1MMMA

Distinct metal environment in iron-substituted manganese superoxide dismutase provides a structural basis of metal specificity
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (IRON-SUBSTITUTED MANGANESE SUPEROXIDE DISMUTASE)
publication title Distinct Metal Environment in Fe-Substituted Manganese Superoxide Dismutase Provides a Structural Basis of Metal Specificity
pubmed rcsb
total genus 76
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1mmmA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1mmmA02
1JR9A 1MNGA 1P7GA 3IC9A 1BSMA 1JA8A 1BT8A 1ZLZA 1EN5A 3KKYA 3QVNA 1KKCA 1LUWA 1ZUQA 4X9QA 1I08A 1N0JA 3RN4A 1MMMA 3DC6A 1Y67A 2RCVA 1ZTEA 1WB7A 3OT7A 1EN4A 1PM9A 1MSDA 1XUQA 1IX9A 2AW9A 4JZ2A 4GUNA 1I0HA 1XREA 1D5NA 1AR4A 3CEIA 1N0NA 2CE4A 3DC5A 1EN6A 1GN2A 2QKCA 2P4KA 3AK1A 3BFRA 1BS3A 3AK2A 1MA1A 1GN4A 3EVKA 1PL4A 3MDSA 1AP5A 5A9GA 2CDYA 3LSUA 4JYYA 3K9SA 1XDCA 4E4EA 1EM1A 3TJTA 1B06A 4YIPA 4C7UA 1AP6A 2ADQB 3C3SA 1IDSA 1ZSPA 1SZXA 1VARA 4BR6A 1QNMA 1AVMA 1AR5A 4F6EA 1GN6A 4YIOA 2GDSA 1XILA 2ADPA 5AG2A 1LUVA 3C3TA 1GN3A 4FFKA 4JZGA 1IXBA 1WB8A 2QKAA 1VEWA 3AK3A
chains in the Genus database with same CATH superfamily
1KYOF 1AB3A 2W6JG 1Q81W 5IE9A 1G8MA 1TVKB 3ZRXA 3ZX6A 4X89A 1K33A 2OIGA 3J81N 3A8TA 5KHKA 4JI3B 3HB3B 1LUWA 1I08A 1TVKA 3RGBA 4PDRA 2HVJC 2Q6AA 4TV8B 2JEUA 1H2KA 3RYCB 2CGNA 3CCQV 4TV8A 1JOYA 3BPZA 2F95B 2PTMA 5LGTA 2WWWA 3CD6V 5TISZ 4GKJB 3RYCA 3K9AA 2IU3A 4JYBA 3JSLA 3ABKB 3KG2A 3MHSC 5KUKA 2HJFC 4JTCB 4UFZA 3WG7B 2X0LA 1N0NA 4LF9O 1JCHA 2P4KA 1I94O 3ZMTA 4QPJA 4LFCO 5LMUB 5E79Z 1N36O 5GTIZ 2DW4A 1AI6A 4JI2O 3VQVA 4OPHA 3ABLB 4DV4B 5LXTA 1O9GA 4JI7B 1JQ0A 4RUFA 3D36C 3K5NA 1QBZA 1B06A 4PDVA 4I9WA 2LFSA 2OCCB 1N34O 2YI9A 5JJEB 1ROPA 4EFEA 2DYSB 5B1AC 1SZXA 1XQ8A 2B5UA 3E8HA 5EK0A 1L0NH 4FFBB 2RNBA 3A0RA 4EEQA 1M57C 2N05A 1XILA 1HNZO 2WA4A 4WFFA 1NVPD 4LF5B 5JQGB 4FFBA 1IURA 1WB8A 1WPBA 3H9VA 2IJKA 1VQ7V 5F2VO 1N32B 2ZDIA 3E86A 1XNQB 2ZNJA 4QIWF 2F4VB 5JQGA 1JR9A 2PF4E 5B66Z 4GKKO 1IBMB 2ZIOA 5L3EA 5B1NA 1XOUA 2KSDA 2HHHB 3CC2V 3RYFB 1WN7A 2XUMA 3OW2U 3ZRVA 1THZA 4RWUA 1YF2A 5CA3A 5JWPA 1ZTEA 1K34A 4J7KA 3RYFA 3RT3C 3CCUV 2RMKB 1SQPH 4GLXA 4K8ZA 1NR1A 2Q7HA 1IX9A 1F23A 4U3FH 3RYIA 1Y66A 1I0HA 4D7SA 4MVSA 4F4LA 1JMKC 3WB1A 2EIMC 3JCZA 4R6ZA 4DR2B 4N21A 1LNQA 3RYHB 1GN2A 2BOBC 3AK1A 1QVFU 2ZE6A 3CE2A 5LA6B 1DF4A 1KB9F 4J7ZA 3H1IH 3RYHA 2R72A 3ZMSA 3T4ZA 4E2LA 3TETA 5LA6A 3JD4A 5ITZB 3OMAB 3I56V 3JAKB 4FLXA 4ABMA 3AG1B 4O2BB 2WLNA 4DK1A 1H2MA 3GB7C 2X6BA 2QWQB 1FFXB 4I9QA 3H1JH 4JTAB 4C7UA 1T5EA 1E79G 2CTPA 2EBOA 3JAKA 5B3SB 3UKMA 4O2BA 3C3SA 1FFXA 3U11A 4OX9B 1MZFA 1VQ9V 3N27A 3C3TA 1BL8A 3T1YO 1K4DC 1XNRO 2ITCC 2H94A 1JJ2U 1ORQC 4ASUG 1K5QA 2KQXA 2YIBD 3IAYA 3VQYA 1KD1W 3K08A 3FYEB 3F5TA 4R50A 1SKVA 4PI2A 4JAAA 1JA8A 4TT3G 4UCTA 1DTOA 4EB6B 3OFNG 2IW5A 3OEHG 2ZD9A 2E5LB 4DR7O 3J80N 2YS8A 4B3TO 4LF7B 4X9QA 3LDDA 4EB6A 2NNUA 1JNBA 2Q9LA 3JAMN 2DWEC 1WA8B 2ITDC 3P32A 2EULA 5IJ0B 2MW2B 2XAFA 1FXVA 2ZINA 2UXBO 3AG2B 1WA8A 5IJ0A 2R70A 1XREA 4IIJB 2Q7EA 5KLVH 3ZHSA 4DV6O 2PI4A 4AHCA 3N2GB 1PNMA 1VQKV 4GZRB 2P7TC 1PP9H 2JS3A 4IIJA 4FZ0A 4X1KB 4CS4A 4B3SO 4R7CA 3N2GA 5JJNB 5EIBC 4JV5B 2W0XA 4X1KA 4JI5B 2QWRB 3SYQA 2UUCB 1PNLA 3D8CA 3SPJA 1OCOB 1Z5WA 4X64O 3ASOB 2WLHA 1AP5A 2P22C 3B09A 3GVMA 2Y48A 5HFMA 3QG5A 1XDCA 2VQEB 2ARHA 2WLKA 2ZT9B 4ZI7B 3ZHUA 2Q67A 4LNUA 3OGIB 2RQ6A 2YXHA 2ZR3A 2IJIA 2BCCH 4DK0A 4JI1B 2F43G 2VWKA 4JI3O 4ZI7A 2GHYA 2F23A 1M56C 3B77A 5C93A 1VIBA 1GRJA 4FM1A 4U7OA 5KA6A 4ZBMA 4CC5A 3MAQA 1N4CA 1P7BA 1FS0G 2VS0A 3T4DA 1BCCH 3ASNB 3ZN0A 3K0GA 3ZMUA 4MSWC 4GKJO 1HWYA 2DN9A 1KKDA 1OCZB 1AILA 2XNDG 3W7XA 2CH7B 1H2GA 4BWAA 3N2KA 3NXSA 3AG3B 4O4IB 4CZZA 5IJ9B 1KMIZ 5KHJA 1MZEA 2CH7A 2QE7G 1NKDA 5IY5B 1OCCB 4O4IA 5IJ9A 4FLVA 2RCVA 5LMUO 1MSWD 4WFHA 4HBNA 3FB7C 2LP7A 3W7TA 3FAVB 1YZBA 3BY6A 4W4KA 4GYCB 4DV4O 2P06A 3STZC 1XMQB 5A2QN 4JI7O 3FAVA 2RDCA 4CS2A 2Y4UA 3TXQA 1KQSU 4FK5C 1R3IC 1FAFA 1SRYA 2X6CA 3K3WA 4RQEA 3LNNA 2F93B 4DRXA 2YXYA 2VRZA 2JVDA 2L35A 5JH7A 4LC1A 4LP8A 4UCVA 4KFMA 5EZYA 5CN0A 1B3QA 4LF5O 2JJ2G 2OCHA 3IGAC 1N32O 4MVMA 1XNQO 2CDYA 3LSUA 3EXAA 2F4VO 4JI4B 2OWOA 4IYHA 1IBMO 3CJHB 1BMFG 2UXDB 3LSSA 3SYPA 2LW1A 3K79A 2HHHO 1XEQA 3G71V 4KP4A 3CJHA 4F6EA 1BQZA 3CRCA 3CC4V 4MTFA 3H1LH 1IXBA 1QVGU 3VBBA 2KKWA 4K35A 5DM6V 4DV0B 5EC2C 4DR4B 5KX5B 2HP8A 3CCEV 3ZMZA 1ZL8B 1P4RA 4UB8Z 4YY3B 4MVQA 1R3KC 5LP6C 4X8AA 5FLXN 3SR2C 4DW0A 2UXCB 5KX5A 2JIZG 5EYPB 4DR2O 4MVRA 3WFVA 1ZL8A 2FL4A 5EYPA 5LGUA 2B1IA 2QTSA 1WNSA 1AR1B 1MMMA 1IVSA 3JARB 1PKXA 2A7WA 2AGAA 3L74H 4Z1VA 2IH1C 1XUQA 4B3MB 1QR9A 1TUEB 5FL7G 2YEVA 2ZE8A 3ZHTA 3LNMB 3JARA 3AEIA 3E22A 2AW9A 1QR8A 3RFRA 1URFA 2PZSA 1VQ5V 2EILC 4ZKIA 1V54C 2PGGA 3OEEG 1MABG 1E1QG 1VF6C 4OX9O 1FPOA 1NZ6A 2A79B 3FYIB 4DR3B 4CH6A 4AILC 1Q82W 3CXHF 3T2MA 3W7WA 2M6YA 1X4TA 1R3JC 4WBNA 3QO5A 2GSMB 3ZRSA 5E1AC 3ZHRA 2Z0AA 1NBMG 3RVZA 2IU0A 2E5LO 3C90A 4LF7O 1AVMA 1NS1A 3IJ4A 1QLEB 3P30A 2LO1A 3JD3A 1KUQA 4PA7A 4TQFA 4PA6A 1HNXB 4J80A 3BCCH 4GT1A 4UCUA 2BTOA 2QDOA 3ABKC 2EILB 3WU2Z 1V9PA 2XOKG 4Q6GA 3WG7C 1GH6A 2RJZA 1S76D 1JJOA 4UVCA 4JV5O 5GONB 1ZX3A 4JI5O 5H6RA 2WA3A 2UUCO 4K3AA 5CMUA 5GONA 4KL1A 3BA8A 1WLEA 2Q7GA 5B1OA 3ZN1A 1RM1B 4BAYA 2R9AA 3ABLC 4DR6B 4GUNA 3L9DA 4UCSA 1PNKA 1QLNA 2ZE5A 5H9CA 2VQEO 4TUYB 1HNWB 2PYJA 2OCCC 5EIBD 3CP1A 4BIZA 2DYSC 4UXNA 4JI1O 1Q5OA 1EN6A 4TUYA 2XAJA 3HKCB 4LF4B 4N23A 1M90W 1Q43A 5B1BB 1YTFD 2DE0X 1I5YA 1YCIA 4UB6Z 3FB5C 4TOIA 1IBKB 2ETNA 4B7EA 2ZDIC 3APQA 4BW9A 2FKXA 3HKCA 1KP3A 2AHYA 2X6AA 3FFQA 4MS2A 2L6LA 4I7ZB 2E75B 3KCXA 3H1HH 4EKWA 2O57A 5L3CA 3LDCA 1EM1A 3ML0A 1BZKA 3TJTA 3BAAA 1X59A 4YIPA 4G27B 2ADQB 2EX3A 3CPWU 3CCJV 1VARA 1Z2GA 3FX7A 5H2FZ 5LXTB 2DQ0A 2EJ7A 1US6A 2GV9A 5H6QA 3CRRA 1YITV 1AJQA 3OGCC 1BSMA 1SQQH 1XMQO 1QQCA 2C2AA 3AG7A 2YUAA 1EN5A 3TXSA 4NR1A 1VQOV 1S77D 3K5OA 1OHHG 4J11A 1M5IA 2UU9B 4X65B 3UO3A 1R3LC 1NH2B 3K06A 2QM4A 1P49A 3ZBHA 3GWOA 1EN4A 2HFEC 2N04A 3W7UA 3OD4A 5J2TB 1GK9A 3LUTB 1RPRA 2CUGA 2QJ1A 1YJWV 1F51A 3AG1C 2XAQA 4JI4O 2P6JA 1K73W 5J2TA 3T1CA 3SPCA 1SESA 5B3SC 1YHQV 2UXDO 1YEWA 4H0LB 1BHAA 3S3WA 4K0KB 2QKCA 5EC1C 3RYIB 2FYUH 4R8CA 1S0VA 2Z3YA 4NKGB 4JYAB 2OTJV 3OR7C 1XBLA 4DV0O 4DR4O 4JAVA 4JYCA 1NQTA 1SS3A 2QR4A 3CWBH 5IYZA 1EFRG 3P3PA 5J9PC 4YY3O 3UQ8A 2OT5A 3SJCC 2UXCO 1NTZH 2UUBB 1AP6A 1QU7A 3F5WC 1ZSPA 5CB4B 5CA1B 4ZHQB 2JGDA 3UCSC 2F1MA 3SPIA 5CB4A 5CA1A 3B4SA 4X1IA 4ZHQA 4NTXA 2FB5A 1K7DA 3STLC 3ABTA 1NI8A 4A5UB 3AG2C 4B3MO 1FXHA 1FJGB 3CCSV 5K1XA 1Y6XA 4Z2WA 4O4LB 1RFYA 2ILMA 4UUJC 4DV2B 1L0LH 4HYOA 1ENVA 2ZR2A 4O4LA 1UPGA 2JEXA 1VQNV 1U97A 3DC6A 5B5EZ 1WB7A 4DR3O 3G4SV 5BR8B 3BRCA 2Y69B 1OCOC 1DGSA 3ASOC 1B04A 3PJSK 2A0LA 4JF3A 1AR4A 4YXWG 3ABUA 4QGPA 4FM2A 3I55V 4MTOA 5L3GA 2D2CB 4JAUA 3H1KH 5IWAB 4J10A 3CSXA 4H13B 3SYOA 3LDEA 2IH3C 4KHPB 3EVKA 4B7KA 3CCRV 3AG4B 4QPKA 2ZXWB 3E8GA 3ASNC 1HNXO 1F4MA 2ZM6B 4MTGA 1J5EB 1OCZC 2JS5A 3FB8C 1COWG 4LH6A 1AJNA 3AG3C 1SQFA 3CCVV 4UCRA 4PDMA 3OR6C 4YIOA 3FD9A 5IY5C 5KHGA 1OCCC 4LF8B 1W0KG 2DYRB 2RN9A 4YHHB 2A06H 4LNUB 1Y76B 4TWKA 1CXZB 2QSAA 2DJVA 4J9YB 3CB2A 3AK3A 5H5NA 3M7MX 3VOUA 1Y76A 3ZIAG 4DR6O 1EBOA 1EZJA 3IC9A 2AXTZ 1I7FA 2VQFB 1FD9A 1BT8A 3F7YC 5IYBO 1ZLZA 3SYCA 3KKYA 2EIKB 1K8AW 1ZUQA 2QA4V 4CC6A 3H01A 4LF4O 3E8BA 1UFIA 3J7AU 5CBGA 1IBKO 2NLJC 2UXNA 1W2BU 4FIPC 3N2KB 4I4TB 1Q3EA 1DLBA 5LMNB 2NN4A 1MG1A 4NXNB 5JJJB 5CBFA 2EIJB 4I4TA 1CEZA 2JK5C 2Y0PA 5LL6Y 2G38A 4NB5A 5FPOA 5L3DA 3HKEA 3DTUB 4CH5A 2ZNIA 1H8EG 1YJNV 1TUBB 4LFAB 4K8XA 3BEHA 2JGUA 4PA3A 2M7WA 2IJJA 3R66A 4UCOA 1TUBA 3FKSG 3W7SA 1OZ0A 1QHTA 3B8MA 1WAZA 3L73H 1DF5A 2R9IA 2GTSA 2E74B 5LHIA 2E76B 2F66C 1FXKB 3MDSA 4DRXB 3CYOA 1IXMA 2QTOA 4NYKA 5JH7B 2Q68A 3CS5A 1DK1A 5IT9N 2LJ2A 1FXKA 5EZYB 1S3JA 3CCMV 2HR3A 2Y0IA 1A32A 4DYLA 2HJDA 3PN1A 4FZ1A 1GN6A 1O9HA 1VQLV 2UU9O 4X65O 2LQTA 2LGWA 3CCLV 2XT9A 3OTOB 4DUYB 1GN3A 3UO2A 4LCUC 5EBLC 2A9HA 4ZIBA 1K92A 1Q6UA 2ODMA 2QWPB 2LW7A 3ZRWB 1FOUA 5L3BA 1WPXA 2KB1A 3ZRWA 4XBFA 1PV0A 4K0KO 3EFFK 2WLMA 3OMIB 2UUAB 4DXWA 4TV9B 2ATKC 2GUZB 1S5JA 4JYAO 1H2LA 4X1YA 4FLUA 3U10A 1NVPB 4TV9A 2GUZA 4Z1MG 4G28B 2PYLA 1KC8W 2Q8VA 3A0BZ 4DV5B 1H38A 1GKFA 4X62B 2UUBO 4J41A 4YJ3B 1NTKH 3SJBC 1YIJV 1Q6HA 1E1RG 4AQYB 2YEVB 1I5XA 1CPYA 3E22B 3K58A 2VWJA 1SF9A 4YJ3A 1QLEC 4RUEA 2XASA 3JYCA 2H8PC 4FLYA 1BQ0A 1AJPA 2EINB 3M8AA 2EJRA 3QTCA 1FJGO 3JALB 2B9ZA 1KU9A 4U3JB 4H33A 1H8HG 3JALA 3OE7G 4MTXA 4DV2O 5FPRA 1TA8A 4U3JA 4WBNB 4DUZB 3MD0A 4DV3B 3ABMB 1GTOA 5LOVB 1KP2A 4B08A 3KDRA 2W0FC 4DR5B 4QJFB 1FKAO 3WB0A 4KXRA 1R6KA 3OUSA 3HR0A 4WF9V 5LOVA 4GX1A 5BR8O 1XL6A 2ZIMA 2QKAA 4IGGA 1RM1C 3QO7A 2JDIG 1HW7A 4H44B 2OIEA 4JI6B 2Q0OC 2ZE7A 3FB6C 1BHBA 5KHIA 3P3NA 1S5LZ 1GM9A 1IJGA 5B1BC 3CRAA 3RN4A 1G4YB 2ZQMA 4IT5A 5IWAO 4B3RB 3CMAV 2ZKOA 1AI7A 4KHPO 1MSDA 4LH7A 2GBOA 4P30A 1QCEA 3CC7V 1XHZA 4NVPA 5DECA 2WLIB 1K4CC 2ZM6O 3X2QB 1TGOA 1J5EO 1GM7A 2JJ1G 2W6IG 4CH3A 3QO8A 2WLIA 4HAMA 2YXLA 4LBEC 2YIBA 2V1DA 1GMGA 2UXXA 1R6TA 2HLDG 4O4JA 4LF8O 2CTQA 3K59A 3ZS8C 4YHHO 1AROP 2JRIA 3EHBB 5BY1A 3ZCCA 1NU1H 2Y4TA 4FPPA 1CP9A 2Q5ZA 2YICA 4X66B 2BE3A 5A9GA 3JCUZ 2VQFO 3RBZA 4GX2A 3Q4HB 1KECA 1K97A 2P4VA 2HKOA 5LGNA 3K04A 3D3QA 4PI0A 1YSCA 1LR1A 4X20B 1QNMA 4FJCC 3A0HZ 1AR5A 3Q4HA 3G80A 1K9MW 2Q4PA 3O65A 1GM8A 4IHJB 5D5QA 5D5PA 3RW0A 3KZIZ 4X20A 1LUVA 1HR0B 3E35A 4FLTA 2YIDA 4FFKA 4PD4F 4IHJA 4UVBA 5JCOA 1VP7A 3TCUA 3BHPA 5LMNO 4NXNO 1PPJH 5L3FA 3G6EV 4DO2A 4W4LA 4OPAA 4X88A 4TSFG 1KKCA 4LFAO 1ZWIC 3ZJZA 1N0JA 3IFXA 1V55B 3ETDA 2YC0A 4DV1B 2X7RB 3BA9A 3K03A 3OT7A 1OCRB 4XDLA 5IYDO 1PM9A 1Q6IA 4FM0A 1OV9A 2P5OA 4FLWA 2OTLV 4LFBB 3B2EE 1MOFA 1M1KW 3B40A 3B8NA 5KAFZ 2R9RB 5BXZA 4QE7A 1YDXA 5JVDB 4OGQB 4DR1B 3OTOO 4PDLA 1SQBH 2Q69A 1SQXH 4DUYO 5KA5A 2KG7B 5JVDA 3JD0A 1H2NA 1PL4A 1SA0B 3OMNB 3RWRD 1VQ4V 1K5SA 2E3CA 2NR5A 4HZ3A 4JYYA 5LHGA 2KG7A 2DQ3A 4D7TA 4NXMB 1NR7A 3G67A 1SA0A 1R73A 4CS3A 2BSKB 2HEPA 1R6NA 2AZ2A 2DWDC 4JTDB 1G6UA 4L8JA 2BSKA 3DSQA 3CMEV 4U7NA 5IYZB 1GAXA 1B6QA 2UUAO 1YJ9V 4RQFA 1W59A 4XDJA 2CK3G 3K0DA 5CBHA 1IBLB 2Y69C 4GCZA 3WB2A 4JGSA 2QGNA 2AHZA 2PUSA 2JGDB 2EZPA 3T1HB 5HFLA 4DV5O 2QWOB 4X1IB 4X62O 5B1AB 4WFGA 4P9OA 1HDJA 3D36A 4G2KA 4QNHB 2MK3A 4AQYO 4P9PA 1M57B 4MVOA 4JI8B 3OUFA 1N33B 1G1XB 3AG4C 3JASB 5BZBA 2ZXWC 4RAIA 4RO2A 3JASA 3L70H 1EZVH 5KAIZ 4BW5A 3CRMA 1RP3B 5ITZA 1Q86W 1GO3F 2YIAA 3KCYA 4LF6B 4IL6Z 1BS3A 4DUZO 4DV3O 2V4DA 1MA1A 2DYRC 5KMGB 1NJIW 4OXSA 4DR5O 2CTWA 1JPXA 2AZ0A 3OTFA 2QKSA 4O4HB 5C8YB 5KMGA 3OM3B 4PA9A 4O4HA 2EIMB 5C8YA 4JI6O 4FVMA 4WFAV 3K5LA 2XAGA 2P90A 2EIKC 4F6RB 1D5AA 5DEDA 3G6BA 1Y74B 2H3OA 1JFFB 1KBHA 3I5DA 3VQXA 4F6RA 4B3RO 1XMOB 5KHHA 1Y74A 1SETA 1JFFA 2FTKA 1HP8A 1J95A 2Z5UA 3M99B 4ZOLB 1F7YA 3HPLC 1Q8IA 1VQ8V 1MNGA 2EIJC 3RVYA 3SJQC 4ZOLA 1VF7A 4MW8A 1VQMV 1IZ3A 3CRQA 2LFRA 4JI0B 4KUMA 1M9NA 4DV7B 2Q0AA 3E83A 3JATB 2YDEA 2QEXV 2IJHA 3JATA 4CBCA 4AI8A 2V7QG 4GX0A 1FXKC 3GWKC 2WLLB 1HNWO 4X66O 1SQGA 2HVKC 3DGEA 2QM8A 4J9ZB 4H37A 1M4UA 2WLLA 4WFBV 1BE3H 4JPRA 3DC5A 1TAEA 4I50B 4UVAA 1RPOA 3BFRA 2QM7A 1SZTA 2PY5A 3AK2A 4CH4A 3THOA 1HR0O 4I50A 3QNEA 1GN4A 4LWSB 2DMXA 1AI4A 3HKEB 4NTWA 4E4EA 4LWSA 1NT2B 3ETGA 2N74A 2CGOA 5LYJB 4LF9B 1VMGA 3ETQA 1NH2D 4O2AB 1I94B 4BIOA 5LYJA 1PL0A 4HNAB 4LFCB 4J42A 2ZCEA 5AG2A 2PI5A 1N36B 4LR3A 1N8RW 4O2AA 4DV1O 1Q7YW 1NTMH 1YTFB 4WFEA 3E8FA 4HNAA 4JI2B 2A3QA 4MT8A 1L8DA 3ZHQA 2XHBA 1P7GA 2OYQA 4LFBO 3K57A 1N34B 3SPHA 1SQVH 4ICGA 4L87A 1OJHA 1L1FA 4PV1B 5IDJA 2CTRA 1M56B 3ETEA 1WJZA 3QF7A 2BOCC 1S72V 1HNZB 3ZEDA 4DR1O 3L75H 4PA4A 2EZOA 3UT5B 4Q20A 2EINC 4MVUA 1JVMA 3TK1A 5BMVB 2LGQA 4JZ2A 3CX5F 3UT5A 4GKKB 4MW3A 4BIUA 1D5NA 3JSNA 3JD2A 4NXMO 4PELA 3D3IA 5BMVA 1K3EA 4I0XB 3CHXA 1XL4A 2WLJA 3UM7A 4X1YB 3L71H 4I0XA 4PJ0Z 3ABMC 4UV9A 4EFBA 1D2DA 4YJ2B 1UJWB 1IBLO 1AI5A 5J2UB 4J7JA 4YJ2A 3K5MA 3K9SA 5EBWC 3T1HO 2WAMA 2YSUB 5J2UA 3CXCU 3SGIA 4P2ZA 2QWNB 2BTQB 3JAWB 5FNVB 2WSSG 2FMLA 3JD1A 3TGUH 1ZAUA 2ADPA 2BTQA 4PHZA 3JAWA 3R65A 4JI8O 4WCEV 4JZGA 1N33O 5FNVA 3BVOA 3ZHVA 1XHXA 1SERA 5KUMA 3X2QC 4UV8A 3MHHC 1BGYH 5DN6G 3S3XA 1H5WA 3ZMVA 1Y4MA 2P67A 1XI1A 1F4NA 3QVNA 4I5SA 3HKDB 4TQDA 1YXBA 4LF6O 2DOSA 1WP8A 3OAAG 2IBZH 1U96A 1Y67A 1PD3A 3T1YB 1XNRB 1P84F 2Q73A 3HKDA 3L72H 3HKBB 4DW1A 3SJAC 2IM9A 4FLZA 1FYJA 3HKBA 1JX9A 2K9PA 1W0JG 5LP6B 5LBQA 1YI2V 3CEIA 2GTAA 4DR7B 2XTAA 3IC7A 1VQ6V 1Z5VA 4B3TB 3SPGA 1RSOB 3E2EA 4IYIA 2CE4A 5LP6A 5GW7A 1R1BA 3O9OA 5JCOC 3A2FA 5GTHZ 2YI8A 1VQPV 1RSOA 5LHHA 4D6TH 1XMOO 3SDLA 4NTYA 2B1GA 4I55B 1WP7A 2UXBB 3ICXA 4FMTA 4MVZA 2K1EA 1S5HC 1SC5B 1FFTB 5CA0B 4I55A 2XAHA 4DV6B 3BABA 4O4JB 3DXRB 3APOA 3NR7A 5EBMC 5CA0A 2WPDG 2HG5C 3VQWA 1IDSA 4GX5A 4BR6A 3LSQA 5K1PA 4B3SB 1H2SB 4JI0O 1V54B 3SYAA 3DXRA 2CAZC 4DV7O 2D3OW 4QE9A 1V55C 4XDKA 2GDSA 5IYCO 3E89A 4JASA 1OCRC 1M93A 1VF6A 4X64B 1Q90D 3U0ZA 1VF5B 1YVWA 3F7VC 1VEWA
chains in the Genus database with same CATH topology
1JR9A 1MNGA 1P7GA 3IC9A 1BSMA 1JA8A 1BT8A 1ZLZA 1EN5A 3KKYA 3QVNA 1KKCA 1LUWA 1ZUQA 4X9QA 1I08A 1N0JA 3RN4A 1MMMA 3DC6A 1Y67A 2RCVA 1ZTEA 1WB7A 3OT7A 1EN4A 1PM9A 1MSDA 1XUQA 1IX9A 2AW9A 4JZ2A 4GUNA 1I0HA 1XREA 1D5NA 1AR4A 3CEIA 1N0NA 2CE4A 3DC5A 1EN6A 1GN2A 2QKCA 2P4KA 3AK1A 3BFRA 1BS3A 3AK2A 1MA1A 1GN4A 3EVKA 1PL4A 3MDSA 1AP5A 5A9GA 2CDYA 3LSUA 4JYYA 3K9SA 1XDCA 4E4EA 1EM1A 3TJTA 1B06A 4YIPA 4C7UA 1AP6A 2ADQB 3C3SA 1IDSA 1ZSPA 1SZXA 1VARA 4BR6A 1QNMA 1AVMA 1AR5A 4F6EA 1GN6A 4YIOA 2GDSA 1XILA 2ADPA 5AG2A 1LUVA 3KDRA 3C3TA 1GN3A 4FFKA 4JZGA 1IXBA 1WB8A 2QKAA 1VEWA 3AK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR9 A;  1MNG A;  1P7G A;  3IC9 A;  1BSM A;  1JA8 A;  1BT8 A;  1ZLZ A;  1EN5 A;  3KKY A;  3QVN A;  1KKC A;  1LUW A;  1ZUQ A;  4X9Q A;  1I08 A;  1N0J A;  3RN4 A;  1MMM A;  3DC6 A;  1Y67 A;  2RCV A;  1ZTE A;  1WB7 A;  3OT7 A;  1EN4 A;  1PM9 A;  1MSD A;  1XUQ A;  1IX9 A;  2AW9 A;  4JZ2 A;  4GUN A;  1I0H A;  1XRE A;  1D5N A;  1AR4 A;  3CEI A;  1N0N A;  2CE4 A;  3DC5 A;  1EN6 A;  1GN2 A;  2QKC A;  2P4K A;  3AK1 A;  3BFR A;  1BS3 A;  3AK2 A;  1MA1 A;  1GN4 A;  3EVK A;  1PL4 A;  3MDS A;  1AP5 A;  5A9G A;  2CDY A;  3LSU A;  4JYY A;  3K9S A;  1XDC A;  4E4E A;  1EM1 A;  3TJT A;  1B06 A;  4YIP A;  4C7U A;  1AP6 A;  2ADQ B;  3C3S A;  1IDS A;  1ZSP A;  1SZX A;  1VAR A;  4BR6 A;  1QNM A;  1AVM A;  1AR5 A;  4F6E A;  1GN6 A;  4YIO A;  2GDS A;  1XIL A;  2ADP A;  5AG2 A;  1LUV A;  3C3T A;  1GN3 A;  4FFK A;  4JZG A;  1IXB A;  1WB8 A;  2QKA A;  1VEW A;  3AK3 A; 
#chains in the Genus database with same CATH topology
 1KYO F;  1AB3 A;  2W6J G;  1Q81 W;  5IE9 A;  1G8M A;  1TVK B;  3ZRX A;  3ZX6 A;  4X89 A;  1K33 A;  2OIG A;  3J81 N;  3A8T A;  5KHK A;  4JI3 B;  3HB3 B;  1LUW A;  1I08 A;  1TVK A;  3RGB A;  4PDR A;  2HVJ C;  2Q6A A;  4TV8 B;  2JEU A;  1H2K A;  3RYC B;  2CGN A;  3CCQ V;  4TV8 A;  1JOY A;  3BPZ A;  2F95 B;  2PTM A;  5LGT A;  2WWW A;  3CD6 V;  5TIS Z;  4GKJ B;  3RYC A;  3K9A A;  2IU3 A;  4JYB A;  3JSL A;  3ABK B;  3KG2 A;  3MHS C;  5KUK A;  2HJF C;  4JTC B;  4UFZ A;  3WG7 B;  2X0L A;  1N0N A;  4LF9 O;  1JCH A;  2P4K A;  1I94 O;  3ZMT A;  4QPJ A;  4LFC O;  5LMU B;  5E79 Z;  1N36 O;  5GTI Z;  2DW4 A;  1AI6 A;  4JI2 O;  3VQV A;  4OPH A;  3ABL B;  4DV4 B;  5LXT A;  1O9G A;  4JI7 B;  1JQ0 A;  4RUF A;  3D36 C;  3K5N A;  1QBZ A;  1B06 A;  4PDV A;  4I9W A;  2LFS A;  2OCC B;  1N34 O;  2YI9 A;  5JJE B;  1ROP A;  4EFE A;  2DYS B;  5B1A C;  1SZX A;  1XQ8 A;  2B5U A;  3E8H A;  5EK0 A;  1L0N H;  4FFB B;  2RNB A;  3A0R A;  4EEQ A;  1M57 C;  2N05 A;  1XIL A;  1HNZ O;  2WA4 A;  4WFF A;  1NVP D;  4LF5 B;  5JQG B;  4FFB A;  1IUR A;  1WB8 A;  1WPB A;  3H9V A;  2IJK A;  1VQ7 V;  5F2V O;  1N32 B;  2ZDI A;  3E86 A;  1XNQ B;  2ZNJ A;  4QIW F;  2F4V B;  5JQG A;  1JR9 A;  2PF4 E;  5B66 Z;  4GKK O;  1IBM B;  2ZIO A;  5L3E A;  5B1N A;  1XOU A;  2KSD A;  2HHH B;  3CC2 V;  3RYF B;  1WN7 A;  2XUM A;  3OW2 U;  3ZRV A;  1THZ A;  4RWU A;  1YF2 A;  5CA3 A;  5JWP A;  1ZTE A;  1K34 A;  4J7K A;  3RYF A;  3RT3 C;  3CCU V;  2RMK B;  1SQP H;  4GLX A;  4K8Z A;  1NR1 A;  2Q7H A;  1IX9 A;  1F23 A;  4U3F H;  3RYI A;  1Y66 A;  1I0H A;  4D7S A;  4MVS A;  4F4L A;  1JMK C;  3WB1 A;  2EIM C;  3JCZ A;  4R6Z A;  4DR2 B;  4N21 A;  1LNQ A;  3RYH B;  1GN2 A;  2BOB C;  3AK1 A;  1QVF U;  2ZE6 A;  3CE2 A;  5LA6 B;  1DF4 A;  1KB9 F;  4J7Z A;  3H1I H;  3RYH A;  2R72 A;  3ZMS A;  3T4Z A;  4E2L A;  3TET A;  5LA6 A;  3JD4 A;  5ITZ B;  3OMA B;  3I56 V;  3JAK B;  4FLX A;  4ABM A;  3AG1 B;  4O2B B;  2WLN A;  4DK1 A;  1H2M A;  3GB7 C;  2X6B A;  2QWQ B;  1FFX B;  4I9Q A;  3H1J H;  4JTA B;  4C7U A;  1T5E A;  1E79 G;  2CTP A;  2EBO A;  3JAK A;  5B3S B;  3UKM A;  4O2B A;  3C3S A;  1FFX A;  3U11 A;  4OX9 B;  1MZF A;  1VQ9 V;  3N27 A;  3C3T A;  1BL8 A;  3T1Y O;  1K4D C;  1XNR O;  2ITC C;  2H94 A;  1JJ2 U;  1ORQ C;  4ASU G;  1K5Q A;  2KQX A;  2YIB D;  3IAY A;  3VQY A;  1KD1 W;  3K08 A;  3FYE B;  3F5T A;  4R50 A;  1SKV A;  4PI2 A;  4JAA A;  1JA8 A;  4TT3 G;  4UCT A;  1DTO A;  4EB6 B;  3OFN G;  2IW5 A;  3OEH G;  2ZD9 A;  2E5L B;  4DR7 O;  3J80 N;  2YS8 A;  4B3T O;  4LF7 B;  4X9Q A;  3LDD A;  4EB6 A;  2NNU A;  1JNB A;  2Q9L A;  3JAM N;  2DWE C;  1WA8 B;  2ITD C;  3P32 A;  2EUL A;  5IJ0 B;  2MW2 B;  2XAF A;  1FXV A;  2ZIN A;  2UXB O;  3AG2 B;  1WA8 A;  5IJ0 A;  2R70 A;  1XRE A;  4IIJ B;  2Q7E A;  5KLV H;  3ZHS A;  4DV6 O;  2PI4 A;  4AHC A;  3N2G B;  1PNM A;  1VQK V;  4GZR B;  2P7T C;  1PP9 H;  2JS3 A;  4IIJ A;  4FZ0 A;  4X1K B;  4CS4 A;  4B3S O;  4R7C A;  3N2G A;  5JJN B;  5EIB C;  4JV5 B;  2W0X A;  4X1K A;  4JI5 B;  2QWR B;  3SYQ A;  2UUC B;  1PNL A;  3D8C A;  3SPJ A;  1OCO B;  1Z5W A;  4X64 O;  3ASO B;  2WLH A;  1AP5 A;  2P22 C;  3B09 A;  3GVM A;  2Y48 A;  5HFM A;  3QG5 A;  1XDC A;  2VQE B;  2ARH A;  2WLK A;  2ZT9 B;  4ZI7 B;  3ZHU A;  2Q67 A;  4LNU A;  3OGI B;  2RQ6 A;  2YXH A;  2ZR3 A;  2IJI A;  2BCC H;  4DK0 A;  4JI1 B;  2F43 G;  2VWK A;  4JI3 O;  4ZI7 A;  2GHY A;  2F23 A;  1M56 C;  3B77 A;  5C93 A;  1VIB A;  1GRJ A;  4FM1 A;  4U7O A;  5KA6 A;  4ZBM A;  4CC5 A;  3MAQ A;  1N4C A;  1P7B A;  1FS0 G;  2VS0 A;  3T4D A;  1BCC H;  3ASN B;  3ZN0 A;  3K0G A;  3ZMU A;  4MSW C;  4GKJ O;  1HWY A;  2DN9 A;  1KKD A;  1OCZ B;  1AIL A;  2XND G;  3W7X A;  2CH7 B;  1H2G A;  4BWA A;  3N2K A;  3NXS A;  3AG3 B;  4O4I B;  4CZZ A;  5IJ9 B;  1KMI Z;  5KHJ A;  1MZE A;  2CH7 A;  2QE7 G;  1NKD A;  5IY5 B;  1OCC B;  4O4I A;  5IJ9 A;  4FLV A;  2RCV A;  5LMU O;  1MSW D;  4WFH A;  4HBN A;  3FB7 C;  2LP7 A;  3W7T A;  3FAV B;  1YZB A;  3BY6 A;  4W4K A;  4GYC B;  4DV4 O;  2P06 A;  3STZ C;  1XMQ B;  5A2Q N;  4JI7 O;  3FAV A;  2RDC A;  4CS2 A;  2Y4U A;  3TXQ A;  1KQS U;  4FK5 C;  1R3I C;  1FAF A;  1SRY A;  2X6C A;  3K3W A;  4RQE A;  3LNN A;  2F93 B;  4DRX A;  2YXY A;  2VRZ A;  2JVD A;  2L35 A;  5JH7 A;  4LC1 A;  4LP8 A;  4UCV A;  4KFM A;  5EZY A;  5CN0 A;  1B3Q A;  4LF5 O;  2JJ2 G;  2OCH A;  3IGA C;  1N32 O;  4MVM A;  1XNQ O;  2CDY A;  3LSU A;  3EXA A;  2F4V O;  4JI4 B;  2OWO A;  4IYH A;  1IBM O;  3CJH B;  1BMF G;  2UXD B;  3LSS A;  3SYP A;  2LW1 A;  3K79 A;  2HHH O;  1XEQ A;  3G71 V;  4KP4 A;  3CJH A;  4F6E A;  1BQZ A;  3CRC A;  3CC4 V;  4MTF A;  3H1L H;  1IXB A;  1QVG U;  3VBB A;  2KKW A;  4K35 A;  5DM6 V;  4DV0 B;  5EC2 C;  4DR4 B;  5KX5 B;  2HP8 A;  3CCE V;  3ZMZ A;  1ZL8 B;  1P4R A;  4UB8 Z;  4YY3 B;  4MVQ A;  1R3K C;  5LP6 C;  4X8A A;  5FLX N;  3SR2 C;  4DW0 A;  2UXC B;  5KX5 A;  2JIZ G;  5EYP B;  4DR2 O;  4MVR A;  3WFV A;  1ZL8 A;  2FL4 A;  5EYP A;  5LGU A;  2B1I A;  2QTS A;  1WNS A;  1AR1 B;  1MMM A;  1IVS A;  3JAR B;  1PKX A;  2A7W A;  2AGA A;  3L74 H;  4Z1V A;  2IH1 C;  1XUQ A;  4B3M B;  1QR9 A;  1TUE B;  5FL7 G;  2YEV A;  2ZE8 A;  3ZHT A;  3LNM B;  3JAR A;  3AEI A;  3E22 A;  2AW9 A;  1QR8 A;  3RFR A;  1URF A;  2PZS A;  1VQ5 V;  2EIL C;  4ZKI A;  1V54 C;  2PGG A;  3OEE G;  1MAB G;  1E1Q G;  1VF6 C;  4OX9 O;  1FPO A;  1NZ6 A;  2A79 B;  3FYI B;  4DR3 B;  4CH6 A;  4AIL C;  1Q82 W;  3CXH F;  3T2M A;  3W7W A;  2M6Y A;  1X4T A;  1R3J C;  4WBN A;  3QO5 A;  2GSM B;  3ZRS A;  5E1A C;  3ZHR A;  2Z0A A;  1NBM G;  3RVZ A;  2IU0 A;  2E5L O;  3C90 A;  4LF7 O;  1AVM A;  1NS1 A;  3IJ4 A;  1QLE B;  3P30 A;  2LO1 A;  3JD3 A;  1KUQ A;  4PA7 A;  4TQF A;  4PA6 A;  1HNX B;  4J80 A;  3BCC H;  4GT1 A;  4UCU A;  2BTO A;  2QDO A;  3ABK C;  2EIL B;  3WU2 Z;  1V9P A;  2XOK G;  4Q6G A;  3WG7 C;  1GH6 A;  2RJZ A;  1S76 D;  1JJO A;  4UVC A;  4JV5 O;  5GON B;  1ZX3 A;  4JI5 O;  5H6R A;  2WA3 A;  2UUC O;  4K3A A;  5CMU A;  5GON A;  4KL1 A;  3BA8 A;  1WLE A;  2Q7G A;  5B1O A;  3ZN1 A;  1RM1 B;  4BAY A;  2R9A A;  3ABL C;  4DR6 B;  4GUN A;  3L9D A;  4UCS A;  1PNK A;  1QLN A;  2ZE5 A;  5H9C A;  2VQE O;  4TUY B;  1HNW B;  2PYJ A;  2OCC C;  5EIB D;  3CP1 A;  4BIZ A;  2DYS C;  4UXN A;  4JI1 O;  1Q5O A;  1EN6 A;  4TUY A;  2XAJ A;  3HKC B;  4LF4 B;  4N23 A;  1M90 W;  1Q43 A;  5B1B B;  1YTF D;  2DE0 X;  1I5Y A;  1YCI A;  4UB6 Z;  3FB5 C;  4TOI A;  1IBK B;  2ETN A;  4B7E A;  2ZDI C;  3APQ A;  4BW9 A;  2FKX A;  3HKC A;  1KP3 A;  2AHY A;  2X6A A;  3FFQ A;  4MS2 A;  2L6L A;  4I7Z B;  2E75 B;  3KCX A;  3H1H H;  4EKW A;  2O57 A;  5L3C A;  3LDC A;  1EM1 A;  3ML0 A;  1BZK A;  3TJT A;  3BAA A;  1X59 A;  4YIP A;  4G27 B;  2ADQ B;  2EX3 A;  3CPW U;  3CCJ V;  1VAR A;  1Z2G A;  3FX7 A;  5H2F Z;  5LXT B;  2DQ0 A;  2EJ7 A;  1US6 A;  2GV9 A;  5H6Q A;  3CRR A;  1YIT V;  1AJQ A;  3OGC C;  1BSM A;  1SQQ H;  1XMQ O;  1QQC A;  2C2A A;  3AG7 A;  2YUA A;  1EN5 A;  3TXS A;  4NR1 A;  1VQO V;  1S77 D;  3K5O A;  1OHH G;  4J11 A;  1M5I A;  2UU9 B;  4X65 B;  3UO3 A;  1R3L C;  1NH2 B;  3K06 A;  2QM4 A;  1P49 A;  3ZBH A;  3GWO A;  1EN4 A;  2HFE C;  2N04 A;  3W7U A;  3OD4 A;  5J2T B;  1GK9 A;  3LUT B;  1RPR A;  2CUG A;  2QJ1 A;  1YJW V;  1F51 A;  3AG1 C;  2XAQ A;  4JI4 O;  2P6J A;  1K73 W;  5J2T A;  3T1C A;  3SPC A;  1SES A;  5B3S C;  1YHQ V;  2UXD O;  1YEW A;  4H0L B;  1BHA A;  3S3W A;  4K0K B;  2QKC A;  5EC1 C;  3RYI B;  2FYU H;  4R8C A;  1S0V A;  2Z3Y A;  4NKG B;  4JYA B;  2OTJ V;  3OR7 C;  1XBL A;  4DV0 O;  4DR4 O;  4JAV A;  4JYC A;  1NQT A;  1SS3 A;  2QR4 A;  3CWB H;  5IYZ A;  1EFR G;  3P3P A;  5J9P C;  4YY3 O;  3UQ8 A;  2OT5 A;  3SJC C;  2UXC O;  1NTZ H;  2UUB B;  1AP6 A;  1QU7 A;  3F5W C;  1ZSP A;  5CB4 B;  5CA1 B;  4ZHQ B;  2JGD A;  3UCS C;  2F1M A;  3SPI A;  5CB4 A;  5CA1 A;  3B4S A;  4X1I A;  4ZHQ A;  4NTX A;  2FB5 A;  1K7D A;  3STL C;  3ABT A;  1NI8 A;  4A5U B;  3AG2 C;  4B3M O;  1FXH A;  1FJG B;  3CCS V;  5K1X A;  1Y6X A;  4Z2W A;  4O4L B;  1RFY A;  2ILM A;  4UUJ C;  4DV2 B;  1L0L H;  4HYO A;  1ENV A;  2ZR2 A;  4O4L A;  1UPG A;  2JEX A;  1VQN V;  1U97 A;  3DC6 A;  5B5E Z;  1WB7 A;  4DR3 O;  3G4S V;  5BR8 B;  3BRC A;  2Y69 B;  1OCO C;  1DGS A;  3ASO C;  1B04 A;  3PJS K;  2A0L A;  4JF3 A;  1AR4 A;  4YXW G;  3ABU A;  4QGP A;  4FM2 A;  3I55 V;  4MTO A;  5L3G A;  2D2C B;  4JAU A;  3H1K H;  5IWA B;  4J10 A;  3CSX A;  4H13 B;  3SYO A;  3LDE A;  2IH3 C;  4KHP B;  3EVK A;  4B7K A;  3CCR V;  3AG4 B;  4QPK A;  2ZXW B;  3E8G A;  3ASN C;  1HNX O;  1F4M A;  2ZM6 B;  4MTG A;  1J5E B;  1OCZ C;  2JS5 A;  3FB8 C;  1COW G;  4LH6 A;  1AJN A;  3AG3 C;  1SQF A;  3CCV V;  4UCR A;  4PDM A;  3OR6 C;  4YIO A;  3FD9 A;  5IY5 C;  5KHG A;  1OCC C;  4LF8 B;  1W0K G;  2DYR B;  2RN9 A;  4YHH B;  2A06 H;  4LNU B;  1Y76 B;  4TWK A;  1CXZ B;  2QSA A;  2DJV A;  4J9Y B;  3CB2 A;  3AK3 A;  5H5N A;  3M7M X;  3VOU A;  1Y76 A;  3ZIA G;  4DR6 O;  1EBO A;  1EZJ A;  3IC9 A;  2AXT Z;  1I7F A;  2VQF B;  1FD9 A;  1BT8 A;  3F7Y C;  5IYB O;  1ZLZ A;  3SYC A;  3KKY A;  2EIK B;  1K8A W;  1ZUQ A;  2QA4 V;  4CC6 A;  3H01 A;  4LF4 O;  3E8B A;  1UFI A;  3J7A U;  5CBG A;  1IBK O;  2NLJ C;  2UXN A;  1W2B U;  4FIP C;  3N2K B;  4I4T B;  1Q3E A;  1DLB A;  5LMN B;  2NN4 A;  1MG1 A;  4NXN B;  5JJJ B;  5CBF A;  2EIJ B;  4I4T A;  1CEZ A;  2JK5 C;  2Y0P A;  5LL6 Y;  2G38 A;  4NB5 A;  5FPO A;  5L3D A;  3HKE A;  3DTU B;  4CH5 A;  2ZNI A;  1H8E G;  1YJN V;  1TUB B;  4LFA B;  4K8X A;  3BEH A;  2JGU A;  4PA3 A;  2M7W A;  2IJJ A;  3R66 A;  4UCO A;  1TUB A;  3FKS G;  3W7S A;  1OZ0 A;  1QHT A;  3B8M A;  1WAZ A;  3L73 H;  1DF5 A;  2R9I A;  2GTS A;  2E74 B;  5LHI A;  2E76 B;  2F66 C;  1FXK B;  3MDS A;  4DRX B;  3CYO A;  1IXM A;  2QTO A;  4NYK A;  5JH7 B;  2Q68 A;  3CS5 A;  1DK1 A;  5IT9 N;  2LJ2 A;  1FXK A;  5EZY B;  1S3J A;  3CCM V;  2HR3 A;  2Y0I A;  1A32 A;  4DYL A;  2HJD A;  3PN1 A;  4FZ1 A;  1GN6 A;  1O9H A;  1VQL V;  2UU9 O;  4X65 O;  2LQT A;  2LGW A;  3CCL V;  2XT9 A;  3OTO B;  4DUY B;  1GN3 A;  3UO2 A;  4LCU C;  5EBL C;  2A9H A;  4ZIB A;  1K92 A;  1Q6U A;  2ODM A;  2QWP B;  2LW7 A;  3ZRW B;  1FOU A;  5L3B A;  1WPX A;  2KB1 A;  3ZRW A;  4XBF A;  1PV0 A;  4K0K O;  3EFF K;  2WLM A;  3OMI B;  2UUA B;  4DXW A;  4TV9 B;  2ATK C;  2GUZ B;  1S5J A;  4JYA O;  1H2L A;  4X1Y A;  4FLU A;  3U10 A;  1NVP B;  4TV9 A;  2GUZ A;  4Z1M G;  4G28 B;  2PYL A;  1KC8 W;  2Q8V A;  3A0B Z;  4DV5 B;  1H38 A;  1GKF A;  4X62 B;  2UUB O;  4J41 A;  4YJ3 B;  1NTK H;  3SJB C;  1YIJ V;  1Q6H A;  1E1R G;  4AQY B;  2YEV B;  1I5X A;  1CPY A;  3E22 B;  3K58 A;  2VWJ A;  1SF9 A;  4YJ3 A;  1QLE C;  4RUE A;  2XAS A;  3JYC A;  2H8P C;  4FLY A;  1BQ0 A;  1AJP A;  2EIN B;  3M8A A;  2EJR A;  3QTC A;  1FJG O;  3JAL B;  2B9Z A;  1KU9 A;  4U3J B;  4H33 A;  1H8H G;  3JAL A;  3OE7 G;  4MTX A;  4DV2 O;  5FPR A;  1TA8 A;  4U3J A;  4WBN B;  4DUZ B;  3MD0 A;  4DV3 B;  3ABM B;  1GTO A;  5LOV B;  1KP2 A;  4B08 A;  3KDR A;  2W0F C;  4DR5 B;  4QJF B;  1FKA O;  3WB0 A;  4KXR A;  1R6K A;  3OUS A;  3HR0 A;  4WF9 V;  5LOV A;  4GX1 A;  5BR8 O;  1XL6 A;  2ZIM A;  2QKA A;  4IGG A;  1RM1 C;  3QO7 A;  2JDI G;  1HW7 A;  4H44 B;  2OIE A;  4JI6 B;  2Q0O C;  2ZE7 A;  3FB6 C;  1BHB A;  5KHI A;  3P3N A;  1S5L Z;  1GM9 A;  1IJG A;  5B1B C;  3CRA A;  3RN4 A;  1G4Y B;  2ZQM A;  4IT5 A;  5IWA O;  4B3R B;  3CMA V;  2ZKO A;  1AI7 A;  4KHP O;  1MSD A;  4LH7 A;  2GBO A;  4P30 A;  1QCE A;  3CC7 V;  1XHZ A;  4NVP A;  5DEC A;  2WLI B;  1K4C C;  2ZM6 O;  3X2Q B;  1TGO A;  1J5E O;  1GM7 A;  2JJ1 G;  2W6I G;  4CH3 A;  3QO8 A;  2WLI A;  4HAM A;  2YXL A;  4LBE C;  2YIB A;  2V1D A;  1GMG A;  2UXX A;  1R6T A;  2HLD G;  4O4J A;  4LF8 O;  2CTQ A;  3K59 A;  3ZS8 C;  4YHH O;  1ARO P;  2JRI A;  3EHB B;  5BY1 A;  3ZCC A;  1NU1 H;  2Y4T A;  4FPP A;  1CP9 A;  2Q5Z A;  2YIC A;  4X66 B;  2BE3 A;  5A9G A;  3JCU Z;  2VQF O;  3RBZ A;  4GX2 A;  3Q4H B;  1KEC A;  1K97 A;  2P4V A;  2HKO A;  5LGN A;  3K04 A;  3D3Q A;  4PI0 A;  1YSC A;  1LR1 A;  4X20 B;  1QNM A;  4FJC C;  3A0H Z;  1AR5 A;  3Q4H A;  3G80 A;  1K9M W;  2Q4P A;  3O65 A;  1GM8 A;  4IHJ B;  5D5Q A;  5D5P A;  3RW0 A;  3KZI Z;  4X20 A;  1LUV A;  1HR0 B;  3E35 A;  4FLT A;  2YID A;  4FFK A;  4PD4 F;  4IHJ A;  4UVB A;  5JCO A;  1VP7 A;  3TCU A;  3BHP A;  5LMN O;  4NXN O;  1PPJ H;  5L3F A;  3G6E V;  4DO2 A;  4W4L A;  4OPA A;  4X88 A;  4TSF G;  1KKC A;  4LFA O;  1ZWI C;  3ZJZ A;  1N0J A;  3IFX A;  1V55 B;  3ETD A;  2YC0 A;  4DV1 B;  2X7R B;  3BA9 A;  3K03 A;  3OT7 A;  1OCR B;  4XDL A;  5IYD O;  1PM9 A;  1Q6I A;  4FM0 A;  1OV9 A;  2P5O A;  4FLW A;  2OTL V;  4LFB B;  3B2E E;  1MOF A;  1M1K W;  3B40 A;  3B8N A;  5KAF Z;  2R9R B;  5BXZ A;  4QE7 A;  1YDX A;  5JVD B;  4OGQ B;  4DR1 B;  3OTO O;  4PDL A;  1SQB H;  2Q69 A;  1SQX H;  4DUY O;  5KA5 A;  2KG7 B;  5JVD A;  3JD0 A;  1H2N A;  1PL4 A;  1SA0 B;  3OMN B;  3RWR D;  1VQ4 V;  1K5S A;  2E3C A;  2NR5 A;  4HZ3 A;  4JYY A;  5LHG A;  2KG7 A;  2DQ3 A;  4D7T A;  4NXM B;  1NR7 A;  3G67 A;  1SA0 A;  1R73 A;  4CS3 A;  2BSK B;  2HEP A;  1R6N A;  2AZ2 A;  2DWD C;  4JTD B;  1G6U A;  4L8J A;  2BSK A;  3DSQ A;  3CME V;  4U7N A;  5IYZ B;  1GAX A;  1B6Q A;  2UUA O;  1YJ9 V;  4RQF A;  1W59 A;  4XDJ A;  2CK3 G;  3K0D A;  5CBH A;  1IBL B;  2Y69 C;  4GCZ A;  3WB2 A;  4JGS A;  2QGN A;  2AHZ A;  2PUS A;  2JGD B;  2EZP A;  3T1H B;  5HFL A;  4DV5 O;  2QWO B;  4X1I B;  4X62 O;  5B1A B;  4WFG A;  4P9O A;  1HDJ A;  3D36 A;  4G2K A;  4QNH B;  2MK3 A;  4AQY O;  4P9P A;  1M57 B;  4MVO A;  4JI8 B;  3OUF A;  1N33 B;  1G1X B;  3AG4 C;  3JAS B;  5BZB A;  2ZXW C;  4RAI A;  4RO2 A;  3JAS A;  3L70 H;  1EZV H;  5KAI Z;  4BW5 A;  3CRM A;  1RP3 B;  5ITZ A;  1Q86 W;  1GO3 F;  2YIA A;  3KCY A;  4LF6 B;  4IL6 Z;  1BS3 A;  4DUZ O;  4DV3 O;  2V4D A;  1MA1 A;  2DYR C;  5KMG B;  1NJI W;  4OXS A;  4DR5 O;  2CTW A;  1JPX A;  2AZ0 A;  3OTF A;  2QKS A;  4O4H B;  5C8Y B;  5KMG A;  3OM3 B;  4PA9 A;  4O4H A;  2EIM B;  5C8Y A;  4JI6 O;  4FVM A;  4WFA V;  3K5L A;  2XAG A;  2P90 A;  2EIK C;  4F6R B;  1D5A A;  5DED A;  3G6B A;  1Y74 B;  2H3O A;  1JFF B;  1KBH A;  3I5D A;  3VQX A;  4F6R A;  4B3R O;  1XMO B;  5KHH A;  1Y74 A;  1SET A;  1JFF A;  2FTK A;  1HP8 A;  1J95 A;  2Z5U A;  3M99 B;  4ZOL B;  1F7Y A;  3HPL C;  1Q8I A;  1VQ8 V;  1MNG A;  2EIJ C;  3RVY A;  3SJQ C;  4ZOL A;  1VF7 A;  4MW8 A;  1VQM V;  1IZ3 A;  3CRQ A;  2LFR A;  4JI0 B;  4KUM A;  1M9N A;  4DV7 B;  2Q0A A;  3E83 A;  3JAT B;  2YDE A;  2QEX V;  2IJH A;  3JAT A;  4CBC A;  4AI8 A;  2V7Q G;  4GX0 A;  1FXK C;  3GWK C;  2WLL B;  1HNW O;  4X66 O;  1SQG A;  2HVK C;  3DGE A;  2QM8 A;  4J9Z B;  4H37 A;  1M4U A;  2WLL A;  4WFB V;  1BE3 H;  4JPR A;  3DC5 A;  1TAE A;  4I50 B;  4UVA A;  1RPO A;  3BFR A;  2QM7 A;  1SZT A;  2PY5 A;  3AK2 A;  4CH4 A;  3THO A;  1HR0 O;  4I50 A;  3QNE A;  1GN4 A;  4LWS B;  2DMX A;  1AI4 A;  3HKE B;  4NTW A;  4E4E A;  4LWS A;  1NT2 B;  3ETG A;  2N74 A;  2CGO A;  5LYJ B;  4LF9 B;  1VMG A;  3ETQ A;  1NH2 D;  4O2A B;  1I94 B;  4BIO A;  5LYJ A;  1PL0 A;  4HNA B;  4LFC B;  4J42 A;  2ZCE A;  5AG2 A;  2PI5 A;  1N36 B;  4LR3 A;  1N8R W;  4O2A A;  4DV1 O;  1Q7Y W;  1NTM H;  1YTF B;  4WFE A;  3E8F A;  4HNA A;  4JI2 B;  2A3Q A;  4MT8 A;  1L8D A;  3ZHQ A;  2XHB A;  1P7G A;  2OYQ A;  4LFB O;  3K57 A;  1N34 B;  3SPH A;  1SQV H;  4ICG A;  4L87 A;  1OJH A;  1L1F A;  4PV1 B;  5IDJ A;  2CTR A;  1M56 B;  3ETE A;  1WJZ A;  3QF7 A;  2BOC C;  1S72 V;  1HNZ B;  3ZED A;  4DR1 O;  3L75 H;  4PA4 A;  2EZO A;  3UT5 B;  4Q20 A;  2EIN C;  4MVU A;  1JVM A;  3TK1 A;  5BMV B;  2LGQ A;  4JZ2 A;  3CX5 F;  3UT5 A;  4GKK B;  4MW3 A;  4BIU A;  1D5N A;  3JSN A;  3JD2 A;  4NXM O;  4PEL A;  3D3I A;  5BMV A;  1K3E A;  4I0X B;  3CHX A;  1XL4 A;  2WLJ A;  3UM7 A;  4X1Y B;  3L71 H;  4I0X A;  4PJ0 Z;  3ABM C;  4UV9 A;  4EFB A;  1D2D A;  4YJ2 B;  1UJW B;  1IBL O;  1AI5 A;  5J2U B;  4J7J A;  4YJ2 A;  3K5M A;  3K9S A;  5EBW C;  3T1H O;  2WAM A;  2YSU B;  5J2U A;  3CXC U;  3SGI A;  4P2Z A;  2QWN B;  2BTQ B;  3JAW B;  5FNV B;  2WSS G;  2FML A;  3JD1 A;  3TGU H;  1ZAU A;  2ADP A;  2BTQ A;  4PHZ A;  3JAW A;  3R65 A;  4JI8 O;  4WCE V;  4JZG A;  1N33 O;  5FNV A;  3BVO A;  3ZHV A;  1XHX A;  1SER A;  5KUM A;  3X2Q C;  4UV8 A;  3MHH C;  1BGY H;  5DN6 G;  3S3X A;  1H5W A;  3ZMV A;  1Y4M A;  2P67 A;  1XI1 A;  1F4N A;  3QVN A;  4I5S A;  3HKD B;  4TQD A;  1YXB A;  4LF6 O;  2DOS A;  1WP8 A;  3OAA G;  2IBZ H;  1U96 A;  1Y67 A;  1PD3 A;  3T1Y B;  1XNR B;  1P84 F;  2Q73 A;  3HKD A;  3L72 H;  3HKB B;  4DW1 A;  3SJA C;  2IM9 A;  4FLZ A;  1FYJ A;  3HKB A;  1JX9 A;  2K9P A;  1W0J G;  5LP6 B;  5LBQ A;  1YI2 V;  3CEI A;  2GTA A;  4DR7 B;  2XTA A;  3IC7 A;  1VQ6 V;  1Z5V A;  4B3T B;  3SPG A;  1RSO B;  3E2E A;  4IYI A;  2CE4 A;  5LP6 A;  5GW7 A;  1R1B A;  3O9O A;  5JCO C;  3A2F A;  5GTH Z;  2YI8 A;  1VQP V;  1RSO A;  5LHH A;  4D6T H;  1XMO O;  3SDL A;  4NTY A;  2B1G A;  4I55 B;  1WP7 A;  2UXB B;  3ICX A;  4FMT A;  4MVZ A;  2K1E A;  1S5H C;  1SC5 B;  1FFT B;  5CA0 B;  4I55 A;  2XAH A;  4DV6 B;  3BAB A;  4O4J B;  3DXR B;  3APO A;  3NR7 A;  5EBM C;  5CA0 A;  2WPD G;  2HG5 C;  3VQW A;  1IDS A;  4GX5 A;  4BR6 A;  3LSQ A;  5K1P A;  4B3S B;  1H2S B;  4JI0 O;  1V54 B;  3SYA A;  3DXR A;  2CAZ C;  4DV7 O;  2D3O W;  4QE9 A;  1V55 C;  4XDK A;  2GDS A;  5IYC O;  3E89 A;  4JAS A;  1OCR C;  1M93 A;  1VF6 A;  4X64 B;  1Q90 D;  3U0Z A;  1VF5 B;  1YVW A;  3F7V C;  1VEW A; 
#chains in the Genus database with same CATH homology
 1JR9 A;  1MNG A;  1P7G A;  3IC9 A;  1BSM A;  1JA8 A;  1BT8 A;  1ZLZ A;  1EN5 A;  3KKY A;  3QVN A;  1KKC A;  1LUW A;  1ZUQ A;  4X9Q A;  1I08 A;  1N0J A;  3RN4 A;  1MMM A;  3DC6 A;  1Y67 A;  2RCV A;  1ZTE A;  1WB7 A;  3OT7 A;  1EN4 A;  1PM9 A;  1MSD A;  1XUQ A;  1IX9 A;  2AW9 A;  4JZ2 A;  4GUN A;  1I0H A;  1XRE A;  1D5N A;  1AR4 A;  3CEI A;  1N0N A;  2CE4 A;  3DC5 A;  1EN6 A;  1GN2 A;  2QKC A;  2P4K A;  3AK1 A;  3BFR A;  1BS3 A;  3AK2 A;  1MA1 A;  1GN4 A;  3EVK A;  1PL4 A;  3MDS A;  1AP5 A;  5A9G A;  2CDY A;  3LSU A;  4JYY A;  3K9S A;  1XDC A;  4E4E A;  1EM1 A;  3TJT A;  1B06 A;  4YIP A;  4C7U A;  1AP6 A;  2ADQ B;  3C3S A;  1IDS A;  1ZSP A;  1SZX A;  1VAR A;  4BR6 A;  1QNM A;  1AVM A;  1AR5 A;  4F6E A;  1GN6 A;  4YIO A;  2GDS A;  1XIL A;  2ADP A;  5AG2 A;  1LUV A;  3KDR A;  3C3T A;  1GN3 A;  4FFK A;  4JZG A;  1IXB A;  1WB8 A;  2QKA A;  1VEW A;  3AK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...