1MMMA

Distinct metal environment in iron-substituted manganese superoxide dismutase provides a structural basis of metal specificity
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Metal Environment in Fe-Substituted Manganese Superoxide Dismutase Provides a Structural Basis of Metal Specificity
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (IRON-SUBSTITUTED MANGANESE SUPEROXIDE DISMUTASE)
total genus 76
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1mmmA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1mmmA02
1N0JA 3TJTA 1N0NA 3IC9A 1BT8A 2QKCA 1BS3A 3EVKA 1VARA 1GN4A 1I0HA 4YIPA 1LUVA 1GN3A 4JZGA 1MNGA 1XILA 1AP6A 4JZ2A 1ZLZA 1EN5A 1B06A 1ZUQA 1ZSPA 1GN6A 4GUNA 1BSMA 2AW9A 3RN4A 3OT7A 1IX9A 5A9GA 1MMMA 1GN2A 3DC6A 1Y67A 3AK3A 1P7GA 1PL4A 2ADPA 2GDSA 1MA1A 3C3TA 3MDSA 4F6EA 1D5NA 1JR9A 5AG2A 2CDYA 1AR5A 1I08A 1WB7A 1XREA 4X9QA 1AVMA 3AK1A 1IXBA 3BFRA 1AR4A 1WB8A 1AP5A 3DC5A 3C3SA 1KKCA 3LSUA 1PM9A 1XUQA 2RCVA 1JA8A 2QKAA 4YIOA 1QNMA 4BR6A 1LUWA 2CE4A 1EN4A 1XDCA 1EN6A 3AK2A 1MSDA 4C7UA 3CEIA 4FFKA 1SZXA 2ADQB 3KKYA 3K9SA 1ZTEA 4JYYA 3QVNA 1EM1A 2P4KA 1VEWA 4E4EA 1IDSA
chains in the Genus database with same CATH superfamily
1NJIW 4J9ZB 1Y76B 3CRRA 4JAUA 5KHIA 4Z2WA 4RAIA 2KB1A 2V4DA 4LNUB 1K97A 1LUVA 2N05A 1YEWA 4G2KA 1XILA 5EYPA 3OW2U 2Q7HA 1HNZO 1FFXB 1HNXB 1LNQA 2KG7B 4JTDB 5GONA 1COWG 4RQEA 5A9GA 2YXLA 3DC6A 4XDJA 5D5PA 2VQFB 1P7GA 1FKAO 4JI2O 3CYOA 2EIMB 3E8FA 4GX2A 3FD9A 1PNMA 3K58A 1G8MA 3W7TA 3RYHA 3T1CA 4MVRA 3H1HH 1IURA 5DEDA 3T1HO 1YJNV 4DV6O 2BOBC 2PGGA 2LQTA 3CC2V 4FVMA 5EZYB 3CCEV 2YDEA 1H2LA 2Z3YA 1KKCA 4O4IB 4B3SO 2QWQB 4LF6B 3HKBB 1TVKB 3OMNB 5L3DA 2KQXA 2HFEC 2Q8VA 3JASA 5A2QN 4IT5A 5B1NA 2OCCB 4YJ2B 1K92A 2A3QA 4DR3B 2OYQA 2QA4V 2DJVA 1MOFA 1M56B 4N21A 3SJQC 3CJHA 2WLLA 2BTQB 4LF9B 2PTMA 1VP7A 4GX1A 4Q6GA 2P7TC 2QKCA 2O57A 1BS3A 3JD3A 5BR8O 2ZDIA 1VF6A 5CBGA 1GN4A 2Y0IA 2P22C 3AG7A 3T1HB 1OCZC 3GVMA 1M93A 2EBOA 4PDMA 2ZE6A 1I94O 4J80A 4JI3B 4EFBA 1B06A 4DUYB 3FAVB 5EIBC 1G6UA 4UCUA 4LFBB 1GN6A 5GONB 3ZJZA 1THZA 3LDEA 4F6RB 2Z0AA 3JARB 4IIJB 1PP9H 4LF7O 2DMXA 1AB3A 3AK3A 4O4HA 2GUZA 2GV9A 1K5SA 4HBNA 4CH4A 4J7KA 2EZOA 3L70H 4F6EA 5AG2A 5GTIZ 3I5DA 1XMOO 3BHPA 1DTOA 1FJGB 2WLIA 5H9CA 1N34O 4WBNB 1OCZB 3CJHB 1KECA 3K0GA 2BOCC 3DC5A 3UO3A 2XAGA 2HG5C 1IVSA 4GKKO 5GW7A 2FL4A 1PV0A 4TQFA 5B1AC 1AR1B 3JASB 5KMGB 1F23A 2LFSA 4NXNB 2ZT9B 1ENVA 4MSWC 4PA3A 2JEUA 4W4LA 3CB2A 1KP2A 5FNVB 4TT3G 5CA0B 1URFA 4PV1B 3OMAB 1L0NH 4X66O 2E74B 4O4IA 1NVPB 1SA0A 3KZIZ 4YY3B 2X6BA 2HHHO 5LHGA 3GWOA 1N0NA 3E2EA 2QM4A 3EFFK 1R3KC 5BMVA 1U96A 5L3GA 4H37A 5IWAB 4JYAO 4GX0A 1F7YA 2FB5A 4LH6A 1N36B 1Q82W 2EX3A 4MW3A 3G71V 4FLZA 5CA3A 5LGTA 2ARHA 3APOA 5JQGB 3VQVA 3P30A 1WN7A 1GKFA 4GUNA 1BSMA 3E35A 1L8DA 2YSUB 2Q69A 4IIJA 4WBNA 3KCYA 1MMMA 2WPDG 2XAQA 3S3WA 2GSMB 4J10A 4CS3A 1Y66A 2HR3A 1Z5VA 4B08A 5KLVH 3T2MA 2CAZC 4LFAB 3K5MA 3QTCA 3OR7C 3AEIA 3MDSA 3JARA 3RVYA 3CSXA 3EXAA 4X65B 1JFFA 1M56C 1U97A 2CTWA 2QTOA 1AR4A 2RMKB 3F7YC 4DV7O 1IBKB 5LA6B 1M1KW 4DR1O 1AI5A 2Y69C 4ICGA 4EEQA 5H6QA 5E79Z 3CC4V 1QNMA 3ETEA 1V9PA 3A0HZ 3AK2A 3U0ZA 1KD1W 3SYOA 4GYCB 1KC8W 1R73A 2YEVB 3RYIB 4EFEA 4DYLA 1QQCA 3QVNA 4K8XA 3VQYA 3LUTB 4X1KA 4LBEC 4DR3O 1IBLO 5HFLA 3SJBC 5IYDO 3CCSV 2PY5A 1HWYA 4LF8O 1JOYA 3IC9A 4LCUC 4PA4A 4O2BA 5ITZB 3B40A 1WA8A 2A7WA 4IL6Z 5LP6C 1DLBA 3MAQA 2P6JA 1YHQV 1SF9A 4QE7A 3T4ZA 2JGDA 2LGWA 1UJWB 5LA6A 4JV5O 4FMTA 1US6A 3CPWU 5IWAO 1GM9A 4X62B 1XI1A 5JCOA 1Q86W 1ZSPA 1X4TA 2ZIOA 2ITCC 2Q5ZA 4X1YB 2K1EA 3RVZA 2OCHA 3SR2C 3OUSA 3APQA 4B7EA 1SZTA 3VBBA 1OCOC 1RM1C 2B9ZA 1YJWV 4I9QA 5EC2C 1FXHA 1Q90D 4FZ0A 3SPHA 5BMVB 3FB8C 3G6BA 5LYJA 1FYJA 3CRMA 1CXZB 4OX9B 3STLC 1N33B 4FLVA 2H3OA 3OAAG 2HLDG 2ILMA 4QNHB 2BTQA 2ZE5A 3K57A 1MZEA 1I7FA 4GKJB 5J2TA 4PDRA 5B1BC 4JI1B 3THOA 1YI2V 1VQ9V 4UV8A 4FFBA 1JNBA 4MVUA 1QU7A 4YHHB 4ZHQA 1NQTA 4JI7B 2JK5C 1MSDA 5B1AB 1AJNA 3UT5B 4TOIA 3CC7V 1VQKV 2ADQB 1VF5B 2F1MA 1QR9A 4JYYA 3ZMSA 3CCMV 1GRJA 5JWPA 4DR7O 3ZEDA 3D3QA 2DW4A 4X88A 1ORQC 2WLHA 3D36A 5BR8B 1XNRB 4JI3O 4NB5A 5B66Z 1PNLA 4TV9B 3A0RA 1R3LC 2CK3G 2HJFC 3OTOB 1BQZA 1K8AW 4UVAA 4X20A 1AP6A 4JYCA 2BE3A 4FJCC 3BPZA 4B3MO 4UCRA 1VQ4V 3ETDA 4PELA 4P2ZA 1S0VA 3PN1A 4H33A 3N2GB 4PI2A 1TGOA 3K59A 2E3CA 4X1KB 4X64O 4DV5O 1GM7A 2EULA 3B2EE 4U7NA 1M4UA 2WAMA 1Q81W 1E79G 2RJZA 4UVBA 2UUCO 4LFCO 4DR4B 3ZRWA 5L3EA 5KUKA 3JAKA 4I55A 5H5NA 2ZM6O 3CRQA 4JI6B 1D2DA 5FPOA 4RWUA 5C93A 4AI8A 4UCTA 3RYFA 2FTKA 1K4CC 2BSKA 1FPOA 4FLUA 1N36O 2XAJA 3LSSA 3SPIA 3LSUA 1Z5WA 2RCVA 3NR7A 3LNNA 1IBLB 4YIOA 2Y69B 4D6TH 3UO2A 2JS3A 5J2UB 2Q7EA 3A8TA 4PDLA 1A32A 1S77D 2UU9B 3CEIA 3R65A 4JF3A 3NXSA 3ML0A 2X7RB 5LMNO 1TUBA 4FZ1A 5L3CA 2XTAA 4LR3A 4CC5A 2UXXA 1GMGA 2OCCC 2YUAA 1H2NA 3AG3C 2ZQMA 4AQYB 2K9PA 4DRXB 4JI5O 1CP9A 3B4SA 1VARA 1NR1A 2B5UA 1Q8IA 5D5QA 4NXMB 4MVOA 1NU1H 1B04A 4CS4A 1SQFA 2EIJB 1ROPA 1VIBA 3QG5A 1IBMB 4XDLA 2HP8A 1OCRC 4DR6B 2ZXWB 1M5IA 2ZNJA 3OM3B 5LP6A 5B3SC 4DV4B 1SA0B 4OPAA 1YCIA 3OT7A 5BXZA 2VWJA 4XBFA 2X0LA 4CC6A 2UXCB 1XMQO 4TV9A 1VQNV 1XNQO 1SETA 3WB1A 4TUYA 3JSNA 3M7MX 2ADPA 1RM1B 2Q9LA 2ZKOA 5J2UA 2QSAA 4PA6A 2YEVA 3RYIA 4HNAB 3FKSG 4ZI7B 2CTRA 2WLJA 4UCVA 5LOVA 1YIJV 2EIKC 2JGDB 2JS5A 2OTJV 1YITV 4I7ZB 3C3SA 1BMFG 1B3QA 1NZ6A 4X66B 1RPRA 3JALA 2WA4A 4EKWA 4E2LA 3CCLV 4DV3B 3BY6A 2NLJC 2F4VB 1FFTB 3ABMC 4DR5B 3B09A 4LFAO 1S5HC 4C7UA 1YDXA 1OJHA 1VQLV 3KKYA 3GB7C 4R8CA 1R3IC 4QJFB 1K4DC 4GCZA 3B8NA 3VQXA 3OGCC 2F23A 4B3TB 3BAAA 4UUJC 3SPCA 2D3OW 4PA7A 3QF7A 1GN3A 2GUZB 4Z1VA 1AJQA 2ZE7A 3ABTA 4OGQB 2EZPA 4QPKA 3VOUA 5EIBD 1YSCA 4OX9O 5IYCO 2UXNA 5H2FZ 4PJ0Z 1D5AA 1BL8A 1X59A 2AW9A 2F4VO 4NXMO 4MVZA 4UVCA 1NKDA 3E8BA 3BRCA 4JI2B 2H94A 4CH6A 4BWAA 4NTXA 3ZRVA 5IY5C 3OEHG 1HR0O 3E86A 4GX5A 5ITZA 1JVMA 3J81N 5K1PA 2ZNIA 1HR0B 2EINB 1M57C 3SYCA 1EZJA 2ZE8A 1DGSA 2XT9A 3JCZA 3AK1A 4I0XB 4LC1A 1EZVH 4MVSA 1SESA 1FAFA 4X62O 2DWDC 2HEPA 2Q7GA 1L0LH 5JH7B 4HAMA 5LXTA 2CTPA 3ZMTA 2A06H 4FFKA 4I0XA 3LDCA 1VQPV 1H38A 5LGUA 1IJGA 3K9SA 1ZTEA 3CX5F 3JYCA 4BW9A 1YJ9V 3M8AA 4FPPA 1EM1A 2EJ7A 1WPBA 1VEWA 3SPJA 2QM8A 4BIOA 4MS2A 4KFMA 5B3SB 2AHYA 1N0JA 4GKJO 1BT8A 3ASOB 1BE3H 3AG3B 1EFRG 3QO7A 3U11A 4DUYO 1M57B 3FX7A 4I9WA 2WWWA 5B1OA 1H5WA 1I0HA 4WFGA 1QBZA 5L3BA 3ZN0A 1Y74B 2DQ3A 4PI0A 3BCCH 4G27B 3P3PA 2YS8A 1IBKO 1K9MW 1Q7YW 5DN6G 1N32B 3JCUZ 3I55V 4DUZB 5LP6B 3X2QB 4Q20A 4ABMA 1BZKA 2QWRB 3ZMUA 3JATA 1PL0A 5KHGA 2IJHA 4K0KB 3SJCC 1GN2A 3HR0A 4UV9A 3TK1A 2CTQA 3BA9A 4PDVA 3RWRD 3W7WA 3OUFA 2FYUH 2QEXV 1GTOA 2ZM6B 3KCXA 1VMGA 2BTOA 3DXRA 4YJ2A 4MTGA 1AR5A 1WB7A 1MSWD 4MW8A 1UFIA 2R72A 1XMOB 2R70A 4NTWA 4JI8B 4J11A 3EHBB 4DV0B 1PM9A 4MTOA 3IJ4A 4FLYA 4X8AA 4MVQA 5F2VO 1SQPH 4HNAA 4LF4B 1R1BA 4LWSB 1RP3B 3OEEG 1NR7A 4KUMA 4B3MB 1JMKC 1R3JC 5KX5A 4LNUA 5KAIZ 5IJ9B 4LH7A 3ZBHA 5CB4A 3OTOO 3IC7A 4I50B 5EZYA 3K03A 2ZCEA 5CB4B 5FPRA 1S3JA 2R9IA 1H8EG 3TJTA 5IYZA 4CZZA 4NR1A 2ETNA 3EVKA 4R7CA 3MHHC 4JTAB 2LW1A 4YIPA 1O9GA 5IY5B 4EB6B 4AHCA 2R9AA 3CWBH 1JJ2U 2IM9A 1FFXA 1XL4A 4Z1MG 1HDJA 3ZMZA 4PD4F 5BZBA 3K5OA 2ZINA 3ZRXA 5IJ0A 2Q4PA 2IW5A 2KG7A 2DYRC 1WA8B 2KSDA 3CP1A 2UXDO 3CCQV 2LGQA 1CEZA 1RPOA 2OTLV 5FNVA 2QKSA 1QLEC 3W7XA 2UXBO 2YIAA 4WFBV 3JD1A 5IE9A 2JJ2G 1K33A 5KMGA 1GM8A 3JSLA 1SERA 1D5NA 3F5TA 2QWNB 1I08A 1H2KA 1XREA 3L73H 4OXSA 2RDCA 4R6ZA 1IXBA 2M6YA 3H1IH 1XOUA 3L75H 5TISZ 4CH3A 5K1XA 4YY3O 2OWOA 2XHBA 3OE7G 4YJ3A 3ASNC 3BABA 2UU9O 4DR1B 4BW5A 4CH5A 3N27A 2CE4A 3CCUV 1DF5A 4DO2A 4EB6A 3RYCB 4GZRB 3Q4HA 3WG7B 1IZ3A 3JD2A 4TV8B 5LYJB 4PHZA 3D36C 3DSQA 4I4TA 5J9PC 1T5EA 1WNSA 3QO5A 4X1IA 3X2QC 4IHJA 4NYKA 1JPXA 2A0LA 1FXKB 4JGSA 4UB8Z 3HKBA 3E22A 2E5LO 2UXBB 1NI8A 1N34B 5CBFA 1OCOB 4LF6O 5C8YB 3L71H 1V54B 2HKOA 3ZIAG 2YC0A 1VQ5V 2IH1C 2LJ2A 1WP8A 2UUBB 4YJ3B 1KBHA 4B3SB 3ZHSA 2EJRA 4K0KO 3FYEB 4QE9A 3W7UA 3M99B 5IDJA 4RUEA 1OCCC 3A0BZ 3STZC 2N04A 2WLNA 3TGUH 4WFAV 2WLIB 1VQ7V 1Q3EA 1OCRB 2IJIA 2ZXWC 3ZMVA 4P9OA 2WLKA 4JI5B 2QJ1A 3OGIB 4DR2B 2ITDC 1FXKC 3K79A 2BCCH 4N23A 5CN0A 1XNRO 4WFEA 2GTSA 4FLWA 4ZIBA 2VQFO 3SGIA 2Y4UA 1AVMA 3BFRA 2XAFA 3AG2C 4LF4O 2YIDA 2Z5UA 2QKAA 1VF6C 2HVJC 4OPHA 4DV0O 1WP7A 4DR4O 2AZ2A 1EN6A 4TWKA 4JI4B 1CPYA 4LF5B 1XEQA 1XBLA 1H2SB 1AI7A 3E8HA 2DE0X 1J95A 2XAHA 1BCCH 4D7TA 4TQDA 2NNUA 4JAVA 3CS5A 3RGBA 1B6QA 2DYSB 1QHTA 5DECA 1F51A 2W0XA 3SYPA 4DW1A 4KXRA 4MTFA 3ZHUA 5IJ9A 2HHHB 1AI6A 5LMUO 1RSOB 3PJSK 5JVDA 3F5WC 3TXSA 4WCEV 3OFNG 2E5LB 5JCOC 3CE2A 1JX9A 1K7DA 5KHKA 3P3NA 4MTXA 3CMEV 1OV9A 4U3JB 3H01A 4GT1A 1E1QG 4K3AA 1BGYH 2AZ0A 1YTFD 2MW2B 2XUMA 4IHJB 5FLXN 1Y67A 2DYRB 4H44B 3ZCCA 1G1XB 2X6CA 1SQGA 1Y74A 2E75B 4HYOA 3SPGA 2AXTZ 4DR7B 3DGEA 1GK9A 3K0DA 3UKMA 2LFRA 3MHSC 4JAAA 5IYBO 2WSSG 5CA0A 4X1YA 2P90A 1S5JA 2IU0A 4A5UB 3E83A 2Y48A 1NS1A 4ASUG 2W6JG 2W6IG 4J41A 3G6EV 3JATB 4FM0A 1FXVA 4O4JA 2AHZA 2F66C 4DR6O 3FB5C 4FLXA 1SQQH 1J5EB 2JEXA 2EIMC 4DR5O 2JRIA 1P84F 1WPXA 3IGAC 3HKEB 1RSOA 3BVOA 2QDOA 4LF5O 1V55C 2Q67A 2PI5A 4FIPC 3K04A 2P4KA 4IYHA 4AQYO 2ZR3A 2V1DA 4GLXA 2YI9A 1SQVH 3HB3B 4CS2A 3G67A 1G4YB 2YXHA 1KMIZ 2P06A 4KHPB 2XNDG 4ZKIA 1V54C 3HKCA 3P32A 4JZ2A 1QVGU 2VQEB 5EC1C 5DM6V 4ZHQB 1EN5A 2OT5A 1R6TA 3K9AA 4TSFG 1S5LZ 1W59A 3ICXA 3ZRWB 3QNEA 4YHHO 3AG2B 1FXKA 1O9HA 4WFHA 3H1JH 3CCJV 3JAWB 2PYLA 1NTMH 1UPGA 1AROP 5IJ0B 4B3RO 3N2KB 3OMIB 4ZOLA 1SC5B 3ABMB 3T1YB 4DK1A 1AJPA 2PUSA 3D8CA 2A79B 3K3WA 4B3RB 1MG1A 1NT2B 2E76B 4LF7B 2FKXA 1SQBH 1AI4A 1NTZH 2AGAA 5GTHZ 3H1LH 2D2CB 2C2AA 1ZWIC 2X6AA 4LWSA 1JA8A 1Q6HA 3RBZA 4X65O 2VQEO 1PKXA 1DK1A 4DXWA 2EILB 2P67A 4MVMA 2IJJA 1XDCA 4DV7B 3HKDA 1YTFB 1W0JG 1MABG 3AG1B 2Q0OC 1HNXO 2GTAA 1NBMG 3RYHB 5L3FA 4BIZA 1H2MA 1NVPD 1WLEA 2CH7A 3JAWA 3QO8A 2P5OA 3C90A 4UB6Z 1F4NA 1H2GA 3BA8A 3CCVV 4TUYB 4E4EA 1KUQA 2QWOB 3OR6C 1PNKA 4I50A 4J7ZA 1J5EO 4JYBA 4RO2A 2UXCO 2B1IA 4NVPA 3ETGA 4QIWF 3GWKC 3DXRB 2VS0A 3KDRA 4DV4O 4O4JB 5J2TB 1P49A 1GO3F 2YXYA 2EINC 4WFFA 1WAZA 3K08A 4JPRA 1BHAA 2QM7A 3HPLC 3R66A 4I5SA 1L1FA 3CCRV 3RN4A 3UQ8A 3SYQA 3ZHRA 2YIBA 3RYFB 1ZX3A 1KU9A 2JJ1G 1OZ0A 3FAVA 2B1GA 3VQWA 2H8PC 1NH2B 4G28B 3ZHVA 3J80N 2WA3A 4AILC 2YICA 2GDSA 3C3TA 1XHXA 1XQ8A 3ABUA 4UCOA 3H9VA 5H6RA 2KKWA 4X89A 4GKKB 5JJEB 3AG4C 5KA5A 4KP4A 4HZ3A 4NXNO 4F6RA 1WB8A 1QVFU 1AP5A 1TUBB 4IYIA 5CMUA 3ZHQA 2UUAB 3RYCA 4O2AA 4I55B 4BR6A 1S76D 2Q73A 1ZL8A 1V55B 2Y4TA 5LMUB 1Y76A 3KG2A 1IBMO 1SZXA 1KQSU 2XASA 3E22B 2OIEA 2Y0PA 1R6NA 1QLEB 1PPJH 2UUBO 4P30A 1IDSA 2XOKG 5EBMC 4JV5B 5KHHA 3N2GA 1FS0G 3RW0A 3WB0A 1DF4A 4ZI7A 1KB9F 2DWEC 4NTYA 2EIJC 1E1RG 3O65A 4KL1A 1I94B 2NN4A 3UT5A 3B8MA 2BSKB 1QR8A 2GBOA 2Q6AA 3WFVA 5C8YA 3SJAC 3K5LA 3ABLB 2IH3C 4R50A 4O4LA 3JAKB 2QGNA 3MD0A 4FK5C 2RNBA 4J9YB 4J42A 3K5NA 3CXHF 4IGGA 1P7BA 3O9OA 4J7JA 3ABKB 1IX9A 4LF9O 4DR2O 1N4CA 1F4MA 1SS3A 3L9DA 2ODMA 3HKCB 2W0FC 5JQGA 4DV1B 4JTCB 4JI8O 3E89A 2EIKB 3JD0A 5LL6Y 4LP8A 1FJGO 1GH6A 4QGPA 1ZL8B 3AG1C 4B3TO 4W4KA 3ZS8C 4DRXA 1JR9A 5LXTB 2L6LA 1TUEB 4JASA 2F93B 1P4RA 4X1IB 3FYIB 1M9NA 4DV2O 4X9QA 1JJOA 3ZRSA 4K8ZA 5JJJB 4X64B 4DV5B 3H1KH 2ZR2A 5FL7G 3FB6C 1KYOF 4FLTA 1R6KA 4JI1O 1LUWA 1XNQB 3WB2A 4BAYA 2HJDA 2FMLA 2QR4A 1OCCB 4LFBO 5LGNA 1SRYA 3CRCA 3LSQA 2EILC 1YZBA 1HNWB 4DV2B 1XL6A 2IU3A 1Y4MA 3S3XA 1N32O 1EBOA 1JFFB 3ZHTA 4RQFA 2IBZH 4U3FH 3WU2Z 2WLMA 3E8GA 3TETA 1OHHG 2YIBD 5KHJA 2LP7A 3G80A 4K35A 1YVWA 2IJKA 1N33O 2DN9A 4JZGA 1HNZB 1JQ0A 2DYSC 1H8HG 1MNGA 4YXWG 2VRZA 3CHXA 1AILA 5JJNB 5CBHA 1JCHA 1ZLZA 4O2AB 1GAXA 1FD9A 1HW7A 5JH7A 2P4VA 5EYPB 1ZUQA 3K06A 1Q6UA 5LOVB 2N74A 4JI7O 1QCEA 5KA6A 4ZBMA 1RFYA 4H13B 2VWKA 4L8JA 2JDIG 5B5EZ 2Q68A 4X20B 3ETQA 3ASNB 1K34A 2UXDB 1VQOV 4TV8A 4XDKA 1Y6XA 1ZAUA 3UCSC 2ZD9A 4JI4O 3JD4A 4JYAB 3ZX6A 3FFQA 3WG7C 3AG4B 3CRAA 4B7KA 1K3EA 2CDYA 3L74H 5CA1A 2LW7A 3D3IA 1XHZA 1TAEA 4DK0A 1Z2GA 2CGNA 4L87A 3CD6V 3Q4HB 5EBWC 2GHYA 5LMNB 1XUQA 2QTSA 3FB7C 3UM7A 5HFMA 2WLLB 1VQMV 5E1AC 4NKGB 3RT3C 3OD4A 3LDDA 5EBLC 2PI4A 1TA8A 2R9RB 2DQ0A 4RUFA 5IT9N 2ZDIC 1VQ6V 4ZOLB 2JIZG 5LBQA 3ASOC 5LHHA 4O2BB 4DV3O 2CUGA 3IFXA 3LNMB 1BQ0A 1LR1A 5KAFZ 1W0KG 1SKVA 1WJZA 1I5XA 3ABKC 2CGOA 4O4HB 3DTUB 2CH7B 2M7WA 3JAMN 4U7OA 4LF8B 2G38A 1HNWO 2L35A 4PA9A 2NR5A 2DOSA 4WF9V 2F43G 3HKDB 3SYAA 1Q43A 1KP3A 4O4LB 1M90W 4F4LA 1HP8A 4CBCA 1YF2A 3A2FA 3T1YO 4QPJA 4MT8A 3SDLA 2LO1A 4JI6O 1MZFA 3ABLC 3G4SV 4JI0O 1Q5OA 5KUMA 3I56V 2ZIMA 4UFZA 3CMAV 4LFCB 2UUCB 4D7SA 1N8RW 2PYJA 3BEHA 5EK0A 4UXNA 4DV6B 2JVDA 2OIGA 1W2BU 4DV1O 4H0LB 2UUAO 1PD3A 2RQ6A 1PL4A 3CXCU 4UCSA 5BY1A 2YI8A 2QWPB 1S72V 1MA1A 1SQXH 3J7AU 1K5QA 2RN9A 4KHPO 3N2KA 5LHIA 1VQ8V 2PZSA 5B1BB 3L72H 3B77A 4FM1A 2A9HA 2ATKC 3RFRA 4U3JA 4DUZO 3U10A 4FFBB 2HVKC 4P9PA 1IXMA 2PF4E 3OTFA 1NTKH 3JALB 3HKEA 1K73W 3IAYA 3F7VC 4BIUA 2MK3A 1NH2D 2Q0AA 5JVDB 3ZN1A 1VF7A 1TVKA 1KKDA 2JGUA 1QLNA 3W7SA 2V7QG 2QE7G 5CA1B 1EN4A 3T4DA 3TCUA 4JI0B 1FOUA 1Q6IA 1I5YA 2F95B 1BHBA 4DW0A 1YXBA 4I4TB 3TXQA 5KX5B 1XMQB 4FM2A 5IYZB
chains in the Genus database with same CATH topology
1N0JA 3TJTA 1N0NA 3IC9A 1BT8A 2QKCA 1BS3A 3EVKA 1VARA 1GN4A 1I0HA 4YIPA 1LUVA 1GN3A 4JZGA 3KDRA 1MNGA 1XILA 1AP6A 4JZ2A 1ZLZA 1EN5A 1B06A 1ZUQA 1ZSPA 1GN6A 4GUNA 1BSMA 2AW9A 3RN4A 3OT7A 1IX9A 5A9GA 1MMMA 1GN2A 3DC6A 1Y67A 3AK3A 1P7GA 1PL4A 2ADPA 2GDSA 1MA1A 3C3TA 3MDSA 4F6EA 1D5NA 1JR9A 5AG2A 2CDYA 1AR5A 1I08A 1WB7A 1XREA 4X9QA 1AVMA 3AK1A 1IXBA 3BFRA 1AR4A 1WB8A 1AP5A 3DC5A 3C3SA 1KKCA 3LSUA 1PM9A 1XUQA 2RCVA 1JA8A 2QKAA 4YIOA 1QNMA 4BR6A 1LUWA 2CE4A 1EN4A 1XDCA 1EN6A 3AK2A 1MSDA 4C7UA 3CEIA 4FFKA 1SZXA 2ADQB 3KKYA 3K9SA 1ZTEA 4JYYA 3QVNA 1EM1A 2P4KA 1VEWA 4E4EA 1IDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0J A;  3TJT A;  1N0N A;  3IC9 A;  1BT8 A;  2QKC A;  1BS3 A;  3EVK A;  1VAR A;  1GN4 A;  1I0H A;  4YIP A;  1LUV A;  1GN3 A;  4JZG A;  1MNG A;  1XIL A;  1AP6 A;  4JZ2 A;  1ZLZ A;  1EN5 A;  1B06 A;  1ZUQ A;  1ZSP A;  1GN6 A;  4GUN A;  1BSM A;  2AW9 A;  3RN4 A;  3OT7 A;  1IX9 A;  5A9G A;  1MMM A;  1GN2 A;  3DC6 A;  1Y67 A;  3AK3 A;  1P7G A;  1PL4 A;  2ADP A;  2GDS A;  1MA1 A;  3C3T A;  3MDS A;  4F6E A;  1D5N A;  1JR9 A;  5AG2 A;  2CDY A;  1AR5 A;  1I08 A;  1WB7 A;  1XRE A;  4X9Q A;  1AVM A;  3AK1 A;  1IXB A;  3BFR A;  1AR4 A;  1WB8 A;  1AP5 A;  3DC5 A;  3C3S A;  1KKC A;  3LSU A;  1PM9 A;  1XUQ A;  2RCV A;  1JA8 A;  2QKA A;  4YIO A;  1QNM A;  4BR6 A;  1LUW A;  2CE4 A;  1EN4 A;  1XDC A;  1EN6 A;  3AK2 A;  1MSD A;  4C7U A;  3CEI A;  4FFK A;  1SZX A;  2ADQ B;  3KKY A;  3K9S A;  1ZTE A;  4JYY A;  3QVN A;  1EM1 A;  2P4K A;  1VEW A;  4E4E A;  1IDS A; 
#chains in the Genus database with same CATH topology
 1NJI W;  4J9Z B;  1Y76 B;  3CRR A;  4JAU A;  5KHI A;  4Z2W A;  4RAI A;  2KB1 A;  2V4D A;  4LNU B;  1K97 A;  1LUV A;  2N05 A;  1YEW A;  4G2K A;  1XIL A;  5EYP A;  3OW2 U;  2Q7H A;  1HNZ O;  1FFX B;  1HNX B;  1LNQ A;  2KG7 B;  4JTD B;  5GON A;  1COW G;  4RQE A;  5A9G A;  2YXL A;  3DC6 A;  4XDJ A;  5D5P A;  2VQF B;  1P7G A;  1FKA O;  4JI2 O;  3CYO A;  2EIM B;  3E8F A;  4GX2 A;  3FD9 A;  1PNM A;  3K58 A;  1G8M A;  3W7T A;  3RYH A;  3T1C A;  4MVR A;  3H1H H;  1IUR A;  5DED A;  3T1H O;  1YJN V;  4DV6 O;  2BOB C;  2PGG A;  2LQT A;  3CC2 V;  4FVM A;  5EZY B;  3CCE V;  2YDE A;  1H2L A;  2Z3Y A;  1KKC A;  4O4I B;  4B3S O;  2QWQ B;  4LF6 B;  3HKB B;  1TVK B;  3OMN B;  5L3D A;  2KQX A;  2HFE C;  2Q8V A;  3JAS A;  5A2Q N;  4IT5 A;  5B1N A;  2OCC B;  4YJ2 B;  1K92 A;  2A3Q A;  4DR3 B;  2OYQ A;  2QA4 V;  2DJV A;  1MOF A;  1M56 B;  4N21 A;  3SJQ C;  3CJH A;  2WLL A;  2BTQ B;  4LF9 B;  2PTM A;  1VP7 A;  4GX1 A;  4Q6G A;  2P7T C;  2QKC A;  2O57 A;  1BS3 A;  3JD3 A;  5BR8 O;  2ZDI A;  1VF6 A;  5CBG A;  1GN4 A;  2Y0I A;  2P22 C;  3AG7 A;  3T1H B;  1OCZ C;  3GVM A;  1M93 A;  2EBO A;  4PDM A;  2ZE6 A;  1I94 O;  4J80 A;  4JI3 B;  4EFB A;  1B06 A;  4DUY B;  3FAV B;  5EIB C;  1G6U A;  4UCU A;  4LFB B;  1GN6 A;  5GON B;  3ZJZ A;  1THZ A;  3LDE A;  4F6R B;  2Z0A A;  3JAR B;  4IIJ B;  1PP9 H;  4LF7 O;  2DMX A;  1AB3 A;  3AK3 A;  4O4H A;  2GUZ A;  2GV9 A;  1K5S A;  4HBN A;  4CH4 A;  4J7K A;  2EZO A;  3L70 H;  4F6E A;  5AG2 A;  5GTI Z;  3I5D A;  1XMO O;  3BHP A;  1DTO A;  1FJG B;  2WLI A;  5H9C A;  1N34 O;  4WBN B;  1OCZ B;  3CJH B;  1KEC A;  3K0G A;  2BOC C;  3DC5 A;  3UO3 A;  2XAG A;  2HG5 C;  1IVS A;  4GKK O;  5GW7 A;  2FL4 A;  1PV0 A;  4TQF A;  5B1A C;  1AR1 B;  3JAS B;  5KMG B;  1F23 A;  2LFS A;  4NXN B;  2ZT9 B;  1ENV A;  4MSW C;  4PA3 A;  2JEU A;  4W4L A;  3CB2 A;  1KP2 A;  5FNV B;  4TT3 G;  5CA0 B;  1URF A;  4PV1 B;  3OMA B;  1L0N H;  4X66 O;  2E74 B;  4O4I A;  1NVP B;  1SA0 A;  3KZI Z;  4YY3 B;  2X6B A;  2HHH O;  5LHG A;  3GWO A;  1N0N A;  3E2E A;  2QM4 A;  3EFF K;  1R3K C;  5BMV A;  1U96 A;  5L3G A;  4H37 A;  5IWA B;  4JYA O;  4GX0 A;  1F7Y A;  2FB5 A;  4LH6 A;  1N36 B;  1Q82 W;  2EX3 A;  4MW3 A;  3G71 V;  4FLZ A;  5CA3 A;  5LGT A;  2ARH A;  3APO A;  5JQG B;  3VQV A;  3P30 A;  1WN7 A;  1GKF A;  4GUN A;  1BSM A;  3E35 A;  1L8D A;  2YSU B;  2Q69 A;  4IIJ A;  4WBN A;  3KCY A;  1MMM A;  2WPD G;  2XAQ A;  3S3W A;  2GSM B;  4J10 A;  4CS3 A;  1Y66 A;  2HR3 A;  1Z5V A;  4B08 A;  5KLV H;  3T2M A;  2CAZ C;  4LFA B;  3K5M A;  3QTC A;  3OR7 C;  3AEI A;  3MDS A;  3JAR A;  3RVY A;  3CSX A;  3EXA A;  4X65 B;  1JFF A;  1M56 C;  1U97 A;  2CTW A;  2QTO A;  1AR4 A;  2RMK B;  3F7Y C;  4DV7 O;  1IBK B;  5LA6 B;  1M1K W;  4DR1 O;  1AI5 A;  2Y69 C;  4ICG A;  4EEQ A;  5H6Q A;  5E79 Z;  3CC4 V;  1QNM A;  3ETE A;  1V9P A;  3A0H Z;  3AK2 A;  3U0Z A;  1KD1 W;  3SYO A;  4GYC B;  1KC8 W;  1R73 A;  2YEV B;  3RYI B;  4EFE A;  4DYL A;  1QQC A;  3QVN A;  4K8X A;  3VQY A;  3LUT B;  4X1K A;  4LBE C;  4DR3 O;  1IBL O;  5HFL A;  3SJB C;  5IYD O;  3CCS V;  2PY5 A;  1HWY A;  4LF8 O;  1JOY A;  3IC9 A;  4LCU C;  4PA4 A;  4O2B A;  5ITZ B;  3B40 A;  1WA8 A;  2A7W A;  4IL6 Z;  5LP6 C;  1DLB A;  3MAQ A;  2P6J A;  1YHQ V;  1SF9 A;  4QE7 A;  3T4Z A;  2JGD A;  2LGW A;  1UJW B;  5LA6 A;  4JV5 O;  4FMT A;  1US6 A;  3CPW U;  5IWA O;  1GM9 A;  4X62 B;  1XI1 A;  5JCO A;  1Q86 W;  1ZSP A;  1X4T A;  2ZIO A;  2ITC C;  2Q5Z A;  4X1Y B;  2K1E A;  3RVZ A;  2OCH A;  3SR2 C;  3OUS A;  3APQ A;  4B7E A;  1SZT A;  3VBB A;  1OCO C;  1RM1 C;  2B9Z A;  1YJW V;  4I9Q A;  5EC2 C;  1FXH A;  1Q90 D;  4FZ0 A;  3SPH A;  5BMV B;  3FB8 C;  3G6B A;  5LYJ A;  1FYJ A;  3CRM A;  1CXZ B;  4OX9 B;  3STL C;  1N33 B;  4FLV A;  2H3O A;  3OAA G;  2HLD G;  2ILM A;  4QNH B;  2BTQ A;  2ZE5 A;  3K57 A;  1MZE A;  1I7F A;  4GKJ B;  5J2T A;  4PDR A;  5B1B C;  4JI1 B;  3THO A;  1YI2 V;  1VQ9 V;  4UV8 A;  4FFB A;  1JNB A;  4MVU A;  1QU7 A;  4YHH B;  4ZHQ A;  1NQT A;  4JI7 B;  2JK5 C;  1MSD A;  5B1A B;  1AJN A;  3UT5 B;  4TOI A;  3CC7 V;  1VQK V;  2ADQ B;  1VF5 B;  2F1M A;  1QR9 A;  4JYY A;  3ZMS A;  3CCM V;  1GRJ A;  5JWP A;  4DR7 O;  3ZED A;  3D3Q A;  2DW4 A;  4X88 A;  1ORQ C;  2WLH A;  3D36 A;  5BR8 B;  1XNR B;  4JI3 O;  4NB5 A;  5B66 Z;  1PNL A;  4TV9 B;  3A0R A;  1R3L C;  2CK3 G;  2HJF C;  3OTO B;  1BQZ A;  1K8A W;  4UVA A;  4X20 A;  1AP6 A;  4JYC A;  2BE3 A;  4FJC C;  3BPZ A;  4B3M O;  4UCR A;  1VQ4 V;  3ETD A;  4PEL A;  4P2Z A;  1S0V A;  3PN1 A;  4H33 A;  3N2G B;  4PI2 A;  1TGO A;  3K59 A;  2E3C A;  4X1K B;  4X64 O;  4DV5 O;  1GM7 A;  2EUL A;  3B2E E;  4U7N A;  1M4U A;  2WAM A;  1Q81 W;  1E79 G;  2RJZ A;  4UVB A;  2UUC O;  4LFC O;  4DR4 B;  3ZRW A;  5L3E A;  5KUK A;  3JAK A;  4I55 A;  5H5N A;  2ZM6 O;  3CRQ A;  4JI6 B;  1D2D A;  5FPO A;  4RWU A;  5C93 A;  4AI8 A;  4UCT A;  3RYF A;  2FTK A;  1K4C C;  2BSK A;  1FPO A;  4FLU A;  1N36 O;  2XAJ A;  3LSS A;  3SPI A;  3LSU A;  1Z5W A;  2RCV A;  3NR7 A;  3LNN A;  1IBL B;  4YIO A;  2Y69 B;  4D6T H;  3UO2 A;  2JS3 A;  5J2U B;  2Q7E A;  3A8T A;  4PDL A;  1A32 A;  1S77 D;  2UU9 B;  3CEI A;  3R65 A;  4JF3 A;  3NXS A;  3ML0 A;  2X7R B;  5LMN O;  1TUB A;  4FZ1 A;  5L3C A;  2XTA A;  4LR3 A;  4CC5 A;  2UXX A;  1GMG A;  2OCC C;  2YUA A;  1H2N A;  3AG3 C;  2ZQM A;  4AQY B;  2K9P A;  4DRX B;  4JI5 O;  1CP9 A;  3B4S A;  1VAR A;  1NR1 A;  2B5U A;  1Q8I A;  5D5Q A;  4NXM B;  4MVO A;  1NU1 H;  1B04 A;  4CS4 A;  1SQF A;  2EIJ B;  1ROP A;  1VIB A;  3QG5 A;  1IBM B;  4XDL A;  2HP8 A;  1OCR C;  4DR6 B;  2ZXW B;  1M5I A;  2ZNJ A;  3OM3 B;  5LP6 A;  5B3S C;  4DV4 B;  1SA0 B;  4OPA A;  1YCI A;  3OT7 A;  5BXZ A;  2VWJ A;  4XBF A;  2X0L A;  4CC6 A;  2UXC B;  1XMQ O;  4TV9 A;  1VQN V;  1XNQ O;  1SET A;  3WB1 A;  4TUY A;  3JSN A;  3M7M X;  2ADP A;  1RM1 B;  2Q9L A;  2ZKO A;  5J2U A;  2QSA A;  4PA6 A;  2YEV A;  3RYI A;  4HNA B;  3FKS G;  4ZI7 B;  2CTR A;  2WLJ A;  4UCV A;  5LOV A;  1YIJ V;  2EIK C;  2JGD B;  2JS5 A;  2OTJ V;  1YIT V;  4I7Z B;  3C3S A;  1BMF G;  1B3Q A;  1NZ6 A;  4X66 B;  1RPR A;  3JAL A;  2WA4 A;  4EKW A;  4E2L A;  3CCL V;  4DV3 B;  3BY6 A;  2NLJ C;  2F4V B;  1FFT B;  3ABM C;  4DR5 B;  3B09 A;  4LFA O;  1S5H C;  4C7U A;  1YDX A;  1OJH A;  1VQL V;  3KKY A;  3GB7 C;  4R8C A;  1R3I C;  4QJF B;  1K4D C;  4GCZ A;  3B8N A;  3VQX A;  3OGC C;  2F23 A;  4B3T B;  3BAA A;  4UUJ C;  3SPC A;  2D3O W;  4PA7 A;  3QF7 A;  1GN3 A;  2GUZ B;  4Z1V A;  1AJQ A;  2ZE7 A;  3ABT A;  4OGQ B;  2EZP A;  4QPK A;  3VOU A;  5EIB D;  1YSC A;  4OX9 O;  5IYC O;  2UXN A;  5H2F Z;  4PJ0 Z;  1D5A A;  1BL8 A;  1X59 A;  2AW9 A;  2F4V O;  4NXM O;  4MVZ A;  4UVC A;  1NKD A;  3E8B A;  3BRC A;  4JI2 B;  2H94 A;  4CH6 A;  4BWA A;  4NTX A;  3ZRV A;  5IY5 C;  3OEH G;  1HR0 O;  3E86 A;  4GX5 A;  5ITZ A;  1JVM A;  3J81 N;  5K1P A;  2ZNI A;  1HR0 B;  2EIN B;  1M57 C;  3SYC A;  1EZJ A;  2ZE8 A;  1DGS A;  2XT9 A;  3JCZ A;  3AK1 A;  4I0X B;  4LC1 A;  1EZV H;  4MVS A;  1SES A;  1FAF A;  4X62 O;  2DWD C;  2HEP A;  2Q7G A;  1L0L H;  5JH7 B;  4HAM A;  5LXT A;  2CTP A;  3ZMT A;  2A06 H;  4FFK A;  4I0X A;  3LDC A;  1VQP V;  1H38 A;  5LGU A;  1IJG A;  3K9S A;  1ZTE A;  3CX5 F;  3JYC A;  4BW9 A;  1YJ9 V;  3M8A A;  4FPP A;  1EM1 A;  2EJ7 A;  1WPB A;  1VEW A;  3SPJ A;  2QM8 A;  4BIO A;  4MS2 A;  4KFM A;  5B3S B;  2AHY A;  1N0J A;  4GKJ O;  1BT8 A;  3ASO B;  1BE3 H;  3AG3 B;  1EFR G;  3QO7 A;  3U11 A;  4DUY O;  1M57 B;  3FX7 A;  4I9W A;  2WWW A;  5B1O A;  1H5W A;  1I0H A;  4WFG A;  1QBZ A;  5L3B A;  3ZN0 A;  1Y74 B;  2DQ3 A;  4PI0 A;  3BCC H;  4G27 B;  3P3P A;  2YS8 A;  1IBK O;  1K9M W;  1Q7Y W;  5DN6 G;  1N32 B;  3JCU Z;  3I55 V;  4DUZ B;  5LP6 B;  3X2Q B;  4Q20 A;  4ABM A;  1BZK A;  2QWR B;  3ZMU A;  3JAT A;  1PL0 A;  5KHG A;  2IJH A;  4K0K B;  3SJC C;  1GN2 A;  3HR0 A;  4UV9 A;  3TK1 A;  2CTQ A;  3BA9 A;  4PDV A;  3RWR D;  3W7W A;  3OUF A;  2FYU H;  2QEX V;  1GTO A;  2ZM6 B;  3KCX A;  1VMG A;  2BTO A;  3DXR A;  4YJ2 A;  4MTG A;  1AR5 A;  1WB7 A;  1MSW D;  4MW8 A;  1UFI A;  2R72 A;  1XMO B;  2R70 A;  4NTW A;  4JI8 B;  4J11 A;  3EHB B;  4DV0 B;  1PM9 A;  4MTO A;  3IJ4 A;  4FLY A;  4X8A A;  4MVQ A;  5F2V O;  1SQP H;  4HNA A;  4LF4 B;  1R1B A;  4LWS B;  1RP3 B;  3OEE G;  1NR7 A;  4KUM A;  4B3M B;  1JMK C;  1R3J C;  5KX5 A;  4LNU A;  5KAI Z;  5IJ9 B;  4LH7 A;  3ZBH A;  5CB4 A;  3OTO O;  3IC7 A;  4I50 B;  5EZY A;  3K03 A;  2ZCE A;  5CB4 B;  5FPR A;  1S3J A;  2R9I A;  1H8E G;  3TJT A;  5IYZ A;  4CZZ A;  4NR1 A;  2ETN A;  3EVK A;  4R7C A;  3MHH C;  4JTA B;  2LW1 A;  4YIP A;  1O9G A;  5IY5 B;  4EB6 B;  4AHC A;  2R9A A;  3CWB H;  1JJ2 U;  2IM9 A;  1FFX A;  1XL4 A;  4Z1M G;  1HDJ A;  3ZMZ A;  4PD4 F;  5BZB A;  3K5O A;  2ZIN A;  3ZRX A;  5IJ0 A;  2Q4P A;  2IW5 A;  2KG7 A;  2DYR C;  1WA8 B;  2KSD A;  3CP1 A;  2UXD O;  3CCQ V;  2LGQ A;  1CEZ A;  1RPO A;  2OTL V;  5FNV A;  2QKS A;  1QLE C;  3W7X A;  2UXB O;  2YIA A;  4WFB V;  3JD1 A;  5IE9 A;  2JJ2 G;  1K33 A;  5KMG A;  1GM8 A;  3JSL A;  1SER A;  1D5N A;  3F5T A;  2QWN B;  1I08 A;  1H2K A;  1XRE A;  3L73 H;  4OXS A;  2RDC A;  4R6Z A;  1IXB A;  2M6Y A;  3H1I H;  1XOU A;  3L75 H;  5TIS Z;  4CH3 A;  5K1X A;  4YY3 O;  2OWO A;  2XHB A;  3OE7 G;  4YJ3 A;  3ASN C;  3BAB A;  2UU9 O;  4DR1 B;  4BW5 A;  4CH5 A;  3N27 A;  2CE4 A;  3CCU V;  1DF5 A;  4DO2 A;  4EB6 A;  3RYC B;  4GZR B;  3Q4H A;  3WG7 B;  1IZ3 A;  3JD2 A;  4TV8 B;  5LYJ B;  4PHZ A;  3D36 C;  3DSQ A;  4I4T A;  5J9P C;  1T5E A;  1WNS A;  3QO5 A;  4X1I A;  3X2Q C;  4IHJ A;  4NYK A;  1JPX A;  2A0L A;  1FXK B;  4JGS A;  4UB8 Z;  3HKB A;  3E22 A;  2E5L O;  2UXB B;  1NI8 A;  1N34 B;  5CBF A;  1OCO B;  4LF6 O;  5C8Y B;  3L71 H;  1V54 B;  2HKO A;  3ZIA G;  2YC0 A;  1VQ5 V;  2IH1 C;  2LJ2 A;  1WP8 A;  2UUB B;  4YJ3 B;  1KBH A;  4B3S B;  3ZHS A;  2EJR A;  4K0K O;  3FYE B;  4QE9 A;  3W7U A;  3M99 B;  5IDJ A;  4RUE A;  1OCC C;  3A0B Z;  3STZ C;  2N04 A;  2WLN A;  3TGU H;  4WFA V;  2WLI B;  1VQ7 V;  1Q3E A;  1OCR B;  2IJI A;  2ZXW C;  3ZMV A;  4P9O A;  2WLK A;  4JI5 B;  2QJ1 A;  3OGI B;  4DR2 B;  2ITD C;  1FXK C;  3K79 A;  2BCC H;  4N23 A;  5CN0 A;  1XNR O;  4WFE A;  2GTS A;  4FLW A;  4ZIB A;  2VQF O;  3SGI A;  2Y4U A;  1AVM A;  3BFR A;  2XAF A;  3AG2 C;  4LF4 O;  2YID A;  2Z5U A;  2QKA A;  1VF6 C;  2HVJ C;  4OPH A;  4DV0 O;  1WP7 A;  4DR4 O;  2AZ2 A;  1EN6 A;  4TWK A;  4JI4 B;  1CPY A;  4LF5 B;  1XEQ A;  1XBL A;  1H2S B;  1AI7 A;  3E8H A;  2DE0 X;  1J95 A;  2XAH A;  1BCC H;  4D7T A;  4TQD A;  2NNU A;  4JAV A;  3CS5 A;  3RGB A;  1B6Q A;  2DYS B;  1QHT A;  5DEC A;  1F51 A;  2W0X A;  3SYP A;  4DW1 A;  4KXR A;  4MTF A;  3ZHU A;  5IJ9 A;  2HHH B;  1AI6 A;  5LMU O;  1RSO B;  3PJS K;  5JVD A;  3F5W C;  3TXS A;  4WCE V;  3OFN G;  2E5L B;  5JCO C;  3CE2 A;  1JX9 A;  1K7D A;  5KHK A;  3P3N A;  4MTX A;  3CME V;  1OV9 A;  4U3J B;  3H01 A;  4GT1 A;  1E1Q G;  4K3A A;  1BGY H;  2AZ0 A;  1YTF D;  2MW2 B;  2XUM A;  4IHJ B;  5FLX N;  1Y67 A;  2DYR B;  4H44 B;  3ZCC A;  1G1X B;  2X6C A;  1SQG A;  1Y74 A;  2E75 B;  4HYO A;  3SPG A;  2AXT Z;  4DR7 B;  3DGE A;  1GK9 A;  3K0D A;  3UKM A;  2LFR A;  3MHS C;  4JAA A;  5IYB O;  2WSS G;  5CA0 A;  4X1Y A;  2P90 A;  1S5J A;  2IU0 A;  4A5U B;  3E83 A;  2Y48 A;  1NS1 A;  4ASU G;  2W6J G;  2W6I G;  4J41 A;  3G6E V;  3JAT B;  4FM0 A;  1FXV A;  4O4J A;  2AHZ A;  2F66 C;  4DR6 O;  3FB5 C;  4FLX A;  1SQQ H;  1J5E B;  2JEX A;  2EIM C;  4DR5 O;  2JRI A;  1P84 F;  1WPX A;  3IGA C;  3HKE B;  1RSO A;  3BVO A;  2QDO A;  4LF5 O;  1V55 C;  2Q67 A;  2PI5 A;  4FIP C;  3K04 A;  2P4K A;  4IYH A;  4AQY O;  2ZR3 A;  2V1D A;  4GLX A;  2YI9 A;  1SQV H;  3HB3 B;  4CS2 A;  3G67 A;  1G4Y B;  2YXH A;  1KMI Z;  2P06 A;  4KHP B;  2XND G;  4ZKI A;  1V54 C;  3HKC A;  3P32 A;  4JZ2 A;  1QVG U;  2VQE B;  5EC1 C;  5DM6 V;  4ZHQ B;  1EN5 A;  2OT5 A;  1R6T A;  3K9A A;  4TSF G;  1S5L Z;  1W59 A;  3ICX A;  3ZRW B;  3QNE A;  4YHH O;  3AG2 B;  1FXK A;  1O9H A;  4WFH A;  3H1J H;  3CCJ V;  3JAW B;  2PYL A;  1NTM H;  1UPG A;  1ARO P;  5IJ0 B;  4B3R O;  3N2K B;  3OMI B;  4ZOL A;  1SC5 B;  3ABM B;  3T1Y B;  4DK1 A;  1AJP A;  2PUS A;  3D8C A;  2A79 B;  3K3W A;  4B3R B;  1MG1 A;  1NT2 B;  2E76 B;  4LF7 B;  2FKX A;  1SQB H;  1AI4 A;  1NTZ H;  2AGA A;  5GTH Z;  3H1L H;  2D2C B;  2C2A A;  1ZWI C;  2X6A A;  4LWS A;  1JA8 A;  1Q6H A;  3RBZ A;  4X65 O;  2VQE O;  1PKX A;  1DK1 A;  4DXW A;  2EIL B;  2P67 A;  4MVM A;  2IJJ A;  1XDC A;  4DV7 B;  3HKD A;  1YTF B;  1W0J G;  1MAB G;  3AG1 B;  2Q0O C;  1HNX O;  2GTA A;  1NBM G;  3RYH B;  5L3F A;  4BIZ A;  1H2M A;  1NVP D;  1WLE A;  2CH7 A;  3JAW A;  3QO8 A;  2P5O A;  3C90 A;  4UB6 Z;  1F4N A;  1H2G A;  3BA8 A;  3CCV V;  4TUY B;  4E4E A;  1KUQ A;  2QWO B;  3OR6 C;  1PNK A;  4I50 A;  4J7Z A;  1J5E O;  4JYB A;  4RO2 A;  2UXC O;  2B1I A;  4NVP A;  3ETG A;  4QIW F;  3GWK C;  3DXR B;  2VS0 A;  3KDR A;  4DV4 O;  4O4J B;  5J2T B;  1P49 A;  1GO3 F;  2YXY A;  2EIN C;  4WFF A;  1WAZ A;  3K08 A;  4JPR A;  1BHA A;  2QM7 A;  3HPL C;  3R66 A;  4I5S A;  1L1F A;  3CCR V;  3RN4 A;  3UQ8 A;  3SYQ A;  3ZHR A;  2YIB A;  3RYF B;  1ZX3 A;  1KU9 A;  2JJ1 G;  1OZ0 A;  3FAV A;  2B1G A;  3VQW A;  2H8P C;  1NH2 B;  4G28 B;  3ZHV A;  3J80 N;  2WA3 A;  4AIL C;  2YIC A;  2GDS A;  3C3T A;  1XHX A;  1XQ8 A;  3ABU A;  4UCO A;  3H9V A;  5H6R A;  2KKW A;  4X89 A;  4GKK B;  5JJE B;  3AG4 C;  5KA5 A;  4KP4 A;  4HZ3 A;  4NXN O;  4F6R A;  1WB8 A;  1QVF U;  1AP5 A;  1TUB B;  4IYI A;  5CMU A;  3ZHQ A;  2UUA B;  3RYC A;  4O2A A;  4I55 B;  4BR6 A;  1S76 D;  2Q73 A;  1ZL8 A;  1V55 B;  2Y4T A;  5LMU B;  1Y76 A;  3KG2 A;  1IBM O;  1SZX A;  1KQS U;  2XAS A;  3E22 B;  2OIE A;  2Y0P A;  1R6N A;  1QLE B;  1PPJ H;  2UUB O;  4P30 A;  1IDS A;  2XOK G;  5EBM C;  4JV5 B;  5KHH A;  3N2G A;  1FS0 G;  3RW0 A;  3WB0 A;  1DF4 A;  4ZI7 A;  1KB9 F;  2DWE C;  4NTY A;  2EIJ C;  1E1R G;  3O65 A;  4KL1 A;  1I94 B;  2NN4 A;  3UT5 A;  3B8M A;  2BSK B;  1QR8 A;  2GBO A;  2Q6A A;  3WFV A;  5C8Y A;  3SJA C;  3K5L A;  3ABL B;  2IH3 C;  4R50 A;  4O4L A;  3JAK B;  2QGN A;  3MD0 A;  4FK5 C;  2RNB A;  4J9Y B;  4J42 A;  3K5N A;  3CXH F;  4IGG A;  1P7B A;  3O9O A;  4J7J A;  3ABK B;  1IX9 A;  4LF9 O;  4DR2 O;  1N4C A;  1F4M A;  1SS3 A;  3L9D A;  2ODM A;  3HKC B;  2W0F C;  5JQG A;  4DV1 B;  4JTC B;  4JI8 O;  3E89 A;  2EIK B;  3JD0 A;  5LL6 Y;  4LP8 A;  1FJG O;  1GH6 A;  4QGP A;  1ZL8 B;  3AG1 C;  4B3T O;  4W4K A;  3ZS8 C;  4DRX A;  1JR9 A;  5LXT B;  2L6L A;  1TUE B;  4JAS A;  2F93 B;  1P4R A;  4X1I B;  3FYI B;  1M9N A;  4DV2 O;  4X9Q A;  1JJO A;  3ZRS A;  4K8Z A;  5JJJ B;  4X64 B;  4DV5 B;  3H1K H;  2ZR2 A;  5FL7 G;  3FB6 C;  1KYO F;  4FLT A;  1R6K A;  4JI1 O;  1LUW A;  1XNQ B;  3WB2 A;  4BAY A;  2HJD A;  2FML A;  2QR4 A;  1OCC B;  4LFB O;  5LGN A;  1SRY A;  3CRC A;  3LSQ A;  2EIL C;  1YZB A;  1HNW B;  4DV2 B;  1XL6 A;  2IU3 A;  1Y4M A;  3S3X A;  1N32 O;  1EBO A;  1JFF B;  3ZHT A;  4RQF A;  2IBZ H;  4U3F H;  3WU2 Z;  2WLM A;  3E8G A;  3TET A;  1OHH G;  2YIB D;  5KHJ A;  2LP7 A;  3G80 A;  4K35 A;  1YVW A;  2IJK A;  1N33 O;  2DN9 A;  4JZG A;  1HNZ B;  1JQ0 A;  2DYS C;  1H8H G;  1MNG A;  4YXW G;  2VRZ A;  3CHX A;  1AIL A;  5JJN B;  5CBH A;  1JCH A;  1ZLZ A;  4O2A B;  1GAX A;  1FD9 A;  1HW7 A;  5JH7 A;  2P4V A;  5EYP B;  1ZUQ A;  3K06 A;  1Q6U A;  5LOV B;  2N74 A;  4JI7 O;  1QCE A;  5KA6 A;  4ZBM A;  1RFY A;  4H13 B;  2VWK A;  4L8J A;  2JDI G;  5B5E Z;  2Q68 A;  4X20 B;  3ETQ A;  3ASN B;  1K34 A;  2UXD B;  1VQO V;  4TV8 A;  4XDK A;  1Y6X A;  1ZAU A;  3UCS C;  2ZD9 A;  4JI4 O;  3JD4 A;  4JYA B;  3ZX6 A;  3FFQ A;  3WG7 C;  3AG4 B;  3CRA A;  4B7K A;  1K3E A;  2CDY A;  3L74 H;  5CA1 A;  2LW7 A;  3D3I A;  1XHZ A;  1TAE A;  4DK0 A;  1Z2G A;  2CGN A;  4L87 A;  3CD6 V;  3Q4H B;  5EBW C;  2GHY A;  5LMN B;  1XUQ A;  2QTS A;  3FB7 C;  3UM7 A;  5HFM A;  2WLL B;  1VQM V;  5E1A C;  4NKG B;  3RT3 C;  3OD4 A;  3LDD A;  5EBL C;  2PI4 A;  1TA8 A;  2R9R B;  2DQ0 A;  4RUF A;  5IT9 N;  2ZDI C;  1VQ6 V;  4ZOL B;  2JIZ G;  5LBQ A;  3ASO C;  5LHH A;  4O2B B;  4DV3 O;  2CUG A;  3IFX A;  3LNM B;  1BQ0 A;  1LR1 A;  5KAF Z;  1W0K G;  1SKV A;  1WJZ A;  1I5X A;  3ABK C;  2CGO A;  4O4H B;  3DTU B;  2CH7 B;  2M7W A;  3JAM N;  4U7O A;  4LF8 B;  2G38 A;  1HNW O;  2L35 A;  4PA9 A;  2NR5 A;  2DOS A;  4WF9 V;  2F43 G;  3HKD B;  3SYA A;  1Q43 A;  1KP3 A;  4O4L B;  1M90 W;  4F4L A;  1HP8 A;  4CBC A;  1YF2 A;  3A2F A;  3T1Y O;  4QPJ A;  4MT8 A;  3SDL A;  2LO1 A;  4JI6 O;  1MZF A;  3ABL C;  3G4S V;  4JI0 O;  1Q5O A;  5KUM A;  3I56 V;  2ZIM A;  4UFZ A;  3CMA V;  4LFC B;  2UUC B;  4D7S A;  1N8R W;  2PYJ A;  3BEH A;  5EK0 A;  4UXN A;  4DV6 B;  2JVD A;  2OIG A;  1W2B U;  4DV1 O;  4H0L B;  2UUA O;  1PD3 A;  2RQ6 A;  1PL4 A;  3CXC U;  4UCS A;  5BY1 A;  2YI8 A;  2QWP B;  1S72 V;  1MA1 A;  1SQX H;  3J7A U;  1K5Q A;  2RN9 A;  4KHP O;  3N2K A;  5LHI A;  1VQ8 V;  2PZS A;  5B1B B;  3L72 H;  3B77 A;  4FM1 A;  2A9H A;  2ATK C;  3RFR A;  4U3J A;  4DUZ O;  3U10 A;  4FFB B;  2HVK C;  4P9P A;  1IXM A;  2PF4 E;  3OTF A;  1NTK H;  3JAL B;  3HKE A;  1K73 W;  3IAY A;  3F7V C;  4BIU A;  2MK3 A;  1NH2 D;  2Q0A A;  5JVD B;  3ZN1 A;  1VF7 A;  1TVK A;  1KKD A;  2JGU A;  1QLN A;  3W7S A;  2V7Q G;  2QE7 G;  5CA1 B;  1EN4 A;  3T4D A;  3TCU A;  4JI0 B;  1FOU A;  1Q6I A;  1I5Y A;  2F95 B;  1BHB A;  4DW0 A;  1YXB A;  4I4T B;  3TXQ A;  5KX5 B;  1XMQ B;  4FM2 A;  5IYZ B; 
#chains in the Genus database with same CATH homology
 1N0J A;  3TJT A;  1N0N A;  3IC9 A;  1BT8 A;  2QKC A;  1BS3 A;  3EVK A;  1VAR A;  1GN4 A;  1I0H A;  4YIP A;  1LUV A;  1GN3 A;  4JZG A;  3KDR A;  1MNG A;  1XIL A;  1AP6 A;  4JZ2 A;  1ZLZ A;  1EN5 A;  1B06 A;  1ZUQ A;  1ZSP A;  1GN6 A;  4GUN A;  1BSM A;  2AW9 A;  3RN4 A;  3OT7 A;  1IX9 A;  5A9G A;  1MMM A;  1GN2 A;  3DC6 A;  1Y67 A;  3AK3 A;  1P7G A;  1PL4 A;  2ADP A;  2GDS A;  1MA1 A;  3C3T A;  3MDS A;  4F6E A;  1D5N A;  1JR9 A;  5AG2 A;  2CDY A;  1AR5 A;  1I08 A;  1WB7 A;  1XRE A;  4X9Q A;  1AVM A;  3AK1 A;  1IXB A;  3BFR A;  1AR4 A;  1WB8 A;  1AP5 A;  3DC5 A;  3C3S A;  1KKC A;  3LSU A;  1PM9 A;  1XUQ A;  2RCV A;  1JA8 A;  2QKA A;  4YIO A;  1QNM A;  4BR6 A;  1LUW A;  2CE4 A;  1EN4 A;  1XDC A;  1EN6 A;  3AK2 A;  1MSD A;  4C7U A;  3CEI A;  4FFK A;  1SZX A;  2ADQ B;  3KKY A;  3K9S A;  1ZTE A;  4JYY A;  3QVN A;  1EM1 A;  2P4K A;  1VEW A;  4E4E A;  1IDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...