE4 A;  3LSU A;  1BT8 A;  1B06 A;  1XDC A;  3CEI A;  3OT7 A;  1EN4 A;  3C3S A;  1AR5 A;  3MDS A;  2P4K A;  3AK2 A;  2QKC A;  1ZTE A;  1AR4 A;  1GN6 A;  1GN3 A;  1P7G A;  1N0J A;  3K9S A;  1N0N A;  1AVM A;  1MSD A;  1MA1 A;  5AG2 A;  1JA8 A;  1IX9 A;  1VAR A;  4JZ2 A;  4YIP A;  4X9Q A;  3BFR A;  2RCV A;  3AK3 A;  1AP5 A;  1Y67 A;  1AP6 A;  2GDS A;  4FFK A;  2ADP A;  1EN6 A;  3DC5 A;  1I08 A;  1D5N A;  1ZLZ A;  2ADQ B;  1I0H A;  1XIL A;  1WB7 A;  4E4E A;  2QKA A;  1GN4 A;  1EM1 A;  4YIO A;  3RN4 A;  1IXB A;  1GN2 A;  1XUQ A;  1PL4 A;  3IC9 A;  1IDS A;  1XRE A;  2AW9 A;  3KKY A;  4JZG A;  3DC6 A;  3C3T A;  1ZSP A;  1KKC A;  4F6E A;  1VEW A;  4GUN A;  2CDY A;  1JR9 A;  1WB8 A;  1LUV A;  1BSM A;  1BS3 A;  5A9G A;  3KDR A;  1MMM A;  3AK1 A;  4C7U A;  4JYY A;  1LUW A;  1ZUQ A;  3EVK A;  1QNM A;  1EN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...