1MMMA

Distinct metal environment in iron-substituted manganese superoxide dismutase provides a structural basis of metal specificity
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IRON-SUBSTITUTED MANGANESE SUPEROXIDE DISMUTASE)
publication title Distinct Metal Environment in Fe-Substituted Manganese Superoxide Dismutase Provides a Structural Basis of Metal Specificity
pubmed rcsb
molecule tags Oxidoreductase
total genus 76
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1mmmA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1mmmA02
4E4EA 2CE4A 3BFRA 4X9QA 1N0JA 3AK2A 1EN4A 1WB8A 1LUVA 1AP6A 1EN5A 4GUNA 1AR5A 2CDYA 1KKCA 1LUWA 1EM1A 1Y67A 1P7GA 1ZUQA 2ADPA 5A9GA 2P4KA 3LSUA 1MNGA 3K9SA 3DC6A 1XREA 4C7UA 1WB7A 1GN4A 4JYYA 1VARA 1ZTEA 4JZGA 4F6EA 3AK3A 1EN6A 1BT8A 1PM9A 2GDSA 2AW9A 1PL4A 4YIOA 1I0HA 1I08A 3TJTA 1XDCA 1JR9A 3EVKA 1AR4A 2RCVA 1MA1A 1D5NA 1IXBA 3CEIA 4BR6A 1AP5A 1AVMA 3KKYA 5AG2A 1B06A 1JA8A 1MSDA 1ZLZA 3OT7A 1N0NA 2QKAA 3IC9A 1IX9A 3QVNA 2ADQB 3C3TA 3C3SA 1ZSPA 1IDSA 1GN6A 1BSMA 3AK1A 3RN4A 1GN3A 3DC5A 3MDSA 1GN2A 1BS3A 1MMMA 4YIPA 2QKCA 4FFKA 1SZXA 1VEWA 1QNMA 4JZ2A 1XUQA 1XILA
chains in the Genus database with same CATH superfamily
2DWEC 3OEHG 4JI1O 2UXCB 2DYSC 2L6LA 4LF6B 3IC7A 1IBLO 1Z2GA 2EZOA 3ICXA 3QF7A 3CRMA 2EBOA 3T1HB 4I9WA 3KCYA 3HKEB 1B3QA 1GKFA 2KG7A 1AB3A 3NXSA 1Z5WA 4PA7A 1XREA 4EFBA 1Y74A 5GTIZ 4NKGB 1XI1A 5EIBD 4FLTA 1FFTB 1FKAO 1SC5B 3EHBB 3AG2B 2ZXWB 5E1AC 2Q73A 2EZPA 3ZIAG 3LSQA 4X65B 2M6YA 1YTFB 4X64B 4UB8Z 3H9VA 1R6TA 4Z1VA 1WLEA 2FMLA 2HHHB 1GM7A 2FB5A 3SR2C 3W7TA 1I5XA 2Q0OC 4LF9O 3RYFA 5EC1C 1KBHA 4WFAV 1NTKH 3TGUH 4GZRB 1N0NA 4DW1A 1D2DA 4X66O 5L3FA 3KCXA 4O2BB 3MDSA 5IJ0B 1SQBH 1TVKB 1F23A 3ABLB 4TV8B 1F7YA 3JCZA 1RM1C 1RPRA 2QKCA 5J2UA 4FLUA 4R8CA 1QHTA 4ICGA 1HR0B 2UU9B 3VQWA 1PNKA 2UXNA 4L87A 4RUFA 1KP2A 1Y76A 1FXVA 1YSCA 3SPGA 2QEXV 3ETQA 1FJGB 1TAEA 1OCZB 3H1JH 1Q82W 1WB8A 4UVBA 1HNZB 1Q86W 4DO2A 3WB2A 4FPPA 2GUZB 2LQTA 2Q8VA 3D3IA 1ZUQA 2AHZA 3E8HA 2W6IG 2IU3A 1CXZB 2P4KA 1YHQV 4MVUA 4AQYO 1B04A 1SETA 5JQGB 4YXWG 4H13B 3DC6A 4G2KA 4HYOA 5JCOA 2LFRA 2X6AA 1M57B 3AG1C 1Y66A 5GONA 4QPKA 5C8YB 5LXTB 4IHJB 5LA6A 4ZI7B 2QR4A 3A0RA 3H1LH 2DYSB 1NQTA 4RQFA 3D36C 2QKSA 3K79A 1XNQO 2N74A 4RO2A 2AZ0A 5DEDA 2XHBA 2QM4A 2AW9A 3JATA 1GO3F 3I56V 1PNLA 1AR4A 4Q6GA 3R65A 1JPXA 4KUMA 4DUYB 2GHYA 2IH1C 2YXHA 5IE9A 5CA1B 4G28B 5FLXN 2WLIB 5LOVB 3CP1A 4JI0O 2A7WA 4LF4B 4FM0A 1MMMA 4BW9A 4YIPA 2UXXA 2UUBO 3SJCC 4R6ZA 3N27A 1N32B 1YITV 5D5PA 5DECA 4UUJC 1VQ4V 1RPOA 1SQVH 5LYJB 1TUBA 3JD1A 4O2AB 3ABMC 1DGSA 1CP9A 4B7EA 3ETGA 3UT5A 3E86A 4JZ2A 2ILMA 1WAZA 5KX5B 2XAQA 1YXBA 2YXYA 3QO7A 2HG5C 1NTZH 4MVQA 4LF5B 4ABMA 2HVJC 1HNXO 2OT5A 1LUVA 3CXCU 3VBBA 2JIZG 3N2GA 4WF9V 1VQ5V 4DR6O 1ZAUA 3ZN0A 2HJFC 2AHYA 2FL4A 3ETDA 3X2QB 1KC8W 5KUMA 4UXNA 4X1IA 1XNRO 1ORQC 3E35A 4GT1A 2ZM6B 5K1PA 2P5OA 1ZX3A 2ITCC 2LGWA 1X59A 4I0XB 2JJ1G 2LW1A 2HLDG 4UCSA 1QVFU 1SRYA 1BT8A 4X20A 1TUEB 4NXMO 3OR7C 2P4VA 3CJHA 3DSQA 3RT3C 4LF9B 1VMGA 3APOA 1OCOC 5IY5C 3PJSK 1S77D 4MT8A 2LW7A 3GVMA 2WLNA 4X66B 1X4TA 3G6EV 5KMGA 1MOFA 3L72H 3ZHQA 4JYBA 1M56C 2QDOA 5H2FZ 1US6A 3AG1B 4PA9A 1IX9A 1JMKC 1WNSA 2P06A 4IIJA 3B8NA 5CA0A 2HR3A 2N04A 1GN3A 3P30A 3SYPA 3HKCB 2KG7B 1SQPH 1AR1B 4ZBMA 1Q90D 2OTLV 1Y74B 2BOBC 4JI2O 3JCUZ 4NXNO 4WFFA 2RMKB 4KL1A 3O9OA 2YS8A 5LHIA 3VQXA 3TCUA 4X8AA 4J10A 2R9IA 3D8CA 1KYOF 2JEXA 4I5SA 4X9QA 4X1KA 3ZBHA 3RVZA 4PA6A 2PYLA 4YJ3A 2Y0IA 1WJZA 5L3GA 3OM3B 4GUNA 1YI2V 4AQYB 2ZCEA 3RYFB 3ABUA 1QQCA 1XOUA 1JFFB 4I55A 3WU2Z 1Y67A 4Q20A 1Q6UA 2ZKOA 3BA8A 3K08A 4FJCC 2UXDO 3ABMB 5IYCO 3WG7C 1AI5A 4JAUA 3OGCC 4QE9A 3SJBC 4DV0O 3E8GA 4EEQA 1BHBA 3E89A 2VQFO 4U3FH 2WA4A 3ZRWA 2EJ7A 5KAFZ 4Z1MG 3A0BZ 3G80A 1R73A 1JQ0A 2JK5C 3T1HO 2OCHA 3CC2V 2DJVA 4DW0A 2Q67A 4UCTA 1P84F 4P9PA 2EINC 1EFRG 1P4RA 4CC6A 2ODMA 1F4NA 3OE7G 2ARHA 3SGIA 4X88A 3ZS8C 1IBMB 1HNWO 5IYDO 1T5EA 2BE3A 4H0LB 1GN2A 3MHSC 4MW8A 1W59A 1AJQA 4RUEA 4X65O 1OCOB 5IY5B 3F5TA 2ZQMA 3FB7C 1SZTA 3OTFA 3JD4A 3CRRA 5LA6B 2HHHO 1Q7YW 4O4IA 4NB5A 1N36O 1M56B 4N21A 1HNXB 3K06A 1ZL8B 4GYCB 1DLBA 1URFA 4DR6B 2JEUA 2WLJA 1SS3A 2QE7G 3JATB 1RSOB 2NNUA 3SPCA 4XDJA 2QWQB 2VRZA 3JD3A 1XNRB 3CRAA 3ZMVA 1KD1W 4EB6A 3T4DA 4R7CA 2X6CA 3G71V 2F66C 4JYCA 2E75B 2X6BA 3ZHTA 3CS5A 4DV1B 1VARA 3ASNC 2VWJA 1K7DA 4KXRA 1M93A 2QWRB 5BR8O 4H33A 4J7ZA 1QLNA 3LDDA 4UCRA 1TUBB 2CTWA 1EZJA 1KQSU 3JD2A 3UT5B 5ITZA 1NKDA 1K92A 3CRQA 2Y69C 4JTDB 2V7QG 4OGQB 4BAYA 1YTFD 2GBOA 1K5SA 4OPHA 3WG7B 4FK5C 4U7OA 3E2EA 5C93A 4DR2B 1ZLZA 3AG3C 2RDCA 4HAMA 2JDIG 1ROPA 2A0LA 3QVNA 2RJZA 1ZSPA 2WAMA 3CCVV 1GN6A 3LNMB 4JI2B 3STLC 4X1IB 4F6RA 4NXNB 4LNUB 4DR7B 3SYOA 1WA8B 2BTQA 4NTYA 4O4LA 3J81N 4DV5O 1Y6XA 3OD4A 1R3IC 1VQ6V 2DQ3A 4B7KA 4P30A 4W4LA 1VEWA 4OPAA 1PV0A 4FM2A 5LGNA 2Q69A 2RN9A 1XILA 3FKSG 1Q6HA 2EINB 3K0GA 4DK1A 3JALA 3IFXA 1KKDA 2B1IA 1HWYA 1EN4A 2BOCC 1PKXA 4O4JB 3N2KB 2UXDB 4H37A 3QO8A 5JWPA 3B2EE 2CDYA 3C90A 1S72V 2EIMC 5B1BC 4LF4O 4TSFG 2UUAO 1B6QA 5A9GA 4DV0B 1Q43A 4LFBO 1N32O 1BHAA 2X7RB 3JSNA 1AJPA 2Z5UA 2WA3A 3F7YC 4IIJB 3CCUV 1W0JG 4BIZA 5CA0B 3ZN1A 2ZR2A 1V9PA 2CH7A 2DWDC 5L3BA 2QWOB 4J9ZB 1IURA 2D3OW 3K5MA 4FLVA 2IJKA 4LF5O 2GDSA 3BEHA 2ZNJA 2PY5A 3W7UA 4UCUA 5B5EZ 1I08A 5EZYA 5LBQA 3ZMTA 4X1KB 2X0LA 2R70A 4YJ3B 1HNWB 3OT7A 1N4CA 4UCVA 2PTMA 3K3WA 2BSKA 2ZM6O 3L9DA 4F4LA 3ASNB 2M7WA 4JYAO 4I55B 2FTKA 4B3MO 1NT2B 3RN4A 4PV1B 4IYHA 5TISZ 4MVRA 4I4TA 3S3WA 1QCEA 1N36B 4RQEA 2Y69B 3OGIB 1VQ8V 3UM7A 1F51A 1QR8A 1JVMA 4U3JA 3ZRWB 3APQA 4TV9A 2FKXA 4JI5O 2Q68A 1K4CC 1XUQA 3AG3B 2F95B 3ASOC 5KHHA 3OMAB 4DV6O 3AG4C 2VQEO 5H5NA 3QNEA 1H2NA 3LDCA 3BABA 3B4SA 4JF3A 4JI3B 3X2QC 1LUWA 5EC2C 4K35A 5L3DA 1UPGA 3T4ZA 4X89A 1Q81W 4X62O 4PI2A 2JGDA 1U97A 1XEQA 2JJ2G 2YUAA 1GMGA 5EBLC 3TXSA 5BR8B 1H2SB 3CCJV 1E1RG 1K4DC 1KB9F 1J95A 4GCZA 2W0XA 4EKWA 1L0LH 3ZMZA 4PDMA 2VWKA 4WFBV 2EIMB 5B1BB 4WBNA 3FAVA 5JJEB 2XASA 3TJTA 5LGUA 1S5HC 2BCCH 3OAAG 3BPZA 2AXTZ 1K9MW 1CEZA 4TUYA 1YDXA 5LL6Y 1H38A 1YJ9V 4KP4A 3KKYA 5GW7A 5FNVA 4L8JA 2XAFA 3TETA 1VF5B 1GK9A 2PF4E 2YICA 1MSWD 1VF6A 3SJQC 4DV5B 1THZA 1YF2A 3JARA 1BSMA 4HBNA 4EB6B 2P6JA 4PD4F 1W2BU 5H9CA 5IJ9B 1FXKA 4QGPA 4JV5O 1L1FA 4QIWF 1FYJA 2ZDIA 1JNBA 2F43G 4A5UB 3B40A 4QNHB 1FD9A 1N33O 2CUGA 5KHIA 2R9RB 1SKVA 4XBFA 1SA0A 3FD9A 3OUFA 1N0JA 3ZMUA 5ITZB 4PHZA 2WSSG 2UUAB 1K73W 3VQYA 3B77A 1LR1A 3KG2A 4LFBB 1IBMO 3QO5A 1RP3B 1P49A 3OTOO 2PYJA 1WPXA 4MTOA 2B5UA 1GH6A 4B3TB 3HKDA 2YEVA 3DXRA 2WLLA 4KHPO 3STZC 2A9HA 2CTPA 2EJRA 3IAYA 4K0KB 2QGNA 4ZHQA 1SESA 1D5AA 4F6RB 3ASOB 4NTXA 1S76D 2YIDA 3JAWB 3CCLV 3AG4B 2BTQB 4CC5A 4TOIA 1S0VA 1PL0A 4MTGA 3HKBA 4O4HA 1YJWV 3LNNA 1QVGU 4U7NA 1GRJA 3RYIB 2EX3A 4MVMA 1QU7A 4J41A 5BXZA 3JALB 1N8RW 2Y4UA 2DN9A 4JYAB 5AG2A 3BAAA 4B3MB 1K3EA 1E79G 4FVMA 2F23A 4W4KA 4K8ZA 3LDEA 1YEWA 2QKAA 2K1EA 2LJ2A 4XDKA 2ZE6A 4FFBB 2IW5A 4DV1O 5KAIZ 2ADQB 3CMEV 3AK1A 2E5LB 2KSDA 2YIBD 5CB4A 5JCOC 1VQ7V 3A8TA 3M7MX 1NZ6A 2QA4V 4JI5B 2UXBO 1VIBA 3E83A 4PI0A 4JAAA 4LBEC 4TWKA 5BZBA 1VF6C 1SZXA 2EIKC 4DV6B 2VQEB 4UVAA 1AROP 3RYCA 3A2FA 4WCEV 2CE4A 3G67A 3CE2A 1U96A 4DR2O 2DW4A 1FXKC 2YI8A 5H6RA 4X62B 5JVDA 2B1GA 2HVKC 5EZYB 2ZE7A 1EN5A 2GV9A 2ZDIC 2IBZH 4NVPA 3W7WA 3E22A 5A2QN 2OIGA 4DR7O 4LF7O 5BMVA 3D3QA 3RBZA 2BSKB 4MVSA 3E8FA 2CTRA 1XMOO 5LHGA 2ZIMA 1IXMA 5LP6A 1R3LC 3SPJA 2A3QA 1J5EB 1GN4A 4I4TB 5IYZA 3HKEA 1BQ0A 5IWAB 3P32A 3M8AA 1M1KW 3ZHRA 4RWUA 4PDVA 4U3JB 4TV9B 2Q7HA 1JX9A 4DRXA 4LH7A 2O57A 1G1XB 1K5QA 1H5WA 2L35A 1AI4A 4FLZA 3CEIA 1R1BA 2DYRC 3ABKC 3K58A 1JA8A 4AILC 5J2UB 2IJJA 2YC0A 1L0NH 1BE3H 4MSWC 4BW5A 3T1YO 1NS1A 1W0KG 3CRCA 4JV5B 2JGDB 2B9ZA 1Y76B 2YDEA 1N34O 2XUMA 2ZR3A 2RNBA 1N33B 2YSUB 1M9NA 5DN6G 2AZ2A 4FLYA 1ZWIC 5CMUA 1NR1A 5LGTA 5IJ0A 3J80N 1TVKA 3BFRA 1QBZA 2WLKA 3OTOB 3FAVB 2XAGA 5FPOA 4UCOA 5L3EA 1K33A 1H8EG 4TUYB 4OXSA 5GONB 1DK1A 4KHPB 1KKCA 4YY3B 3GWOA 2N05A 5KHJA 4B3SB 3O65A 3R66A 3Q4HA 2EIKB 1SQFA 2DQ0A 1MNGA 2ZIOA 2P90A 1I94O 5B1OA 1L8DA 4DV2B 1NH2B 3JARB 2QM7A 1OCRC 3PN1A 2XTAA 2GUZA 1KU9A 2ZNIA 3ZEDA 1WPBA 1Q8IA 4HNAA 1FXKB 4DR4O 3QG5A 1K97A 4DR3O 3SYAA 2PZSA 1KUQA 2EILC 4ZIBA 2JRIA 1I0HA 3CPWU 4JI3O 5LP6C 1TA8A 5C8YA 5LXTA 4IHJA 1DF4A 3FYEB 1AP5A 3ZMSA 1JOYA 4NYKA 5KUKA 2OYQA 3OUSA 1SQQH 4P2ZA 5DM6V 1YVWA 5LMUB 2UXBB 1H2GA 5B66Z 4RAIA 1K34A 1Q5OA 3AEIA 2CK3G 3HKDB 2YEVB 3DXRB 1SQXH 2WLLB 4GKJB 1WP7A 1QLEC 3FX7A 2LO1A 3DGEA 2V1DA 1NVPB 2KB1A 2JGUA 1M5IA 4J7JA 4ZHQB 1Q3EA 4FZ1A 3T1CA 3AG7A 3ZRXA 2DYRB 3ABKB 3N2GB 1G4YB 4CZZA 2EIJC 1PPJH 4IT5A 3HKBB 1XMQB 4O4HB 4UB6Z 1EZVH 4WFGA 2QTSA 4LF7B 3A0HZ 2P67A 5EYPA 3HB3B 3BCCH 1XMOB 1WN7A 2A06H 5EK0A 1FFXA 1OV9A 5IT9N 2WWWA 3OMNB 2Q7GA 4ZOLA 5CBGA 4HZ3A 4X20B 3UKMA 1O9HA 3ZRVA 3CCRV 5LMNB 3CJHB 4DR1B 4R50A 4UFZA 4LFCO 4JPRA 4YJ2A 2HEPA 3JAMN 4D7SA 1BGYH 2F4VB 3U11A 5CB4B 3CCEV 4PJ0Z 1CPYA 4GX0A 4YHHO 1R6KA 3W7SA 1OZ0A 5FPRA 5KMGB 5B3SC 4XDLA 5E79Z 3RW0A 5KHGA 2CAZC 1JCHA 3CB2A 4YIOA 2DOSA 4OX9O 2AGAA 1XDCA 5L3CA 2OTJV 4BIOA 4FMTA 4PDLA 2R9AA 3W7XA 3CXHF 2IM9A 2V4DA 4B3TO 2KKWA 1IVSA 3T1YB 3QTCA 2QJ1A 5JVDB 2GTSA 1OCRB 4ASUG 4K0KO 1N34B 4JTCB 1O9GA 4JI6O 1FPOA 3C3SA 5BMVB 4B08A 3CX5F 2OWOA 3HPLC 3CCSV 4JI7B 2EILB 5IYBO 1NU1H 4BWAA 5LP6B 1Z5VA 5EIBC 5IYZB 3CHXA 3D36A 2ZINA 2UUCO 3HKCA 4DR5O 2DE0X 1NI8A 4E4EA 1SF9A 3I5DA 4DRXB 5IDJA 1GTOA 4PELA 4NR1A 4CH3A 4GKKB 2Q9LA 3VOUA 3BHPA 4TT3G 3CC4V 3B8MA 1QLEB 2E5LO 2LP7A 3WFVA 1I94B 5K1XA 1K8AW 4DV3O 1Q6IA 4LFAO 2NN4A 4DV4B 2BTOA 1AI6A 4DR4B 2EIJB 2NR5A 3VQVA 1H2LA 1Y4MA 4DR3B 4IYIA 3K0DA 4JZGA 1JFFA 5J2TA 3ZRSA 4GLXA 3G4SV 2W6JG 1EN6A 3KDRA 2Z0AA 3EFFK 1M90W 1JJ2U 4MW3A 2JS5A 4CH4A 4DV7O 2RCVA 2PGGA 1IXBA 1HW7A 4BR6A 2E76B 3UO3A 3WB1A 1M4UA 2F1MA 1ENVA 2HFEC 5H6QA 3U0ZA 4PA3A 1YCIA 3BRCA 4JGSA 1J5EO 3F7VC 5KA5A 4O4IB 5B3SB 3Q4HB 4Z2WA 5IWAO 3ZHSA 4JI8O 1I7FA 5CN0A 1IBKO 4LWSA 2XAHA 1XQ8A 1FAFA 5KHKA 2YIBA 3RYHA 2P7TC 3IGAC 1R6NA 2LGQA 2QWNB 1V55C 4HNAB 3E8BA 1HDJA 3KZIZ 3JASA 3HR0A 3ZHUA 3MHHC 5B1AC 1SERA 4J42A 1XL6A 1FS0G 1OCCC 1VP7A 2ZE8A 3MAQA 5JJNB 2Q0AA 1AJNA 2E3CA 1VQMV 1PP9H 1ZL8A 1S5LZ 4LFCB 1VQOV 1P7GA 3OW2U 1E1QG 1BQZA 1MZFA 3L75H 3LSUA 4LCUC 3K9SA 1RSOA 4YHHB 3FB5C 1WB7A 3K03A 4JYYA 1ZTEA 3B09A 2Q5ZA 5JH7A 3JAKA 4GX5A 2IU0A 1UJWB 2XT9A 1IZ3A 1XHXA 4FZ0A 4OX9B 4MVZA 4DUZB 3S3XA 3T2MA 1S3JA 2HP8A 1PL4A 1GM9A 3CCMV 1R3JC 1JR9A 4YY3O 3EVKA 3SYQA 4B3RB 1D5NA 4B3SO 2PI4A 2F93B 3SPHA 5EBWC 3ZX6A 3P3NA 4JI6B 2W0FC 4LC1A 4O4LB 2GSMB 2WLHA 4JI1B 4DV2O 3RWRD 3TK1A 1IBLB 4X1YA 5EYPB 2WPDG 5D5QA 2Y48A 3C3TA 4J80A 2OCCC 3ZJZA 1FFXB 1H8HG 3G6BA 4WFEA 3WB0A 4ZOLB 3RGBA 2XAJA 1XHZA 5J9PC 2H8PC 4KFMA 3I55V 2UUCB 4K3AA 2ZE5A 4YJ2B 3BA9A 4DR5B 1YIJV 2A79B 4LF8O 1P7BA 4FFKA 1RM1B 1VQKV 1PNMA 2C2AA 5LHHA 4LNUA 2HKOA 1NJIW 1G8MA 4JTAB 4PA4A 1VQPV 1WA8A 4I7ZB 4MTXA 3JSLA 2EULA 4J7KA 2JVDA 5LMUO 3AK2A 4I50A 3M99B 4DV3B 4LFAB 4CH5A 4K8XA 1NR7A 1EM1A 2CH7B 4GKJO 2YXLA 3J7AU 1YJNV 2ADPA 4CS2A 2H94A 5BY1A 3DTUB 1V55B 3OMIB 2IJHA 1WP8A 4FLXA 4O4JA 3N2KA 4LH6A 2WLMA 3ZCCA 4C7UA 4TQFA 4FIPC 2OIEA 5B1AB 2QTOA 5HFLA 4I9QA 2YIAA 3L71H 1XMQO 1OCCB 1COWG 4H44B 1NH2D 5JJJB 4DV7B 5FL7G 4GX2A 5CBFA 3FB8C 4D7TA 1BZKA 2PI5A 5EBMC 1GM8A 3TXQA 1UFIA 1FOUA 3UO2A 2D2CB 3CMAV 3ML0A 1YZBA 3K04A 3SJAC 1NBMG 1MZEA 5LMNO 4DR1O 2Y4TA 4JI8B 3ZHVA 4AHCA 1V54C 2HJDA 2F4VO 3K5LA 1IBKB 2GTAA 4E2LA 3ETEA 1KP3A 3BY6A 5HFMA 3H01A 4J11A 4IL6Z 3CCQV 1BS3A 2CGOA 3RFRA 2P22C 2ZD9A 3IJ4A 1GAXA 4WFHA 1VQ9V 4DXWA 5J2TB 3EXAA 4JASA 3OEEG 4PDRA 1NVPD 1QNMA 2ZT9B 1DF5A 3P3PA 3L74H 4JI4O 3OR6C 3OFNG 3CYOA 4D6TH 3NR7A 5KA6A 2OCCB 1XNQB 3BVOA 1AP6A 1XL4A 4CS3A 2FYUH 3CWBH 1JJOA 1BMFG 1NTMH 2ATKC 2UXCO 5CA3A 4LF6O 4JI7O 4TQDA 4O2BA 4TV8A 2G38A 2K9PA 2Q7EA 4WBNB 1HP8A 2ITDC 4MTFA 5F2VO 2CGNA 2JS3A 3LSSA 1RFYA 4LWSB 2H3OA 4JAVA 4F6EA 3AK3A 2LFSA 4JI0B 5FNVB 3RYHB 3LUTB 4ZKIA 4BIUA 3L73H 2UUBB 4GKKO 1S5JA 2RQ6A 3JASB 1VQNV 2PUSA 3K9AA 4CBCA 4CH6A 4FLWA 4X64O 1XBLA 3K5OA 4DV4O 2NLJC 2MW2B 2Z3YA 1MSDA 4J9YB 2R72A 3IC9A 1QR9A 1AI7A 3F5WC 4EFEA 3JD0A 2QWPB 5JQGA 1FXHA 1IDSA 3UCSC 4QE7A 4LF8B 3MD0A 2CTQA 4ZI7A 2YI9A 2ETNA 3CSXA 1KECA 1SA0B 2MK3A 3L70H 1EBOA 4UVCA 1KMIZ 1AILA 5JH7B 3JAKB 1VF7A 3CC7V 3SPIA 2KQXA 1HR0O 2UU9O 1V54B 5IJ9A 4FM1A 3AG2C 4G27B 2ZXWC 2QM8A 4CS4A 4NXMB 3H1HH 3GWKC 4MVOA 2IJIA 2Q6AA 4UV8A 5CA1A 3FFQA 1AR5A 1PD3A 1OHHG 4P9OA 4NTWA 1FJGO 3CD6V 3FYIB 2WLIA 2QSAA 2VS0A 5LOVA 3GB7C 1HNZO 1IJGA 1I5YA 4LP8A 4X1YB 3H1IH 3JYCA 4MS2A 4QJFB 2E74B 2XNDG 3SDLA 4DYLA 5LYJA 1R3KC 4O2AA 3U10A 2IH3C 1MABG 1SQGA 2Y0PA 1PM9A 5KX5A 4GX1A 3ABLC 1DTOA 3FB6C 1BL8A 3SYCA 5KLVH 3JAWA 5B1NA 1MA1A 1AVMA 4UV9A 4I50B 1B06A 5GTHZ 3K59A 1OJHA 3K5NA 2XOKG 3UQ8A 1H2MA 4LR3A 3RYIA 2Q4PA 1F4MA 3H1KH 1OCZC 3RVYA 1G6UA 1A32A 4DUYO 2DMXA 3K57A 1VQLV 3DC5A 3RYCB 4DUZO 4I0XA 1BCCH 3ABTA 4AI8A 4DK0A 5CBHA 3THOA 1H2KA 1TGOA 1LNQA 4QPJA 4FFBA 4JI4B 1MG1A 4B3RO 4IGGA 3E22B 2VQFB 1M57C 4N23A
chains in the Genus database with same CATH topology
4E4EA 2CE4A 3BFRA 4X9QA 1N0JA 3AK2A 1EN4A 1WB8A 1LUVA 1AP6A 1EN5A 4GUNA 1AR5A 2CDYA 1KKCA 1LUWA 1EM1A 1Y67A 1P7GA 1ZUQA 2ADPA 5A9GA 2P4KA 3LSUA 1MNGA 3K9SA 3DC6A 1XREA 4C7UA 1WB7A 1GN4A 4JYYA 1VARA 1ZTEA 4JZGA 4F6EA 3AK3A 1EN6A 1BT8A 1PM9A 3KDRA 2GDSA 2AW9A 1PL4A 4YIOA 1I0HA 1I08A 3TJTA 1XDCA 1JR9A 3EVKA 1AR4A 2RCVA 1MA1A 1D5NA 1IXBA 3CEIA 4BR6A 1AP5A 1AVMA 3KKYA 5AG2A 1B06A 1JA8A 1MSDA 1ZLZA 3OT7A 1N0NA 2QKAA 3IC9A 1IX9A 3QVNA 2ADQB 3C3TA 3C3SA 1ZSPA 1IDSA 1GN6A 1BSMA 3AK1A 3RN4A 1GN3A 3DC5A 3MDSA 1GN2A 1BS3A 1MMMA 4YIPA 2QKCA 4FFKA 1SZXA 1VEWA 1QNMA 4JZ2A 1XUQA 1XILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E4E A;  2CE4 A;  3BFR A;  4X9Q A;  1N0J A;  3AK2 A;  1EN4 A;  1WB8 A;  1LUV A;  1AP6 A;  1EN5 A;  4GUN A;  1AR5 A;  2CDY A;  1KKC A;  1LUW A;  1EM1 A;  1Y67 A;  1P7G A;  1ZUQ A;  2ADP A;  5A9G A;  2P4K A;  3LSU A;  1MNG A;  3K9S A;  3DC6 A;  1XRE A;  4C7U A;  1WB7 A;  1GN4 A;  4JYY A;  1VAR A;  1ZTE A;  4JZG A;  4F6E A;  3AK3 A;  1EN6 A;  1BT8 A;  1PM9 A;  2GDS A;  2AW9 A;  1PL4 A;  4YIO A;  1I0H A;  1I08 A;  3TJT A;  1XDC A;  1JR9 A;  3EVK A;  1AR4 A;  2RCV A;  1MA1 A;  1D5N A;  1IXB A;  3CEI A;  4BR6 A;  1AP5 A;  1AVM A;  3KKY A;  5AG2 A;  1B06 A;  1JA8 A;  1MSD A;  1ZLZ A;  3OT7 A;  1N0N A;  2QKA A;  3IC9 A;  1IX9 A;  3QVN A;  2ADQ B;  3C3T A;  3C3S A;  1ZSP A;  1IDS A;  1GN6 A;  1BSM A;  3AK1 A;  3RN4 A;  1GN3 A;  3DC5 A;  3MDS A;  1GN2 A;  1BS3 A;  1MMM A;  4YIP A;  2QKC A;  4FFK A;  1SZX A;  1VEW A;  1QNM A;  4JZ2 A;  1XUQ A;  1XIL A; 
#chains in the Genus database with same CATH topology
 2DWE C;  3OEH G;  4JI1 O;  2UXC B;  2DYS C;  2L6L A;  4LF6 B;  3IC7 A;  1IBL O;  1Z2G A;  2EZO A;  3ICX A;  3QF7 A;  3CRM A;  2EBO A;  3T1H B;  4I9W A;  3KCY A;  3HKE B;  1B3Q A;  1GKF A;  2KG7 A;  1AB3 A;  3NXS A;  1Z5W A;  4PA7 A;  1XRE A;  4EFB A;  1Y74 A;  5GTI Z;  4NKG B;  1XI1 A;  5EIB D;  4FLT A;  1FFT B;  1FKA O;  1SC5 B;  3EHB B;  3AG2 B;  2ZXW B;  5E1A C;  2Q73 A;  2EZP A;  3ZIA G;  3LSQ A;  4X65 B;  2M6Y A;  1YTF B;  4X64 B;  4UB8 Z;  3H9V A;  1R6T A;  4Z1V A;  1WLE A;  2FML A;  2HHH B;  1GM7 A;  2FB5 A;  3SR2 C;  3W7T A;  1I5X A;  2Q0O C;  4LF9 O;  3RYF A;  5EC1 C;  1KBH A;  4WFA V;  1NTK H;  3TGU H;  4GZR B;  1N0N A;  4DW1 A;  1D2D A;  4X66 O;  5L3F A;  3KCX A;  4O2B B;  3MDS A;  5IJ0 B;  1SQB H;  1TVK B;  1F23 A;  3ABL B;  4TV8 B;  1F7Y A;  3JCZ A;  1RM1 C;  1RPR A;  2QKC A;  5J2U A;  4FLU A;  4R8C A;  1QHT A;  4ICG A;  1HR0 B;  2UU9 B;  3VQW A;  1PNK A;  2UXN A;  4L87 A;  4RUF A;  1KP2 A;  1Y76 A;  1FXV A;  1YSC A;  3SPG A;  2QEX V;  3ETQ A;  1FJG B;  1TAE A;  1OCZ B;  3H1J H;  1Q82 W;  1WB8 A;  4UVB A;  1HNZ B;  1Q86 W;  4DO2 A;  3WB2 A;  4FPP A;  2GUZ B;  2LQT A;  2Q8V A;  3D3I A;  1ZUQ A;  2AHZ A;  3E8H A;  2W6I G;  2IU3 A;  1CXZ B;  2P4K A;  1YHQ V;  4MVU A;  4AQY O;  1B04 A;  1SET A;  5JQG B;  4YXW G;  4H13 B;  3DC6 A;  4G2K A;  4HYO A;  5JCO A;  2LFR A;  2X6A A;  1M57 B;  3AG1 C;  1Y66 A;  5GON A;  4QPK A;  5C8Y B;  5LXT B;  4IHJ B;  5LA6 A;  4ZI7 B;  2QR4 A;  3A0R A;  3H1L H;  2DYS B;  1NQT A;  4RQF A;  3D36 C;  2QKS A;  3K79 A;  1XNQ O;  2N74 A;  4RO2 A;  2AZ0 A;  5DED A;  2XHB A;  2QM4 A;  2AW9 A;  3JAT A;  1GO3 F;  3I56 V;  1PNL A;  1AR4 A;  4Q6G A;  3R65 A;  1JPX A;  4KUM A;  4DUY B;  2GHY A;  2IH1 C;  2YXH A;  5IE9 A;  5CA1 B;  4G28 B;  5FLX N;  2WLI B;  5LOV B;  3CP1 A;  4JI0 O;  2A7W A;  4LF4 B;  4FM0 A;  1MMM A;  4BW9 A;  4YIP A;  2UXX A;  2UUB O;  3SJC C;  4R6Z A;  3N27 A;  1N32 B;  1YIT V;  5D5P A;  5DEC A;  4UUJ C;  1VQ4 V;  1RPO A;  1SQV H;  5LYJ B;  1TUB A;  3JD1 A;  4O2A B;  3ABM C;  1DGS A;  1CP9 A;  4B7E A;  3ETG A;  3UT5 A;  3E86 A;  4JZ2 A;  2ILM A;  1WAZ A;  5KX5 B;  2XAQ A;  1YXB A;  2YXY A;  3QO7 A;  2HG5 C;  1NTZ H;  4MVQ A;  4LF5 B;  4ABM A;  2HVJ C;  1HNX O;  2OT5 A;  1LUV A;  3CXC U;  3VBB A;  2JIZ G;  3N2G A;  4WF9 V;  1VQ5 V;  4DR6 O;  1ZAU A;  3ZN0 A;  2HJF C;  2AHY A;  2FL4 A;  3ETD A;  3X2Q B;  1KC8 W;  5KUM A;  4UXN A;  4X1I A;  1XNR O;  1ORQ C;  3E35 A;  4GT1 A;  2ZM6 B;  5K1P A;  2P5O A;  1ZX3 A;  2ITC C;  2LGW A;  1X59 A;  4I0X B;  2JJ1 G;  2LW1 A;  2HLD G;  4UCS A;  1QVF U;  1SRY A;  1BT8 A;  4X20 A;  1TUE B;  4NXM O;  3OR7 C;  2P4V A;  3CJH A;  3DSQ A;  3RT3 C;  4LF9 B;  1VMG A;  3APO A;  1OCO C;  5IY5 C;  3PJS K;  1S77 D;  4MT8 A;  2LW7 A;  3GVM A;  2WLN A;  4X66 B;  1X4T A;  3G6E V;  5KMG A;  1MOF A;  3L72 H;  3ZHQ A;  4JYB A;  1M56 C;  2QDO A;  5H2F Z;  1US6 A;  3AG1 B;  4PA9 A;  1IX9 A;  1JMK C;  1WNS A;  2P06 A;  4IIJ A;  3B8N A;  5CA0 A;  2HR3 A;  2N04 A;  1GN3 A;  3P30 A;  3SYP A;  3HKC B;  2KG7 B;  1SQP H;  1AR1 B;  4ZBM A;  1Q90 D;  2OTL V;  1Y74 B;  2BOB C;  4JI2 O;  3JCU Z;  4NXN O;  4WFF A;  2RMK B;  4KL1 A;  3O9O A;  2YS8 A;  5LHI A;  3VQX A;  3TCU A;  4X8A A;  4J10 A;  2R9I A;  3D8C A;  1KYO F;  2JEX A;  4I5S A;  4X9Q A;  4X1K A;  3ZBH A;  3RVZ A;  4PA6 A;  2PYL A;  4YJ3 A;  2Y0I A;  1WJZ A;  5L3G A;  3OM3 B;  4GUN A;  1YI2 V;  4AQY B;  2ZCE A;  3RYF B;  3ABU A;  1QQC A;  1XOU A;  1JFF B;  4I55 A;  3WU2 Z;  1Y67 A;  4Q20 A;  1Q6U A;  2ZKO A;  3BA8 A;  3K08 A;  4FJC C;  2UXD O;  3ABM B;  5IYC O;  3WG7 C;  1AI5 A;  4JAU A;  3OGC C;  4QE9 A;  3SJB C;  4DV0 O;  3E8G A;  4EEQ A;  1BHB A;  3E89 A;  2VQF O;  4U3F H;  2WA4 A;  3ZRW A;  2EJ7 A;  5KAF Z;  4Z1M G;  3A0B Z;  3G80 A;  1R73 A;  1JQ0 A;  2JK5 C;  3T1H O;  2OCH A;  3CC2 V;  2DJV A;  4DW0 A;  2Q67 A;  4UCT A;  1P84 F;  4P9P A;  2EIN C;  1EFR G;  1P4R A;  4CC6 A;  2ODM A;  1F4N A;  3OE7 G;  2ARH A;  3SGI A;  4X88 A;  3ZS8 C;  1IBM B;  1HNW O;  5IYD O;  1T5E A;  2BE3 A;  4H0L B;  1GN2 A;  3MHS C;  4MW8 A;  1W59 A;  1AJQ A;  4RUE A;  4X65 O;  1OCO B;  5IY5 B;  3F5T A;  2ZQM A;  3FB7 C;  1SZT A;  3OTF A;  3JD4 A;  3CRR A;  5LA6 B;  2HHH O;  1Q7Y W;  4O4I A;  4NB5 A;  1N36 O;  1M56 B;  4N21 A;  1HNX B;  3K06 A;  1ZL8 B;  4GYC B;  1DLB A;  1URF A;  4DR6 B;  2JEU A;  2WLJ A;  1SS3 A;  2QE7 G;  3JAT B;  1RSO B;  2NNU A;  3SPC A;  4XDJ A;  2QWQ B;  2VRZ A;  3JD3 A;  1XNR B;  3CRA A;  3ZMV A;  1KD1 W;  4EB6 A;  3T4D A;  4R7C A;  2X6C A;  3G71 V;  2F66 C;  4JYC A;  2E75 B;  2X6B A;  3ZHT A;  3CS5 A;  4DV1 B;  1VAR A;  3ASN C;  2VWJ A;  1K7D A;  4KXR A;  1M93 A;  2QWR B;  5BR8 O;  4H33 A;  4J7Z A;  1QLN A;  3LDD A;  4UCR A;  1TUB B;  2CTW A;  1EZJ A;  1KQS U;  3JD2 A;  3UT5 B;  5ITZ A;  1NKD A;  1K92 A;  3CRQ A;  2Y69 C;  4JTD B;  2V7Q G;  4OGQ B;  4BAY A;  1YTF D;  2GBO A;  1K5S A;  4OPH A;  3WG7 B;  4FK5 C;  4U7O A;  3E2E A;  5C93 A;  4DR2 B;  1ZLZ A;  3AG3 C;  2RDC A;  4HAM A;  2JDI G;  1ROP A;  2A0L A;  3QVN A;  2RJZ A;  1ZSP A;  2WAM A;  3CCV V;  1GN6 A;  3LNM B;  4JI2 B;  3STL C;  4X1I B;  4F6R A;  4NXN B;  4LNU B;  4DR7 B;  3SYO A;  1WA8 B;  2BTQ A;  4NTY A;  4O4L A;  3J81 N;  4DV5 O;  1Y6X A;  3OD4 A;  1R3I C;  1VQ6 V;  2DQ3 A;  4B7K A;  4P30 A;  4W4L A;  1VEW A;  4OPA A;  1PV0 A;  4FM2 A;  5LGN A;  2Q69 A;  2RN9 A;  1XIL A;  3FKS G;  1Q6H A;  2EIN B;  3K0G A;  4DK1 A;  3JAL A;  3IFX A;  1KKD A;  2B1I A;  1HWY A;  1EN4 A;  2BOC C;  1PKX A;  4O4J B;  3N2K B;  2UXD B;  4H37 A;  3QO8 A;  5JWP A;  3B2E E;  2CDY A;  3C90 A;  1S72 V;  2EIM C;  5B1B C;  4LF4 O;  4TSF G;  2UUA O;  1B6Q A;  5A9G A;  4DV0 B;  1Q43 A;  4LFB O;  1N32 O;  1BHA A;  2X7R B;  3JSN A;  1AJP A;  2Z5U A;  2WA3 A;  3F7Y C;  4IIJ B;  3CCU V;  1W0J G;  4BIZ A;  5CA0 B;  3ZN1 A;  2ZR2 A;  1V9P A;  2CH7 A;  2DWD C;  5L3B A;  2QWO B;  4J9Z B;  1IUR A;  2D3O W;  3K5M A;  4FLV A;  2IJK A;  4LF5 O;  2GDS A;  3BEH A;  2ZNJ A;  2PY5 A;  3W7U A;  4UCU A;  5B5E Z;  1I08 A;  5EZY A;  5LBQ A;  3ZMT A;  4X1K B;  2X0L A;  2R70 A;  4YJ3 B;  1HNW B;  3OT7 A;  1N4C A;  4UCV A;  2PTM A;  3K3W A;  2BSK A;  2ZM6 O;  3L9D A;  4F4L A;  3ASN B;  2M7W A;  4JYA O;  4I55 B;  2FTK A;  4B3M O;  1NT2 B;  3RN4 A;  4PV1 B;  4IYH A;  5TIS Z;  4MVR A;  4I4T A;  3S3W A;  1QCE A;  1N36 B;  4RQE A;  2Y69 B;  3OGI B;  1VQ8 V;  3UM7 A;  1F51 A;  1QR8 A;  1JVM A;  4U3J A;  3ZRW B;  3APQ A;  4TV9 A;  2FKX A;  4JI5 O;  2Q68 A;  1K4C C;  1XUQ A;  3AG3 B;  2F95 B;  3ASO C;  5KHH A;  3OMA B;  4DV6 O;  3AG4 C;  2VQE O;  5H5N A;  3QNE A;  1H2N A;  3LDC A;  3BAB A;  3B4S A;  4JF3 A;  4JI3 B;  3X2Q C;  1LUW A;  5EC2 C;  4K35 A;  5L3D A;  1UPG A;  3T4Z A;  4X89 A;  1Q81 W;  4X62 O;  4PI2 A;  2JGD A;  1U97 A;  1XEQ A;  2JJ2 G;  2YUA A;  1GMG A;  5EBL C;  3TXS A;  5BR8 B;  1H2S B;  3CCJ V;  1E1R G;  1K4D C;  1KB9 F;  1J95 A;  4GCZ A;  2W0X A;  4EKW A;  1L0L H;  3ZMZ A;  4PDM A;  2VWK A;  4WFB V;  2EIM B;  5B1B B;  4WBN A;  3FAV A;  5JJE B;  2XAS A;  3TJT A;  5LGU A;  1S5H C;  2BCC H;  3OAA G;  3BPZ A;  2AXT Z;  1K9M W;  1CEZ A;  4TUY A;  1YDX A;  5LL6 Y;  1H38 A;  1YJ9 V;  4KP4 A;  3KKY A;  5GW7 A;  5FNV A;  4L8J A;  2XAF A;  3TET A;  1VF5 B;  1GK9 A;  2PF4 E;  2YIC A;  1MSW D;  1VF6 A;  3SJQ C;  4DV5 B;  1THZ A;  1YF2 A;  3JAR A;  1BSM A;  4HBN A;  4EB6 B;  2P6J A;  4PD4 F;  1W2B U;  5H9C A;  5IJ9 B;  1FXK A;  4QGP A;  4JV5 O;  1L1F A;  4QIW F;  1FYJ A;  2ZDI A;  1JNB A;  2F43 G;  4A5U B;  3B40 A;  4QNH B;  1FD9 A;  1N33 O;  2CUG A;  5KHI A;  2R9R B;  1SKV A;  4XBF A;  1SA0 A;  3FD9 A;  3OUF A;  1N0J A;  3ZMU A;  5ITZ B;  4PHZ A;  2WSS G;  2UUA B;  1K73 W;  3VQY A;  3B77 A;  1LR1 A;  3KG2 A;  4LFB B;  1IBM O;  3QO5 A;  1RP3 B;  1P49 A;  3OTO O;  2PYJ A;  1WPX A;  4MTO A;  2B5U A;  1GH6 A;  4B3T B;  3HKD A;  2YEV A;  3DXR A;  2WLL A;  4KHP O;  3STZ C;  2A9H A;  2CTP A;  2EJR A;  3IAY A;  4K0K B;  2QGN A;  4ZHQ A;  1SES A;  1D5A A;  4F6R B;  3ASO B;  4NTX A;  1S76 D;  2YID A;  3JAW B;  3CCL V;  3AG4 B;  2BTQ B;  4CC5 A;  4TOI A;  1S0V A;  1PL0 A;  4MTG A;  3HKB A;  4O4H A;  1YJW V;  3LNN A;  1QVG U;  4U7N A;  1GRJ A;  3RYI B;  2EX3 A;  4MVM A;  1QU7 A;  4J41 A;  5BXZ A;  3JAL B;  1N8R W;  2Y4U A;  2DN9 A;  4JYA B;  5AG2 A;  3BAA A;  4B3M B;  1K3E A;  1E79 G;  4FVM A;  2F23 A;  4W4K A;  4K8Z A;  3LDE A;  1YEW A;  2QKA A;  2K1E A;  2LJ2 A;  4XDK A;  2ZE6 A;  4FFB B;  2IW5 A;  4DV1 O;  5KAI Z;  2ADQ B;  3CME V;  3AK1 A;  2E5L B;  2KSD A;  2YIB D;  5CB4 A;  5JCO C;  1VQ7 V;  3A8T A;  3M7M X;  1NZ6 A;  2QA4 V;  4JI5 B;  2UXB O;  1VIB A;  3E83 A;  4PI0 A;  4JAA A;  4LBE C;  4TWK A;  5BZB A;  1VF6 C;  1SZX A;  2EIK C;  4DV6 B;  2VQE B;  4UVA A;  1ARO P;  3RYC A;  3A2F A;  4WCE V;  2CE4 A;  3G67 A;  3CE2 A;  1U96 A;  4DR2 O;  2DW4 A;  1FXK C;  2YI8 A;  5H6R A;  4X62 B;  5JVD A;  2B1G A;  2HVK C;  5EZY B;  2ZE7 A;  1EN5 A;  2GV9 A;  2ZDI C;  2IBZ H;  4NVP A;  3W7W A;  3E22 A;  5A2Q N;  2OIG A;  4DR7 O;  4LF7 O;  5BMV A;  3D3Q A;  3RBZ A;  2BSK B;  4MVS A;  3E8F A;  2CTR A;  1XMO O;  5LHG A;  2ZIM A;  1IXM A;  5LP6 A;  1R3L C;  3SPJ A;  2A3Q A;  1J5E B;  1GN4 A;  4I4T B;  5IYZ A;  3HKE A;  1BQ0 A;  5IWA B;  3P32 A;  3M8A A;  1M1K W;  3ZHR A;  4RWU A;  4PDV A;  4U3J B;  4TV9 B;  2Q7H A;  1JX9 A;  4DRX A;  4LH7 A;  2O57 A;  1G1X B;  1K5Q A;  1H5W A;  2L35 A;  1AI4 A;  4FLZ A;  3CEI A;  1R1B A;  2DYR C;  3ABK C;  3K58 A;  1JA8 A;  4AIL C;  5J2U B;  2IJJ A;  2YC0 A;  1L0N H;  1BE3 H;  4MSW C;  4BW5 A;  3T1Y O;  1NS1 A;  1W0K G;  3CRC A;  4JV5 B;  2JGD B;  2B9Z A;  1Y76 B;  2YDE A;  1N34 O;  2XUM A;  2ZR3 A;  2RNB A;  1N33 B;  2YSU B;  1M9N A;  5DN6 G;  2AZ2 A;  4FLY A;  1ZWI C;  5CMU A;  1NR1 A;  5LGT A;  5IJ0 A;  3J80 N;  1TVK A;  3BFR A;  1QBZ A;  2WLK A;  3OTO B;  3FAV B;  2XAG A;  5FPO A;  4UCO A;  5L3E A;  1K33 A;  1H8E G;  4TUY B;  4OXS A;  5GON B;  1DK1 A;  4KHP B;  1KKC A;  4YY3 B;  3GWO A;  2N05 A;  5KHJ A;  4B3S B;  3O65 A;  3R66 A;  3Q4H A;  2EIK B;  1SQF A;  2DQ0 A;  1MNG A;  2ZIO A;  2P90 A;  1I94 O;  5B1O A;  1L8D A;  4DV2 B;  1NH2 B;  3JAR B;  2QM7 A;  1OCR C;  3PN1 A;  2XTA A;  2GUZ A;  1KU9 A;  2ZNI A;  3ZED A;  1WPB A;  1Q8I A;  4HNA A;  1FXK B;  4DR4 O;  3QG5 A;  1K97 A;  4DR3 O;  3SYA A;  2PZS A;  1KUQ A;  2EIL C;  4ZIB A;  2JRI A;  1I0H A;  3CPW U;  4JI3 O;  5LP6 C;  1TA8 A;  5C8Y A;  5LXT A;  4IHJ A;  1DF4 A;  3FYE B;  1AP5 A;  3ZMS A;  1JOY A;  4NYK A;  5KUK A;  2OYQ A;  3OUS A;  1SQQ H;  4P2Z A;  5DM6 V;  1YVW A;  5LMU B;  2UXB B;  1H2G A;  5B66 Z;  4RAI A;  1K34 A;  1Q5O A;  3AEI A;  2CK3 G;  3HKD B;  2YEV B;  3DXR B;  1SQX H;  2WLL B;  4GKJ B;  1WP7 A;  1QLE C;  3FX7 A;  2LO1 A;  3DGE A;  2V1D A;  1NVP B;  2KB1 A;  2JGU A;  1M5I A;  4J7J A;  4ZHQ B;  1Q3E A;  4FZ1 A;  3T1C A;  3AG7 A;  3ZRX A;  2DYR B;  3ABK B;  3N2G B;  1G4Y B;  4CZZ A;  2EIJ C;  1PPJ H;  4IT5 A;  3HKB B;  1XMQ B;  4O4H B;  4UB6 Z;  1EZV H;  4WFG A;  2QTS A;  4LF7 B;  3A0H Z;  2P67 A;  5EYP A;  3HB3 B;  3BCC H;  1XMO B;  1WN7 A;  2A06 H;  5EK0 A;  1FFX A;  1OV9 A;  5IT9 N;  2WWW A;  3OMN B;  2Q7G A;  4ZOL A;  5CBG A;  4HZ3 A;  4X20 B;  3UKM A;  1O9H A;  3ZRV A;  3CCR V;  5LMN B;  3CJH B;  4DR1 B;  4R50 A;  4UFZ A;  4LFC O;  4JPR A;  4YJ2 A;  2HEP A;  3JAM N;  4D7S A;  1BGY H;  2F4V B;  3U11 A;  5CB4 B;  3CCE V;  4PJ0 Z;  1CPY A;  4GX0 A;  4YHH O;  1R6K A;  3W7S A;  1OZ0 A;  5FPR A;  5KMG B;  5B3S C;  4XDL A;  5E79 Z;  3RW0 A;  5KHG A;  2CAZ C;  1JCH A;  3CB2 A;  4YIO A;  2DOS A;  4OX9 O;  2AGA A;  1XDC A;  5L3C A;  2OTJ V;  4BIO A;  4FMT A;  4PDL A;  2R9A A;  3W7X A;  3CXH F;  2IM9 A;  2V4D A;  4B3T O;  2KKW A;  1IVS A;  3T1Y B;  3QTC A;  2QJ1 A;  5JVD B;  2GTS A;  1OCR B;  4ASU G;  4K0K O;  1N34 B;  4JTC B;  1O9G A;  4JI6 O;  1FPO A;  3C3S A;  5BMV B;  4B08 A;  3CX5 F;  2OWO A;  3HPL C;  3CCS V;  4JI7 B;  2EIL B;  5IYB O;  1NU1 H;  4BWA A;  5LP6 B;  1Z5V A;  5EIB C;  5IYZ B;  3CHX A;  3D36 A;  2ZIN A;  2UUC O;  3HKC A;  4DR5 O;  2DE0 X;  1NI8 A;  4E4E A;  1SF9 A;  3I5D A;  4DRX B;  5IDJ A;  1GTO A;  4PEL A;  4NR1 A;  4CH3 A;  4GKK B;  2Q9L A;  3VOU A;  3BHP A;  4TT3 G;  3CC4 V;  3B8M A;  1QLE B;  2E5L O;  2LP7 A;  3WFV A;  1I94 B;  5K1X A;  1K8A W;  4DV3 O;  1Q6I A;  4LFA O;  2NN4 A;  4DV4 B;  2BTO A;  1AI6 A;  4DR4 B;  2EIJ B;  2NR5 A;  3VQV A;  1H2L A;  1Y4M A;  4DR3 B;  4IYI A;  3K0D A;  4JZG A;  1JFF A;  5J2T A;  3ZRS A;  4GLX A;  3G4S V;  2W6J G;  1EN6 A;  3KDR A;  2Z0A A;  3EFF K;  1M90 W;  1JJ2 U;  4MW3 A;  2JS5 A;  4CH4 A;  4DV7 O;  2RCV A;  2PGG A;  1IXB A;  1HW7 A;  4BR6 A;  2E76 B;  3UO3 A;  3WB1 A;  1M4U A;  2F1M A;  1ENV A;  2HFE C;  5H6Q A;  3U0Z A;  4PA3 A;  1YCI A;  3BRC A;  4JGS A;  1J5E O;  3F7V C;  5KA5 A;  4O4I B;  5B3S B;  3Q4H B;  4Z2W A;  5IWA O;  3ZHS A;  4JI8 O;  1I7F A;  5CN0 A;  1IBK O;  4LWS A;  2XAH A;  1XQ8 A;  1FAF A;  5KHK A;  2YIB A;  3RYH A;  2P7T C;  3IGA C;  1R6N A;  2LGQ A;  2QWN B;  1V55 C;  4HNA B;  3E8B A;  1HDJ A;  3KZI Z;  3JAS A;  3HR0 A;  3ZHU A;  3MHH C;  5B1A C;  1SER A;  4J42 A;  1XL6 A;  1FS0 G;  1OCC C;  1VP7 A;  2ZE8 A;  3MAQ A;  5JJN B;  2Q0A A;  1AJN A;  2E3C A;  1VQM V;  1PP9 H;  1ZL8 A;  1S5L Z;  4LFC B;  1VQO V;  1P7G A;  3OW2 U;  1E1Q G;  1BQZ A;  1MZF A;  3L75 H;  3LSU A;  4LCU C;  3K9S A;  1RSO A;  4YHH B;  3FB5 C;  1WB7 A;  3K03 A;  4JYY A;  1ZTE A;  3B09 A;  2Q5Z A;  5JH7 A;  3JAK A;  4GX5 A;  2IU0 A;  1UJW B;  2XT9 A;  1IZ3 A;  1XHX A;  4FZ0 A;  4OX9 B;  4MVZ A;  4DUZ B;  3S3X A;  3T2M A;  1S3J A;  2HP8 A;  1PL4 A;  1GM9 A;  3CCM V;  1R3J C;  1JR9 A;  4YY3 O;  3EVK A;  3SYQ A;  4B3R B;  1D5N A;  4B3S O;  2PI4 A;  2F93 B;  3SPH A;  5EBW C;  3ZX6 A;  3P3N A;  4JI6 B;  2W0F C;  4LC1 A;  4O4L B;  2GSM B;  2WLH A;  4JI1 B;  4DV2 O;  3RWR D;  3TK1 A;  1IBL B;  4X1Y A;  5EYP B;  2WPD G;  5D5Q A;  2Y48 A;  3C3T A;  4J80 A;  2OCC C;  3ZJZ A;  1FFX B;  1H8H G;  3G6B A;  4WFE A;  3WB0 A;  4ZOL B;  3RGB A;  2XAJ A;  1XHZ A;  5J9P C;  2H8P C;  4KFM A;  3I55 V;  2UUC B;  4K3A A;  2ZE5 A;  4YJ2 B;  3BA9 A;  4DR5 B;  1YIJ V;  2A79 B;  4LF8 O;  1P7B A;  4FFK A;  1RM1 B;  1VQK V;  1PNM A;  2C2A A;  5LHH A;  4LNU A;  2HKO A;  1NJI W;  1G8M A;  4JTA B;  4PA4 A;  1VQP V;  1WA8 A;  4I7Z B;  4MTX A;  3JSL A;  2EUL A;  4J7K A;  2JVD A;  5LMU O;  3AK2 A;  4I50 A;  3M99 B;  4DV3 B;  4LFA B;  4CH5 A;  4K8X A;  1NR7 A;  1EM1 A;  2CH7 B;  4GKJ O;  2YXL A;  3J7A U;  1YJN V;  2ADP A;  4CS2 A;  2H94 A;  5BY1 A;  3DTU B;  1V55 B;  3OMI B;  2IJH A;  1WP8 A;  4FLX A;  4O4J A;  3N2K A;  4LH6 A;  2WLM A;  3ZCC A;  4C7U A;  4TQF A;  4FIP C;  2OIE A;  5B1A B;  2QTO A;  5HFL A;  4I9Q A;  2YIA A;  3L71 H;  1XMQ O;  1OCC B;  1COW G;  4H44 B;  1NH2 D;  5JJJ B;  4DV7 B;  5FL7 G;  4GX2 A;  5CBF A;  3FB8 C;  4D7T A;  1BZK A;  2PI5 A;  5EBM C;  1GM8 A;  3TXQ A;  1UFI A;  1FOU A;  3UO2 A;  2D2C B;  3CMA V;  3ML0 A;  1YZB A;  3K04 A;  3SJA C;  1NBM G;  1MZE A;  5LMN O;  4DR1 O;  2Y4T A;  4JI8 B;  3ZHV A;  4AHC A;  1V54 C;  2HJD A;  2F4V O;  3K5L A;  1IBK B;  2GTA A;  4E2L A;  3ETE A;  1KP3 A;  3BY6 A;  5HFM A;  3H01 A;  4J11 A;  4IL6 Z;  3CCQ V;  1BS3 A;  2CGO A;  3RFR A;  2P22 C;  2ZD9 A;  3IJ4 A;  1GAX A;  4WFH A;  1VQ9 V;  4DXW A;  5J2T B;  3EXA A;  4JAS A;  3OEE G;  4PDR A;  1NVP D;  1QNM A;  2ZT9 B;  1DF5 A;  3P3P A;  3L74 H;  4JI4 O;  3OR6 C;  3OFN G;  3CYO A;  4D6T H;  3NR7 A;  5KA6 A;  2OCC B;  1XNQ B;  3BVO A;  1AP6 A;  1XL4 A;  4CS3 A;  2FYU H;  3CWB H;  1JJO A;  1BMF G;  1NTM H;  2ATK C;  2UXC O;  5CA3 A;  4LF6 O;  4JI7 O;  4TQD A;  4O2B A;  4TV8 A;  2G38 A;  2K9P A;  2Q7E A;  4WBN B;  1HP8 A;  2ITD C;  4MTF A;  5F2V O;  2CGN A;  2JS3 A;  3LSS A;  1RFY A;  4LWS B;  2H3O A;  4JAV A;  4F6E A;  3AK3 A;  2LFS A;  4JI0 B;  5FNV B;  3RYH B;  3LUT B;  4ZKI A;  4BIU A;  3L73 H;  2UUB B;  4GKK O;  1S5J A;  2RQ6 A;  3JAS B;  1VQN V;  2PUS A;  3K9A A;  4CBC A;  4CH6 A;  4FLW A;  4X64 O;  1XBL A;  3K5O A;  4DV4 O;  2NLJ C;  2MW2 B;  2Z3Y A;  1MSD A;  4J9Y B;  2R72 A;  3IC9 A;  1QR9 A;  1AI7 A;  3F5W C;  4EFE A;  3JD0 A;  2QWP B;  5JQG A;  1FXH A;  1IDS A;  3UCS C;  4QE7 A;  4LF8 B;  3MD0 A;  2CTQ A;  4ZI7 A;  2YI9 A;  2ETN A;  3CSX A;  1KEC A;  1SA0 B;  2MK3 A;  3L70 H;  1EBO A;  4UVC A;  1KMI Z;  1AIL A;  5JH7 B;  3JAK B;  1VF7 A;  3CC7 V;  3SPI A;  2KQX A;  1HR0 O;  2UU9 O;  1V54 B;  5IJ9 A;  4FM1 A;  3AG2 C;  4G27 B;  2ZXW C;  2QM8 A;  4CS4 A;  4NXM B;  3H1H H;  3GWK C;  4MVO A;  2IJI A;  2Q6A A;  4UV8 A;  5CA1 A;  3FFQ A;  1AR5 A;  1PD3 A;  1OHH G;  4P9O A;  4NTW A;  1FJG O;  3CD6 V;  3FYI B;  2WLI A;  2QSA A;  2VS0 A;  5LOV A;  3GB7 C;  1HNZ O;  1IJG A;  1I5Y A;  4LP8 A;  4X1Y B;  3H1I H;  3JYC A;  4MS2 A;  4QJF B;  2E74 B;  2XND G;  3SDL A;  4DYL A;  5LYJ A;  1R3K C;  4O2A A;  3U10 A;  2IH3 C;  1MAB G;  1SQG A;  2Y0P A;  1PM9 A;  5KX5 A;  4GX1 A;  3ABL C;  1DTO A;  3FB6 C;  1BL8 A;  3SYC A;  5KLV H;  3JAW A;  5B1N A;  1MA1 A;  1AVM A;  4UV9 A;  4I50 B;  1B06 A;  5GTH Z;  3K59 A;  1OJH A;  3K5N A;  2XOK G;  3UQ8 A;  1H2M A;  4LR3 A;  3RYI A;  2Q4P A;  1F4M A;  3H1K H;  1OCZ C;  3RVY A;  1G6U A;  1A32 A;  4DUY O;  2DMX A;  3K57 A;  1VQL V;  3DC5 A;  3RYC B;  4DUZ O;  4I0X A;  1BCC H;  3ABT A;  4AI8 A;  4DK0 A;  5CBH A;  3THO A;  1H2K A;  1TGO A;  1LNQ A;  4QPJ A;  4FFB A;  4JI4 B;  1MG1 A;  4B3R O;  4IGG A;  3E22 B;  2VQF B;  1M57 C;  4N23 A; 
#chains in the Genus database with same CATH homology
 4E4E A;  2CE4 A;  3BFR A;  4X9Q A;  1N0J A;  3AK2 A;  1EN4 A;  1WB8 A;  1LUV A;  1AP6 A;  1EN5 A;  4GUN A;  1AR5 A;  2CDY A;  1KKC A;  1LUW A;  1EM1 A;  1Y67 A;  1P7G A;  1ZUQ A;  2ADP A;  5A9G A;  2P4K A;  3LSU A;  1MNG A;  3K9S A;  3DC6 A;  1XRE A;  4C7U A;  1WB7 A;  1GN4 A;  4JYY A;  1VAR A;  1ZTE A;  4JZG A;  4F6E A;  3AK3 A;  1EN6 A;  1BT8 A;  1PM9 A;  3KDR A;  2GDS A;  2AW9 A;  1PL4 A;  4YIO A;  1I0H A;  1I08 A;  3TJT A;  1XDC A;  1JR9 A;  3EVK A;  1AR4 A;  2RCV A;  1MA1 A;  1D5N A;  1IXB A;  3CEI A;  4BR6 A;  1AP5 A;  1AVM A;  3KKY A;  5AG2 A;  1B06 A;  1JA8 A;  1MSD A;  1ZLZ A;  3OT7 A;  1N0N A;  2QKA A;  3IC9 A;  1IX9 A;  3QVN A;  2ADQ B;  3C3T A;  3C3S A;  1ZSP A;  1IDS A;  1GN6 A;  1BSM A;  3AK1 A;  3RN4 A;  1GN3 A;  3DC5 A;  3MDS A;  1GN2 A;  1BS3 A;  1MMM A;  4YIP A;  2QKC A;  4FFK A;  1SZX A;  1VEW A;  1QNM A;  4JZ2 A;  1XUQ A;  1XIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...