1SZXA

Role of hydrogen bonding in the active site of human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGFGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Role of hydrogen bonding in the active site of human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1szxA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1szxA02
2QKAA 5AG2A 1I08A 2AW9A 3CEIA 2CE4A 3K9SA 1AR4A 1EM1A 4GUNA 3LSUA 1MA1A 3C3SA 4X9QA 1QNMA 1GN3A 1IX9A 1AR5A 1ZUQA 3QVNA 3DC5A 4JYYA 1MMMA 1EN6A 2P4KA 1GN6A 3MDSA 4JZ2A 1P7GA 1ZLZA 2RCVA 1Y67A 1IXBA 1JR9A 1MSDA 3RN4A 1B06A 1EN5A 4C7UA 1N0JA 4FFKA 3KKYA 1BS3A 3C3TA 4F6EA 3OT7A 3DC6A 5A9GA 1AP5A 1MNGA 1N0NA 3BFRA 1AVMA 1PM9A 1GN4A 1ZTEA 2GDSA 3AK2A 1KKCA 4BR6A 1WB8A 4JZGA 1AP6A 3AK3A 3TJTA 1VARA 2ADPA 2QKCA 3AK1A 2CDYA 1BT8A 1XILA 1IDSA 3EVKA 3IC9A 1XUQA 1XREA 1EN4A 1PL4A 1BSMA 4YIPA 1D5NA 1VEWA 1ZSPA 1I0HA 2ADQB 4E4EA 1XDCA 1GN2A 1LUVA 1SZXA 1JA8A 1LUWA 1WB7A 4YIOA
chains in the Genus database with same CATH superfamily
2ETNA 1XL4A 4YY3O 3W7XA 1KC8W 5GONB 4YJ2B 2IBZH 3AG7A 3FB6C 3OGCC 1T5EA 5TISZ 3WU2Z 3MHHC 3MHSC 1F51A 1X59A 2KQXA 3SPHA 4B3SO 1MG1A 3L9DA 3CCEV 2ATKC 3AG2B 2YEVA 4MT8A 1NR7A 3ABMB 2YXLA 1M56B 4BW5A 1GN6A 1GO3F 1M5IA 4LFBO 1FAFA 2ZE5A 3ZHVA 4MVMA 3CCVV 1KUQA 5LMNB 3A0RA 1J5EB 3DXRB 4UCRA 3W7TA 3AG1B 1VQ8V 4JYBA 1DF4A 1AB3A 1RSOA 2GTSA 1B3QA 2ZE8A 2UXDO 2HG5C 3C3TA 4MVUA 4B3MB 1HWYA 5LXTB 3T4DA 2AHZA 4KFMA 2LO1A 4O4HA 1K5QA 2QGNA 1FFTB 5LBQA 5CBFA 2ITDC 5LP6C 3JASA 2P67A 3P32A 5J9PC 2WLHA 5LOVA 4YXWG 1OCCB 4O4LB 4UVCA 1EFRG 2DJVA 3OFNG 3BVOA 4DXWA 3UM7A 2N04A 2YI8A 5LYJA 1O9GA 3RWRD 5EIBD 3ZRXA 3HKEB 4LF9B 1KKDA 2OTLV 4YJ3A 1EM1A 4MW8A 2YI9A 5IJ9A 1G8MA 2Y0IA 4NVPA 4JI3O 2WSSG 3LSQA 2C2AA 3ZRWB 1N34O 4L87A 3ML0A 4K8ZA 1VQOV 4MVOA 1SQXH 1GN3A 4TUYB 5FPOA 5KHIA 2W6IG 1YF2A 4DO2A 5LMUB 2LJ2A 1XNQO 4I4TA 1M57C 1IXMA 5BXZA 1P7BA 2P7TC 2FMLA 2LQTA 3X2QC 3RYHB 4WFBV 4JI1B 2DYRB 2OIGA 4LFCO 1U96A 4CBCA 1YDXA 3OGIB 1FFXA 3OEHG 3OMIB 1B06A 4KHPO 1Q6UA 1ROPA 1EN5A 3APOA 3IJ4A 2YIBD 3KKYA 4H13B 4Q6GA 1CPYA 3JSNA 2JVDA 5A2QN 1HNXO 3B09A 2HHHO 4X20A 2QWOB 3L74H 2ZM6O 1COWG 3L75H 4JI6O 4GX2A 4TQFA 4DR6O 1F23A 1WB8A 2UU9B 4F6RA 4DUZO 4AI8A 1ORQC 4P30A 4FFBB 3KCXA 2G38A 1XEQA 4JI8B 1OJHA 2YC0A 4TT3G 1FYJA 1I7FA 2XHBA 1TUBA 4NXNB 2P90A 3FKSG 1GN2A 4K0KO 3QO8A 4HNAB 2OIEA 1K92A 1JPXA 2DE0X 3K06A 3FD9A 4PA4A 3JCZA 3B2EE 1AJNA 4BIOA 1BE3H 4DV6O 3JATB 2Y48A 2UXNA 4DR7O 1R3JC 2CTRA 4X64B 4RUFA 4H37A 4IL6Z 1GM8A 2Q0AA 4MTGA 5B3SC 3H9VA 2ZT9B 1XMOO 4LF4B 2E75B 3OR6C 4ZBMA 4BWAA 5IYCO 1DK1A 1AR5A 4MW3A 4I50A 3S3XA 5LA6A 3F7YC 4G2KA 2IU3A 1VP7A 1TGOA 5KX5A 4H44B 4FLVA 3HKDB 1FXVA 1THZA 3NR7A 1V54B 3ABLC 2X6CA 1Y67A 1G6UA 3CRCA 4U3FH 4DYLA 4EKWA 1QLEB 1SQVH 4PD4F 1N0JA 5JH7A 2F95B 4F6EA 1KQSU 3PJSK 4I0XA 4LFAB 5A9GA 4X1IA 4LF7B 2V4DA 1UPGA 4JI5B 4JI7O 3QO7A 4IT5A 4LF6B 1F4NA 1S5LZ 2Y0PA 1NKDA 3HKCA 5L3CA 2UUBB 2A06H 4LF5B 3JD0A 4PV1B 1FXKA 4NXMO 4JTAB 4JI2O 3WG7B 2QKSA 4P2ZA 3IC9A 1XUQA 1WA8A 1R6KA 4JYCA 1N33O 2Q0OC 1SA0A 1I0HA 2ADQB 2EZOA 3CWBH 4O4HB 5K1XA 3BHPA 4O2AA 2UUAO 3JASB 3JALA 5EIBC 4QPKA 4X66O 4FM0A 1GMGA 2F43G 1Q6IA 3RVZA 1NTMH 1RM1C 3LSUA 3BY6A 3HKBB 2CGNA 3QNEA 4QE7A 2DOSA 2JRIA 2CH7A 2L35A 3CCJV 4K35A 1U97A 2GHYA 3SYAA 1VQPV 2E5LB 1SRYA 3R65A 3RYFB 4XDLA 1WAZA 2WLIA 4LF8B 4W4LA 4JYYA 1L1FA 5DM6V 2ZNJA 1VQ7V 4FLWA 2O57A 4UV9A 4YJ3B 2ZINA 5IE9A 5IJ9B 4JZ2A 1SQPH 1NI8A 4JV5O 5B1BC 2MK3A 2XUMA 4NTXA 5J2UA 2IJKA 2EIJB 5EBLC 2Q7GA 4CH3A 5KMGA 5B1AB 3K5LA 1SC5B 4P9OA 1WN7A 5JCOA 4FVMA 2BTOA 2WLMA 2CUGA 3CRMA 2CTPA 4G27B 2XASA 2B1IA 1ZTEA 2F66C 2LFRA 4QE9A 1R1BA 3SGIA 2AZ2A 2VQFB 4DR5O 1M4UA 1FFXB 1DGSA 5EC2C 3CS5A 2XAHA 5BMVB 3AEIA 5GW7A 1IBMB 1IURA 1Q8IA 3CCUV 1Y76B 4IIJA 5CA0B 1OCOB 4X20B 1SQBH 3I55V 5BR8B 2ZDIC 1QBZA 3SR2C 2W0XA 3E8GA 2EIMC 3W7UA 3UT5A 3K3WA 1K4DC 4B3TO 1RPOA 2WLKA 1WB7A 1Q81W 3VQVA 4YIOA 3K79A 2QKAA 2ZR3A 5L3GA 4X65O 1I08A 2IU0A 5CBGA 3CRRA 4B3RO 1FXHA 5EYPA 3ZIAG 1E1RG 2HKOA 1R6TA 2XNDG 5IY5C 2XT9A 1FS0G 5C8YA 1JX9A 2FTKA 2BOCC 1FOUA 1HR0O 2Q69A 1O9HA 4D7SA 2FB5A 3G6BA 5IYDO 4GKKB 4DW0A 2X6AA 3F5TA 3J80N 2LFSA 1OZ0A 4NTWA 1MMMA 4B7KA 4DV0B 1SZTA 3OM3B 3ZS8C 5LGUA 4WFAV 4DV3B 1K97A 4TV9A 3JAKA 3B8NA 2LGWA 3CCQV 2ODMA 1IXBA 5HFLA 4TWKA 1KECA 4YHHB 4DV7O 2GUZB 4HBNA 4G28B 4I50B 1ZL8A 4K3AA 2WA3A 4RUEA 5LHIA 1SS3A 2P6JA 1WLEA 1Q5OA 2QM8A 5KX5B 3ZN1A 1H2KA 3K5OA 1M90W 2QWPB 2EX3A 5K1PA 2EINB 2QWRB 3OD4A 5CMUA 1AJQA 3CMEV 3FFQA 3SJQC 3CCSV 1BMFG 1WNSA 4GKJB 5IWAO 4LH7A 4I0XB 4DR3O 1S72V 4LC1A 4RO2A 4X1IB 1K34A 2CK3G 3UKMA 3ZEDA 2BTQB 1MZFA 4JI0O 2F4VB 3ZHSA 4X62B 1FXKB 1VF5B 3JAWB 2YS8A 5GTIZ 3TETA 4MS2A 3LDDA 2EILB 2R72A 2CAZC 5KAIZ 1WA8B 5JJEB 4CS2A 3G71V 2XAGA 2PUSA 2QSAA 1SA0B 2VQEO 1LNQA 2YSUB 4MSWC 3C3SA 4OPHA 3SJBC 1S77D 2KKWA 2PI5A 4LFBB 1P49A 3E22A 4R6ZA 1IVSA 4O2AB 1BHBA 3OTOB 3JALB 2EJRA 1BCCH 3TGUH 3G6EV 2UXDB 1F4MA 1LR1A 2KSDA 2HVJC 3ZRSA 2CGOA 4DV2O 1EBOA 5EK0A 2E76B 4I55A 2CH7B 3H1IH 1YSCA 1MSDA 2RJZA 5H9CA 2GV9A 3PN1A 3NXSA 4CC6A 2WLIB 2PI4A 3K9AA 2ZXWC 4L8JA 3JD2A 3WB2A 1K7DA 4ZIBA 1XNRO 1QQCA 2HJFC 4JI4O 1HNWB 2IJJA 4PDRA 1OCZB 3TJTA 2JGDA 3A8TA 1KU9A 2QJ1A 5L3FA 4TOIA 5KMGB 3T1YO 1Z5WA 4WF9V 2R70A 1IBLO 3H1LH 1M93A 2UUCB 1K9MW 4D6TH 4NR1A 4JI3B 3SYOA 4DRXA 2LW7A 5FNVB 1Q43A 1N34B 1QVFU 1Q6HA 1BL8A 2QEXV 3L71H 3SYQA 1V55B 3K9SA 4UXNA 2K9PA 3D36C 2A9HA 3OE7G 5B66Z 3E86A 1KYOF 1H2SB 3UO3A 3UT5B 2QWNB 4J41A 3AG2C 1QNMA 2FL4A 4WBNA 4WFHA 4J10A 4OX9B 3ABMC 3VQYA 2Z5UA 1M56C 5IYBO 2ZIMA 4XDKA 5EYPB 1YHQV 4AHCA 5LMNO 3OAAG 5IYZA 2PZSA 5C8YB 3B8MA 2F93B 1V9PA 4O4IA 2LP7A 3BABA 4DR6B 3RN4A 2FKXA 2V7QG 4KXRA 3CCLV 3AG1C 1N32B 4B3MO 4DUZB 2IW5A 1Y6XA 2B5UA 2MW2B 4A5UB 1H38A 4DV5O 2EBOA 2XAFA 4TV9B 1Q82W 2YICA 4LNUA 3JAKB 4CS4A 4MTXA 4AQYB 3QG5A 1CXZB 4K0KB 5L3BA 4UCOA 2KB1A 3EVKA 2IJHA 1ZL8B 4O2BB 3HB3B 1PL4A 3CX5F 2WWWA 1D5NA 4LP8A 4OGQB 1YI2V 4GX5A 1OCCC 3TK1A 3K58A 3QTCA 2UXBB 4LF9O 1XMQB 1I5YA 2NNUA 2Q67A 5AG2A 3BAAA 1R3LC 1DF5A 2DW4A 2AZ0A 2QM4A 4I9QA 4DR2B 5DEDA 4ABMA 2PYLA 3ASNB 3EHBB 1R3KC 4JPRA 5LMUO 4NB5A 1S5HC 1HP8A 1YJNV 3GB7C 1KB9F 3ASOB 2Y69B 2EIKB 4EB6A 4JI1O 2DYSB 4GT1A 3VQXA 2YDEA 3ZHRA 3E83A 3K0DA 5B1NA 2B9ZA 2Y4TA 1KP3A 3MDSA 1QCEA 2RDCA 2QTOA 4WFFA 2DYRC 4J80A 1QU7A 4BIUA 2JGUA 4MTFA 3E22B 1GM7A 5GTHZ 3JARA 1K8AW 4DUYB 1QVGU 3AG3B 3JAMN 1IBKO 1GKFA 4WFGA 2NLJC 4FM2A 2Q6AA 3K08A 5ITZA 3ETQA 5EBWC 1W0KG 3ZMSA 5DN6G 2QWQB 1N33B 3RT3C 1AROP 1TA8A 4I55B 1E79G 3T1HB 2X7RB 5KHJA 2YEVB 3RVYA 1GK9A 5BZBA 4JI8O 3DTUB 3K57A 1BQZA 4B08A 4PHZA 4NXNO 4YIPA 3ETGA 1VQ9V 2ZE7A 1ZSPA 3RBZA 4O4JA 5EBMC 3D8CA 3ETDA 4I9WA 1PNKA 1R73A 5H5NA 1L8DA 2GSMB 1RSOB 1VQNV 1VF6C 1XOUA 3T2MA 3JYCA 4IYIA 3E8FA 3JSLA 2X0LA 1VMGA 5E1AC 1GH6A 3WB0A 2ZR2A 2BOBC 3ZCCA 1MA1A 3SYPA 5KHGA 4JV5B 1SKVA 4H33A 4DRXB 3CCMV 3OEEG 1US6A 2RQ6A 1QLNA 5FL7G 1FJGO 4GCZA 1Q86W 3DC5A 2QDOA 1VIBA 4DV1B 4NTYA 5LOVB 2UXXA 3CXHF 4UFZA 1V54C 3M8AA 2AHYA 5EZYA 4UCUA 3ZN0A 4ZHQA 1H8HG 3H1KH 1JR9A 1AI4A 5LYJB 3AG4B 2HFEC 2M7WA 3OW2U 3CD6V 5LP6A 4LFAO 4WBNB 4DR5B 1QLEC 4QGPA 4YJ2A 3WB1A 1Y66A 3T4ZA 1AILA 4JI5O 3A0HZ 3K04A 4DV4O 4LF6O 1N36B 1GN4A 4LF5O 3B4SA 3QO5A 3IGAC 5KLVH 5KAFZ 1HNZO 3BRCA 2IM9A 2Q7HA 4JTDB 3ZX6A 2PGGA 4Z2WA 1XBLA 2JS3A 1NVPB 1IDSA 3WG7C 1PNMA 3CHXA 3JCUZ 4TV8A 4U7OA 2WPDG 3CP1A 4X65B 4I4TB 3SPGA 3LDEA 1ZX3A 1Y74A 1AJPA 2CTWA 1K3EA 3E35A 1S0VA 2Z0AA 1KMIZ 3DXRA 4Q20A 3TXSA 5LGNA 1TVKA 2ZKOA 4DW1A 5DECA 2Q4PA 4ZOLA 3G4SV 5KUKA 2AW9A 1BQ0A 3A0BZ 3CXCU 2WLJA 2BSKA 3CRQA 1W2BU 1I94B 1OV9A 5LXTA 4UCSA 4PA7A 4LCUC 3FAVA 4EEQA 3ABKB 2F23A 4UV8A 1S76D 4PA3A 2OCCB 3ICXA 4JAVA 4ASUG 2Y4UA 2JDIG 4OPAA 2E5LO 1HW7A 3CMAV 4F6RB 1Z2GA 4LF8O 2EJ7A 3S3WA 1GTOA 1XQ8A 3RYCA 4DV7B 1IZ3A 4X8AA 1NTKH 4O4LA 1WP8A 4UVBA 4HZ3A 1Q90D 2M6YA 5JVDA 2RMKB 5C93A 4KP4A 1OCRB 3STZC 1JCHA 2H3OA 2DWDC 2EZPA 1E1QG 1N4CA 1TUBB 3CE2A 1GM9A 2R9RB 5B5EZ 2EIJC 4GX1A 3UQ8A 1AR1B 2L6LA 1Q7YW 5B1AC 5JWPA 1L0NH 3SPJA 1BS3A 4EB6B 4PDLA 1PL0A 2VQFO 1CEZA 1S3JA 5IWAB 4GZRB 2XAQA 4DR3B 3ZRWA 4JYAB 3P30A 4D7TA 1Z5VA 1IBMO 1GRJA 4E2LA 3AK1A 3GWOA 4GLXA 1YZBA 3ZHUA 1VQ5V 3CPWU 1JQ0A 2N74A 3JARB 2QR4A 4FZ0A 5LA6B 5BR8O 1H5WA 2UXCO 5BY1A 3HR0A 3RYHA 3CCRV 1OCOC 5ITZB 4CH6A 3LNNA 1XHZA 1SZXA 1H2MA 4FJCC 4MVSA 2ZNIA 4FIPC 4HAMA 2Q5ZA 4RWUA 5JH7B 2RNBA 2WAMA 4YY3B 2Q68A 3Q4HA 1JFFA 1YTFB 4XDJA 4GKKO 1WP7A 4O4JB 5HFMA 5JQGA 2R9AA 2LW1A 3IFXA 3HKCB 2ZIOA 4DV2B 1YEWA 3RFRA 1IX9A 5H6RA 2A3QA 2ZD9A 1K33A 2ILMA 3EXAA 1ZUQA 4FFBA 3HPLC 4DV0O 4B3SB 4DV3O 5FPRA 4UCTA 1EN6A 5IDJA 5CA1A 1VQLV 4U3JA 4YHHO 1Q3EA 4MVQA 4LWSA 4HNAA 4WCEV 1NQTA 1XNRB 1PKXA 3H1HH 1XI1A 1QR9A 3U10A 3N2GA 4DR4O 3SJCC 1YJ9V 2V1DA 2GBOA 3OT7A 5KHKA 3ZHQA 3K5NA 1AP5A 1MNGA 2P22C 2F1MA 4OXSA 3LUTB 3FYEB 2GDSA 3TXQA 1D2DA 2Q8VA 4DR1O 4N21A 3MAQA 5EZYB 1IBLB 2EINC 2Z3YA 4ZHQB 1FPOA 5LP6B 4RQEA 1AI5A 1EN4A 4PA6A 1BSMA 4UUJC 3STLC 2DMXA 3TCUA 2F4VO 3HKDA 4X62O 3MD0A 3KG2A 2AGAA 4FMTA 1XDCA 2D2CB 2EULA 4IYHA 4PI0A 5J2UB 5B1OA 1FXKC 1PV0A 2YIAA 2A79B 2EILC 5H6QA 3CEIA 4TV8B 3ZRVA 2KG7A 2NR5A 1R3IC 1M1KW 4X1YA 5D5QA 1Y74B 4BIZA 1G1XB 4X1KA 3T1CA 1N8RW 3OTOO 1KD1W 2YUAA 1IJGA 1NZ6A 4JTCB 1TVKB 1F7YA 4I5SA 1NU1H 1JMKC 4ZOLB 3B77A 3O9OA 1KP2A 4X88A 1WPXA 4CC5A 1JNBA 1M57B 1J95A 2BSKB 3UCSC 3CC2V 3L70H 2YIBA 4JAAA 3FAVB 4IIJB 3X2QB 1XNQB 4Z1MG 3KZIZ 2VWKA 2Q9LA 1DTOA 2RCVA 5LL6Y 3I56V 4DV5B 4RAIA 1SQFA 3F5WC 5KHHA 4LFCB 4MVZA 3E89A 4FFKA 3RYCB 4FLTA 1KBHA 2N05A 2ZE6A 4KHPB 1HNWO 3ZMZA 1PM9A 3CJHA 2ZDIA 3HKBA 2WLLA 5JVDB 1J5EO 1K5SA 4BR6A 4BW9A 1HNXB 1SF9A 4TSFG 2HHHB 1OCZC 2ZM6B 4DK1A 1P84F 2QKCA 4JI6B 4RQFA 1XILA 3GWKC 2JK5C 3VOUA 2QA4V 3L72H 4N23A 3RYFA 1ENVA 5CN0A 1AI7A 2ZQMA 3CYOA 5JCOC 3K5MA 1VF7A 4XBFA 2UUCO 4ICGA 3QF7A 3ZHTA 1H2NA 1JJ2U 3KDRA 1FKAO 3RYIA 2FYUH 3QVNA 4EFEA 3BPZA 3OTFA 1NT2B 1I5XA 3RW0A 2OTJV 2W0FC 3THOA 2GTAA 1V55C 2P06A 1FD9A 4DV6B 1XL6A 4DR7B 5B3SB 3K59A 2DQ3A 4IGGA 3IAYA 4OX9O 2DQ0A 3BEHA 4F4LA 5BMVA 1HDJA 5E79Z 1K73W 1XMOB 1QR8A 5L3DA 4J9YB 1Y76A 2HJDA 5CA0A 2P4KA 2QM7A 3FB7C 4J11A 3Q4HB 4JF3A 1JFFB 2VWJA 1IBKB 3BA8A 4LH6A 5JQGB 3M7MX 3J81N 3ABLB 1N32O 4I7ZB 1W59A 3VBBA 2WLNA 3C90A 4ZKIA 3O65A 1UFIA 2HP8A 4C7UA 3OR7C 3K03A 5KA6A 2YXHA 5IJ0A 3BFRA 3BCCH 1AVMA 5CA1B 3ZJZA 4U3JB 3ZBHA 3K0GA 4AQYO 1BZKA 3SDLA 4ZI7A 2JS5A 4LWSB 1NVPD 3A2FA 1AI6A 5J2TA 4JI7B 2Q7EA 3N2GB 1URFA 3CRAA 3LDCA 2JJ1G 3D3IA 3SPIA 1JVMA 5H2FZ 4Z1VA 2OYQA 2IJIA 1XREA 4NXMB 2PTMA 4JI2B 3JD3A 3SPCA 5LHHA 1NH2D 3FX7A 3APQA 2UXBO 2UU9O 1YVWA 1SETA 3IC7A 2H94A 1XMQO 2VS0A 5KA5A 1M9NA 2QE7G 4FK5C 3N2KA 1R6NA 3CSXA 2GUZA 3ABUA 4DR2O 2PY5A 1SQGA 2PF4E 3G80A 1SERA 3L73H 2RN9A 2CE4A 1RFYA 1RM1B 2X6BA 2UUAB 4GUNA 1FJGB 3ASNC 1ZAUA 4UB6Z 5CB4A 4X66B 3LNMB 1BGYH 5IT9N 4FZ1A 2XOKG 2BE3A 4FLXA 1CP9A 2JGDB 4W4KA 2VRZA 4X64O 4CZZA 1H2LA 4PI2A 3ASOC 2Y69C 2EIKC 4PDVA 4QIWF 2DYSC 2KG7B 4J9ZB 5CBHA 1G4YB 4X1YB 5LGTA 4DV4B 4LF4O 4UCVA 3R66A 2BTQA 5B1BB 2BCCH 1TAEA 1ZLZA 4X1KB 4DUYO 1A32A 1EZJA 3JAWA 1HNZB 4MVRA 4FPPA 5KUMA 1NTZH 4WFEA 1L0LH 3FYIB 3AG3C 1W0JG 3DC6A 2XAJA 1N0NA 3P3NA 4HYOA 4IHJA 3U0ZA 3N27A 3M99B 3T1HO 4PJ0Z 1SQQH 1VQ6V 1B04A 2ADPA 1VQ4V 5L3EA 2CDYA 2OCHA 1BT8A 1NBMG 1H2GA 1D5AA 3CB2A 5GONA 3SJAC 1NS1A 2CTQA 3E8HA 4LF7O 3WFVA 2HR3A 3D36A 1VEWA 4U7NA 1B6QA 3CJHB 3DSQA 2UUBO 3W7SA 3J7AU 2WLLB 2P4VA 5IYZB 2A0LA 2EIMB 2JEXA 1YJWV 4O4IB 3H1JH 1RPRA 2B1GA 4MTOA 4R50A 3U11A 2IH3C 1TUEB 4J7KA 4B3TB 4J7ZA 1MOFA 1YTFD 2D3OW 5IY5B 4FLYA 1WJZA 4B3RB 3E8BA 2QTSA 4BAYA 2DN9A 4DK0A 1NH2B 4PA9A 1ZWIC 1WPBA 2YIDA 3GVMA 5JJNB 1Y4MA 4LNUB 3RYIB 3W7WA 4EFBA 4R7CA 4K8XA 4UB8Z 4DV1O 1HR0B 1UJWB 3KCYA 5F2VO 4B7EA 4QJFB 1MABG 5LHGA 4H0LB 1DLBA 2JJ2G 1PNLA 3VQWA 1YXBA 2WA4A 1MSWD 1P7GA 2LGQA 3FB8C 4LBEC 2ITCC 1SESA 3I5DA 5FNVA 3AG4C 1JOYA 3JD4A 1MZEA 2OT5A 1N36O 4QPJA 4JGSA 4UVAA 1PP9H 3ZMVA 4NKGB 4P9PA 4KL1A 3BA9A 2UXCB 5EC1C 4FLUA 3EFFK 3HKEA 3D3QA 4JAUA 1VQKV 2ZCEA 1NJIW 3FB5C 5CA3A 3ZMTA 5IJ0B 5D5PA 4E4EA 1LUVA 4TQDA 4ZI7B 3RGBA 3G67A 1LUWA 4TUYA 5J2TB 2JEUA 1I94O 2HEPA 4CH4A 4JI0B 2DWEC 2Q73A 4J42A 4LR3A 4JASA 3OUFA 3DGEA 5JJJB 1AR4A 3ZMUA 2NN4A 1PPJH 3ABKC 2W6JG 4FLZA 2HVKC 2K1EA 2OCCC 3LSSA 3F7VC 1X4TA 3CC4V 4FM1A 4NYKA 3N2KB 4X9QA 2PYJA 4CS3A 3ETEA 2VQEB 1NR1A 2IH1C 4PELA 4O2BA 4X89A 4AILC 1YIJV 4QNHB 4DR4B 1RP3B 1GAXA 3B40A 2P5OA 1K4CC 4GYCB 5CB4B 1PD3A 1OCRC 2ARHA 2R9IA 4DR1B 1P4RA 4CH5A 1YCIA 3H01A 3OMAB 1BHAA 3P3PA 1YITV 2E74B 3UO2A 1JJOA 1S5JA 2ZXWB 4JYAO 5FLXN 2HLDG 3SYCA 1EZVH 3AK2A 1KKCA 4GX0A 4JZGA 1AP6A 3AK3A 2E3CA 4PDMA 1VARA 2AXTZ 1OHHG 4R8CA 4JI4B 2H8PC 3E2EA 1VQMV 2XTAA 3JATA 1VF6A 4IHJB 2OWOA 3CC7V 3ABTA 3T1YB 2A7WA 3OUSA 1H8EG 1QHTA 2JIZG 3JD1A 2YXYA 1XHXA 4J7JA 1JA8A 4KUMA 4GKJO 3OMNB
chains in the Genus database with same CATH topology
2QKAA 5AG2A 1I08A 2AW9A 3CEIA 2CE4A 3K9SA 1AR4A 1EM1A 4GUNA 3LSUA 1MA1A 3C3SA 4X9QA 1QNMA 1GN3A 1IX9A 1AR5A 1ZUQA 3QVNA 3DC5A 4JYYA 1MMMA 1EN6A 2P4KA 1GN6A 3MDSA 4JZ2A 1P7GA 1ZLZA 2RCVA 1Y67A 1IXBA 1JR9A 1MSDA 3RN4A 1B06A 1EN5A 4C7UA 1N0JA 4FFKA 3KKYA 1BS3A 3C3TA 4F6EA 3OT7A 3DC6A 5A9GA 1AP5A 1MNGA 1N0NA 3BFRA 1AVMA 1PM9A 1GN4A 1ZTEA 2GDSA 3AK2A 1KKCA 4BR6A 1WB8A 4JZGA 1AP6A 3AK3A 3TJTA 1VARA 2ADPA 2QKCA 3AK1A 2CDYA 1BT8A 1XILA 1IDSA 3EVKA 3IC9A 1XUQA 1XREA 1EN4A 1PL4A 1BSMA 4YIPA 1D5NA 1VEWA 1ZSPA 1I0HA 2ADQB 4E4EA 1XDCA 1GN2A 1LUVA 1SZXA 3KDRA 1JA8A 1LUWA 1WB7A 4YIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKA A;  5AG2 A;  1I08 A;  2AW9 A;  3CEI A;  2CE4 A;  3K9S A;  1AR4 A;  1EM1 A;  4GUN A;  3LSU A;  1MA1 A;  3C3S A;  4X9Q A;  1QNM A;  1GN3 A;  1IX9 A;  1AR5 A;  1ZUQ A;  3QVN A;  3DC5 A;  4JYY A;  1MMM A;  1EN6 A;  2P4K A;  1GN6 A;  3MDS A;  4JZ2 A;  1P7G A;  1ZLZ A;  2RCV A;  1Y67 A;  1IXB A;  1JR9 A;  1MSD A;  3RN4 A;  1B06 A;  1EN5 A;  4C7U A;  1N0J A;  4FFK A;  3KKY A;  1BS3 A;  3C3T A;  4F6E A;  3OT7 A;  3DC6 A;  5A9G A;  1AP5 A;  1MNG A;  1N0N A;  3BFR A;  1AVM A;  1PM9 A;  1GN4 A;  1ZTE A;  2GDS A;  3AK2 A;  1KKC A;  4BR6 A;  1WB8 A;  4JZG A;  1AP6 A;  3AK3 A;  3TJT A;  1VAR A;  2ADP A;  2QKC A;  3AK1 A;  2CDY A;  1BT8 A;  1XIL A;  1IDS A;  3EVK A;  3IC9 A;  1XUQ A;  1XRE A;  1EN4 A;  1PL4 A;  1BSM A;  4YIP A;  1D5N A;  1VEW A;  1ZSP A;  1I0H A;  2ADQ B;  4E4E A;  1XDC A;  1GN2 A;  1LUV A;  1SZX A;  1JA8 A;  1LUW A;  1WB7 A;  4YIO A; 
#chains in the Genus database with same CATH topology
 2ETN A;  1XL4 A;  4YY3 O;  3W7X A;  1KC8 W;  5GON B;  4YJ2 B;  2IBZ H;  3AG7 A;  3FB6 C;  3OGC C;  1T5E A;  5TIS Z;  3WU2 Z;  3MHH C;  3MHS C;  1F51 A;  1X59 A;  2KQX A;  3SPH A;  4B3S O;  1MG1 A;  3L9D A;  3CCE V;  2ATK C;  3AG2 B;  2YEV A;  4MT8 A;  1NR7 A;  3ABM B;  2YXL A;  1M56 B;  4BW5 A;  1GN6 A;  1GO3 F;  1M5I A;  4LFB O;  1FAF A;  2ZE5 A;  3ZHV A;  4MVM A;  3CCV V;  1KUQ A;  5LMN B;  3A0R A;  1J5E B;  3DXR B;  4UCR A;  3W7T A;  3AG1 B;  1VQ8 V;  4JYB A;  1DF4 A;  1AB3 A;  1RSO A;  2GTS A;  1B3Q A;  2ZE8 A;  2UXD O;  2HG5 C;  3C3T A;  4MVU A;  4B3M B;  1HWY A;  5LXT B;  3T4D A;  2AHZ A;  4KFM A;  2LO1 A;  4O4H A;  1K5Q A;  2QGN A;  1FFT B;  5LBQ A;  5CBF A;  2ITD C;  5LP6 C;  3JAS A;  2P67 A;  3P32 A;  5J9P C;  2WLH A;  5LOV A;  4YXW G;  1OCC B;  4O4L B;  4UVC A;  1EFR G;  2DJV A;  3OFN G;  3BVO A;  4DXW A;  3UM7 A;  2N04 A;  2YI8 A;  5LYJ A;  1O9G A;  3RWR D;  5EIB D;  3ZRX A;  3HKE B;  4LF9 B;  1KKD A;  2OTL V;  4YJ3 A;  1EM1 A;  4MW8 A;  2YI9 A;  5IJ9 A;  1G8M A;  2Y0I A;  4NVP A;  4JI3 O;  2WSS G;  3LSQ A;  2C2A A;  3ZRW B;  1N34 O;  4L87 A;  3ML0 A;  4K8Z A;  1VQO V;  4MVO A;  1SQX H;  1GN3 A;  4TUY B;  5FPO A;  5KHI A;  2W6I G;  1YF2 A;  4DO2 A;  5LMU B;  2LJ2 A;  1XNQ O;  4I4T A;  1M57 C;  1IXM A;  5BXZ A;  1P7B A;  2P7T C;  2FML A;  2LQT A;  3X2Q C;  3RYH B;  4WFB V;  4JI1 B;  2DYR B;  2OIG A;  4LFC O;  1U96 A;  4CBC A;  1YDX A;  3OGI B;  1FFX A;  3OEH G;  3OMI B;  1B06 A;  4KHP O;  1Q6U A;  1ROP A;  1EN5 A;  3APO A;  3IJ4 A;  2YIB D;  3KKY A;  4H13 B;  4Q6G A;  1CPY A;  3JSN A;  2JVD A;  5A2Q N;  1HNX O;  3B09 A;  2HHH O;  4X20 A;  2QWO B;  3L74 H;  2ZM6 O;  1COW G;  3L75 H;  4JI6 O;  4GX2 A;  4TQF A;  4DR6 O;  1F23 A;  1WB8 A;  2UU9 B;  4F6R A;  4DUZ O;  4AI8 A;  1ORQ C;  4P30 A;  4FFB B;  3KCX A;  2G38 A;  1XEQ A;  4JI8 B;  1OJH A;  2YC0 A;  4TT3 G;  1FYJ A;  1I7F A;  2XHB A;  1TUB A;  4NXN B;  2P90 A;  3FKS G;  1GN2 A;  4K0K O;  3QO8 A;  4HNA B;  2OIE A;  1K92 A;  1JPX A;  2DE0 X;  3K06 A;  3FD9 A;  4PA4 A;  3JCZ A;  3B2E E;  1AJN A;  4BIO A;  1BE3 H;  4DV6 O;  3JAT B;  2Y48 A;  2UXN A;  4DR7 O;  1R3J C;  2CTR A;  4X64 B;  4RUF A;  4H37 A;  4IL6 Z;  1GM8 A;  2Q0A A;  4MTG A;  5B3S C;  3H9V A;  2ZT9 B;  1XMO O;  4LF4 B;  2E75 B;  3OR6 C;  4ZBM A;  4BWA A;  5IYC O;  1DK1 A;  1AR5 A;  4MW3 A;  4I50 A;  3S3X A;  5LA6 A;  3F7Y C;  4G2K A;  2IU3 A;  1VP7 A;  1TGO A;  5KX5 A;  4H44 B;  4FLV A;  3HKD B;  1FXV A;  1THZ A;  3NR7 A;  1V54 B;  3ABL C;  2X6C A;  1Y67 A;  1G6U A;  3CRC A;  4U3F H;  4DYL A;  4EKW A;  1QLE B;  1SQV H;  4PD4 F;  1N0J A;  5JH7 A;  2F95 B;  4F6E A;  1KQS U;  3PJS K;  4I0X A;  4LFA B;  5A9G A;  4X1I A;  4LF7 B;  2V4D A;  1UPG A;  4JI5 B;  4JI7 O;  3QO7 A;  4IT5 A;  4LF6 B;  1F4N A;  1S5L Z;  2Y0P A;  1NKD A;  3HKC A;  5L3C A;  2UUB B;  2A06 H;  4LF5 B;  3JD0 A;  4PV1 B;  1FXK A;  4NXM O;  4JTA B;  4JI2 O;  3WG7 B;  2QKS A;  4P2Z A;  3IC9 A;  1XUQ A;  1WA8 A;  1R6K A;  4JYC A;  1N33 O;  2Q0O C;  1SA0 A;  1I0H A;  2ADQ B;  2EZO A;  3CWB H;  4O4H B;  5K1X A;  3BHP A;  4O2A A;  2UUA O;  3JAS B;  3JAL A;  5EIB C;  4QPK A;  4X66 O;  4FM0 A;  1GMG A;  2F43 G;  1Q6I A;  3RVZ A;  1NTM H;  1RM1 C;  3LSU A;  3BY6 A;  3HKB B;  2CGN A;  3QNE A;  4QE7 A;  2DOS A;  2JRI A;  2CH7 A;  2L35 A;  3CCJ V;  4K35 A;  1U97 A;  2GHY A;  3SYA A;  1VQP V;  2E5L B;  1SRY A;  3R65 A;  3RYF B;  4XDL A;  1WAZ A;  2WLI A;  4LF8 B;  4W4L A;  4JYY A;  1L1F A;  5DM6 V;  2ZNJ A;  1VQ7 V;  4FLW A;  2O57 A;  4UV9 A;  4YJ3 B;  2ZIN A;  5IE9 A;  5IJ9 B;  4JZ2 A;  1SQP H;  1NI8 A;  4JV5 O;  5B1B C;  2MK3 A;  2XUM A;  4NTX A;  5J2U A;  2IJK A;  2EIJ B;  5EBL C;  2Q7G A;  4CH3 A;  5KMG A;  5B1A B;  3K5L A;  1SC5 B;  4P9O A;  1WN7 A;  5JCO A;  4FVM A;  2BTO A;  2WLM A;  2CUG A;  3CRM A;  2CTP A;  4G27 B;  2XAS A;  2B1I A;  1ZTE A;  2F66 C;  2LFR A;  4QE9 A;  1R1B A;  3SGI A;  2AZ2 A;  2VQF B;  4DR5 O;  1M4U A;  1FFX B;  1DGS A;  5EC2 C;  3CS5 A;  2XAH A;  5BMV B;  3AEI A;  5GW7 A;  1IBM B;  1IUR A;  1Q8I A;  3CCU V;  1Y76 B;  4IIJ A;  5CA0 B;  1OCO B;  4X20 B;  1SQB H;  3I55 V;  5BR8 B;  2ZDI C;  1QBZ A;  3SR2 C;  2W0X A;  3E8G A;  2EIM C;  3W7U A;  3UT5 A;  3K3W A;  1K4D C;  4B3T O;  1RPO A;  2WLK A;  1WB7 A;  1Q81 W;  3VQV A;  4YIO A;  3K79 A;  2QKA A;  2ZR3 A;  5L3G A;  4X65 O;  1I08 A;  2IU0 A;  5CBG A;  3CRR A;  4B3R O;  1FXH A;  5EYP A;  3ZIA G;  1E1R G;  2HKO A;  1R6T A;  2XND G;  5IY5 C;  2XT9 A;  1FS0 G;  5C8Y A;  1JX9 A;  2FTK A;  2BOC C;  1FOU A;  1HR0 O;  2Q69 A;  1O9H A;  4D7S A;  2FB5 A;  3G6B A;  5IYD O;  4GKK B;  4DW0 A;  2X6A A;  3F5T A;  3J80 N;  2LFS A;  1OZ0 A;  4NTW A;  1MMM A;  4B7K A;  4DV0 B;  1SZT A;  3OM3 B;  3ZS8 C;  5LGU A;  4WFA V;  4DV3 B;  1K97 A;  4TV9 A;  3JAK A;  3B8N A;  2LGW A;  3CCQ V;  2ODM A;  1IXB A;  5HFL A;  4TWK A;  1KEC A;  4YHH B;  4DV7 O;  2GUZ B;  4HBN A;  4G28 B;  4I50 B;  1ZL8 A;  4K3A A;  2WA3 A;  4RUE A;  5LHI A;  1SS3 A;  2P6J A;  1WLE A;  1Q5O A;  2QM8 A;  5KX5 B;  3ZN1 A;  1H2K A;  3K5O A;  1M90 W;  2QWP B;  2EX3 A;  5K1P A;  2EIN B;  2QWR B;  3OD4 A;  5CMU A;  1AJQ A;  3CME V;  3FFQ A;  3SJQ C;  3CCS V;  1BMF G;  1WNS A;  4GKJ B;  5IWA O;  4LH7 A;  4I0X B;  4DR3 O;  1S72 V;  4LC1 A;  4RO2 A;  4X1I B;  1K34 A;  2CK3 G;  3UKM A;  3ZED A;  2BTQ B;  1MZF A;  4JI0 O;  2F4V B;  3ZHS A;  4X62 B;  1FXK B;  1VF5 B;  3JAW B;  2YS8 A;  5GTI Z;  3TET A;  4MS2 A;  3LDD A;  2EIL B;  2R72 A;  2CAZ C;  5KAI Z;  1WA8 B;  5JJE B;  4CS2 A;  3G71 V;  2XAG A;  2PUS A;  2QSA A;  1SA0 B;  2VQE O;  1LNQ A;  2YSU B;  4MSW C;  3C3S A;  4OPH A;  3SJB C;  1S77 D;  2KKW A;  2PI5 A;  4LFB B;  1P49 A;  3E22 A;  4R6Z A;  1IVS A;  4O2A B;  1BHB A;  3OTO B;  3JAL B;  2EJR A;  1BCC H;  3TGU H;  3G6E V;  2UXD B;  1F4M A;  1LR1 A;  2KSD A;  2HVJ C;  3ZRS A;  2CGO A;  4DV2 O;  1EBO A;  5EK0 A;  2E76 B;  4I55 A;  2CH7 B;  3H1I H;  1YSC A;  1MSD A;  2RJZ A;  5H9C A;  2GV9 A;  3PN1 A;  3NXS A;  4CC6 A;  2WLI B;  2PI4 A;  3K9A A;  2ZXW C;  4L8J A;  3JD2 A;  3WB2 A;  1K7D A;  4ZIB A;  1XNR O;  1QQC A;  2HJF C;  4JI4 O;  1HNW B;  2IJJ A;  4PDR A;  1OCZ B;  3TJT A;  2JGD A;  3A8T A;  1KU9 A;  2QJ1 A;  5L3F A;  4TOI A;  5KMG B;  3T1Y O;  1Z5W A;  4WF9 V;  2R70 A;  1IBL O;  3H1L H;  1M93 A;  2UUC B;  1K9M W;  4D6T H;  4NR1 A;  4JI3 B;  3SYO A;  4DRX A;  2LW7 A;  5FNV B;  1Q43 A;  1N34 B;  1QVF U;  1Q6H A;  1BL8 A;  2QEX V;  3L71 H;  3SYQ A;  1V55 B;  3K9S A;  4UXN A;  2K9P A;  3D36 C;  2A9H A;  3OE7 G;  5B66 Z;  3E86 A;  1KYO F;  1H2S B;  3UO3 A;  3UT5 B;  2QWN B;  4J41 A;  3AG2 C;  1QNM A;  2FL4 A;  4WBN A;  4WFH A;  4J10 A;  4OX9 B;  3ABM C;  3VQY A;  2Z5U A;  1M56 C;  5IYB O;  2ZIM A;  4XDK A;  5EYP B;  1YHQ V;  4AHC A;  5LMN O;  3OAA G;  5IYZ A;  2PZS A;  5C8Y B;  3B8M A;  2F93 B;  1V9P A;  4O4I A;  2LP7 A;  3BAB A;  4DR6 B;  3RN4 A;  2FKX A;  2V7Q G;  4KXR A;  3CCL V;  3AG1 C;  1N32 B;  4B3M O;  4DUZ B;  2IW5 A;  1Y6X A;  2B5U A;  2MW2 B;  4A5U B;  1H38 A;  4DV5 O;  2EBO A;  2XAF A;  4TV9 B;  1Q82 W;  2YIC A;  4LNU A;  3JAK B;  4CS4 A;  4MTX A;  4AQY B;  3QG5 A;  1CXZ B;  4K0K B;  5L3B A;  4UCO A;  2KB1 A;  3EVK A;  2IJH A;  1ZL8 B;  4O2B B;  3HB3 B;  1PL4 A;  3CX5 F;  2WWW A;  1D5N A;  4LP8 A;  4OGQ B;  1YI2 V;  4GX5 A;  1OCC C;  3TK1 A;  3K58 A;  3QTC A;  2UXB B;  4LF9 O;  1XMQ B;  1I5Y A;  2NNU A;  2Q67 A;  5AG2 A;  3BAA A;  1R3L C;  1DF5 A;  2DW4 A;  2AZ0 A;  2QM4 A;  4I9Q A;  4DR2 B;  5DED A;  4ABM A;  2PYL A;  3ASN B;  3EHB B;  1R3K C;  4JPR A;  5LMU O;  4NB5 A;  1S5H C;  1HP8 A;  1YJN V;  3GB7 C;  1KB9 F;  3ASO B;  2Y69 B;  2EIK B;  4EB6 A;  4JI1 O;  2DYS B;  4GT1 A;  3VQX A;  2YDE A;  3ZHR A;  3E83 A;  3K0D A;  5B1N A;  2B9Z A;  2Y4T A;  1KP3 A;  3MDS A;  1QCE A;  2RDC A;  2QTO A;  4WFF A;  2DYR C;  4J80 A;  1QU7 A;  4BIU A;  2JGU A;  4MTF A;  3E22 B;  1GM7 A;  5GTH Z;  3JAR A;  1K8A W;  4DUY B;  1QVG U;  3AG3 B;  3JAM N;  1IBK O;  1GKF A;  4WFG A;  2NLJ C;  4FM2 A;  2Q6A A;  3K08 A;  5ITZ A;  3ETQ A;  5EBW C;  1W0K G;  3ZMS A;  5DN6 G;  2QWQ B;  1N33 B;  3RT3 C;  1ARO P;  1TA8 A;  4I55 B;  1E79 G;  3T1H B;  2X7R B;  5KHJ A;  2YEV B;  3RVY A;  1GK9 A;  5BZB A;  4JI8 O;  3DTU B;  3K57 A;  1BQZ A;  4B08 A;  4PHZ A;  4NXN O;  4YIP A;  3ETG A;  1VQ9 V;  2ZE7 A;  1ZSP A;  3RBZ A;  4O4J A;  5EBM C;  3D8C A;  3ETD A;  4I9W A;  1PNK A;  1R73 A;  5H5N A;  1L8D A;  2GSM B;  1RSO B;  1VQN V;  1VF6 C;  1XOU A;  3T2M A;  3JYC A;  4IYI A;  3E8F A;  3JSL A;  2X0L A;  1VMG A;  5E1A C;  1GH6 A;  3WB0 A;  2ZR2 A;  2BOB C;  3ZCC A;  1MA1 A;  3SYP A;  5KHG A;  4JV5 B;  1SKV A;  4H33 A;  4DRX B;  3CCM V;  3OEE G;  1US6 A;  2RQ6 A;  1QLN A;  5FL7 G;  1FJG O;  4GCZ A;  1Q86 W;  3DC5 A;  2QDO A;  1VIB A;  4DV1 B;  4NTY A;  5LOV B;  2UXX A;  3CXH F;  4UFZ A;  1V54 C;  3M8A A;  2AHY A;  5EZY A;  4UCU A;  3ZN0 A;  4ZHQ A;  1H8H G;  3H1K H;  1JR9 A;  1AI4 A;  5LYJ B;  3AG4 B;  2HFE C;  2M7W A;  3OW2 U;  3CD6 V;  5LP6 A;  4LFA O;  4WBN B;  4DR5 B;  1QLE C;  4QGP A;  4YJ2 A;  3WB1 A;  1Y66 A;  3T4Z A;  1AIL A;  4JI5 O;  3A0H Z;  3K04 A;  4DV4 O;  4LF6 O;  1N36 B;  1GN4 A;  4LF5 O;  3B4S A;  3QO5 A;  3IGA C;  5KLV H;  5KAF Z;  1HNZ O;  3BRC A;  2IM9 A;  2Q7H A;  4JTD B;  3ZX6 A;  2PGG A;  4Z2W A;  1XBL A;  2JS3 A;  1NVP B;  1IDS A;  3WG7 C;  1PNM A;  3CHX A;  3JCU Z;  4TV8 A;  4U7O A;  2WPD G;  3CP1 A;  4X65 B;  4I4T B;  3SPG A;  3LDE A;  1ZX3 A;  1Y74 A;  1AJP A;  2CTW A;  1K3E A;  3E35 A;  1S0V A;  2Z0A A;  1KMI Z;  3DXR A;  4Q20 A;  3TXS A;  5LGN A;  1TVK A;  2ZKO A;  4DW1 A;  5DEC A;  2Q4P A;  4ZOL A;  3G4S V;  5KUK A;  2AW9 A;  1BQ0 A;  3A0B Z;  3CXC U;  2WLJ A;  2BSK A;  3CRQ A;  1W2B U;  1I94 B;  1OV9 A;  5LXT A;  4UCS A;  4PA7 A;  4LCU C;  3FAV A;  4EEQ A;  3ABK B;  2F23 A;  4UV8 A;  1S76 D;  4PA3 A;  2OCC B;  3ICX A;  4JAV A;  4ASU G;  2Y4U A;  2JDI G;  4OPA A;  2E5L O;  1HW7 A;  3CMA V;  4F6R B;  1Z2G A;  4LF8 O;  2EJ7 A;  3S3W A;  1GTO A;  1XQ8 A;  3RYC A;  4DV7 B;  1IZ3 A;  4X8A A;  1NTK H;  4O4L A;  1WP8 A;  4UVB A;  4HZ3 A;  1Q90 D;  2M6Y A;  5JVD A;  2RMK B;  5C93 A;  4KP4 A;  1OCR B;  3STZ C;  1JCH A;  2H3O A;  2DWD C;  2EZP A;  1E1Q G;  1N4C A;  1TUB B;  3CE2 A;  1GM9 A;  2R9R B;  5B5E Z;  2EIJ C;  4GX1 A;  3UQ8 A;  1AR1 B;  2L6L A;  1Q7Y W;  5B1A C;  5JWP A;  1L0N H;  3SPJ A;  1BS3 A;  4EB6 B;  4PDL A;  1PL0 A;  2VQF O;  1CEZ A;  1S3J A;  5IWA B;  4GZR B;  2XAQ A;  4DR3 B;  3ZRW A;  4JYA B;  3P30 A;  4D7T A;  1Z5V A;  1IBM O;  1GRJ A;  4E2L A;  3AK1 A;  3GWO A;  4GLX A;  1YZB A;  3ZHU A;  1VQ5 V;  3CPW U;  1JQ0 A;  2N74 A;  3JAR B;  2QR4 A;  4FZ0 A;  5LA6 B;  5BR8 O;  1H5W A;  2UXC O;  5BY1 A;  3HR0 A;  3RYH A;  3CCR V;  1OCO C;  5ITZ B;  4CH6 A;  3LNN A;  1XHZ A;  1SZX A;  1H2M A;  4FJC C;  4MVS A;  2ZNI A;  4FIP C;  4HAM A;  2Q5Z A;  4RWU A;  5JH7 B;  2RNB A;  2WAM A;  4YY3 B;  2Q68 A;  3Q4H A;  1JFF A;  1YTF B;  4XDJ A;  4GKK O;  1WP7 A;  4O4J B;  5HFM A;  5JQG A;  2R9A A;  2LW1 A;  3IFX A;  3HKC B;  2ZIO A;  4DV2 B;  1YEW A;  3RFR A;  1IX9 A;  5H6R A;  2A3Q A;  2ZD9 A;  1K33 A;  2ILM A;  3EXA A;  1ZUQ A;  4FFB A;  3HPL C;  4DV0 O;  4B3S B;  4DV3 O;  5FPR A;  4UCT A;  1EN6 A;  5IDJ A;  5CA1 A;  1VQL V;  4U3J A;  4YHH O;  1Q3E A;  4MVQ A;  4LWS A;  4HNA A;  4WCE V;  1NQT A;  1XNR B;  1PKX A;  3H1H H;  1XI1 A;  1QR9 A;  3U10 A;  3N2G A;  4DR4 O;  3SJC C;  1YJ9 V;  2V1D A;  2GBO A;  3OT7 A;  5KHK A;  3ZHQ A;  3K5N A;  1AP5 A;  1MNG A;  2P22 C;  2F1M A;  4OXS A;  3LUT B;  3FYE B;  2GDS A;  3TXQ A;  1D2D A;  2Q8V A;  4DR1 O;  4N21 A;  3MAQ A;  5EZY B;  1IBL B;  2EIN C;  2Z3Y A;  4ZHQ B;  1FPO A;  5LP6 B;  4RQE A;  1AI5 A;  1EN4 A;  4PA6 A;  1BSM A;  4UUJ C;  3STL C;  2DMX A;  3TCU A;  2F4V O;  3HKD A;  4X62 O;  3MD0 A;  3KG2 A;  2AGA A;  4FMT A;  1XDC A;  2D2C B;  2EUL A;  4IYH A;  4PI0 A;  5J2U B;  5B1O A;  1FXK C;  1PV0 A;  2YIA A;  2A79 B;  2EIL C;  5H6Q A;  3CEI A;  4TV8 B;  3ZRV A;  2KG7 A;  2NR5 A;  1R3I C;  1M1K W;  4X1Y A;  5D5Q A;  1Y74 B;  4BIZ A;  1G1X B;  4X1K A;  3T1C A;  1N8R W;  3OTO O;  1KD1 W;  2YUA A;  1IJG A;  1NZ6 A;  4JTC B;  1TVK B;  1F7Y A;  4I5S A;  1NU1 H;  1JMK C;  4ZOL B;  3B77 A;  3O9O A;  1KP2 A;  4X88 A;  1WPX A;  4CC5 A;  1JNB A;  1M57 B;  1J95 A;  2BSK B;  3UCS C;  3CC2 V;  3L70 H;  2YIB A;  4JAA A;  3FAV B;  4IIJ B;  3X2Q B;  1XNQ B;  4Z1M G;  3KZI Z;  2VWK A;  2Q9L A;  1DTO A;  2RCV A;  5LL6 Y;  3I56 V;  4DV5 B;  4RAI A;  1SQF A;  3F5W C;  5KHH A;  4LFC B;  4MVZ A;  3E89 A;  4FFK A;  3RYC B;  4FLT A;  1KBH A;  2N05 A;  2ZE6 A;  4KHP B;  1HNW O;  3ZMZ A;  1PM9 A;  3CJH A;  2ZDI A;  3HKB A;  2WLL A;  5JVD B;  1J5E O;  1K5S A;  4BR6 A;  4BW9 A;  1HNX B;  1SF9 A;  4TSF G;  2HHH B;  1OCZ C;  2ZM6 B;  4DK1 A;  1P84 F;  2QKC A;  4JI6 B;  4RQF A;  1XIL A;  3GWK C;  2JK5 C;  3VOU A;  2QA4 V;  3L72 H;  4N23 A;  3RYF A;  1ENV A;  5CN0 A;  1AI7 A;  2ZQM A;  3CYO A;  5JCO C;  3K5M A;  1VF7 A;  4XBF A;  2UUC O;  4ICG A;  3QF7 A;  3ZHT A;  1H2N A;  1JJ2 U;  3KDR A;  1FKA O;  3RYI A;  2FYU H;  3QVN A;  4EFE A;  3BPZ A;  3OTF A;  1NT2 B;  1I5X A;  3RW0 A;  2OTJ V;  2W0F C;  3THO A;  2GTA A;  1V55 C;  2P06 A;  1FD9 A;  4DV6 B;  1XL6 A;  4DR7 B;  5B3S B;  3K59 A;  2DQ3 A;  4IGG A;  3IAY A;  4OX9 O;  2DQ0 A;  3BEH A;  4F4L A;  5BMV A;  1HDJ A;  5E79 Z;  1K73 W;  1XMO B;  1QR8 A;  5L3D A;  4J9Y B;  1Y76 A;  2HJD A;  5CA0 A;  2P4K A;  2QM7 A;  3FB7 C;  4J11 A;  3Q4H B;  4JF3 A;  1JFF B;  2VWJ A;  1IBK B;  3BA8 A;  4LH6 A;  5JQG B;  3M7M X;  3J81 N;  3ABL B;  1N32 O;  4I7Z B;  1W59 A;  3VBB A;  2WLN A;  3C90 A;  4ZKI A;  3O65 A;  1UFI A;  2HP8 A;  4C7U A;  3OR7 C;  3K03 A;  5KA6 A;  2YXH A;  5IJ0 A;  3BFR A;  3BCC H;  1AVM A;  5CA1 B;  3ZJZ A;  4U3J B;  3ZBH A;  3K0G A;  4AQY O;  1BZK A;  3SDL A;  4ZI7 A;  2JS5 A;  4LWS B;  1NVP D;  3A2F A;  1AI6 A;  5J2T A;  4JI7 B;  2Q7E A;  3N2G B;  1URF A;  3CRA A;  3LDC A;  2JJ1 G;  3D3I A;  3SPI A;  1JVM A;  5H2F Z;  4Z1V A;  2OYQ A;  2IJI A;  1XRE A;  4NXM B;  2PTM A;  4JI2 B;  3JD3 A;  3SPC A;  5LHH A;  1NH2 D;  3FX7 A;  3APQ A;  2UXB O;  2UU9 O;  1YVW A;  1SET A;  3IC7 A;  2H94 A;  1XMQ O;  2VS0 A;  5KA5 A;  1M9N A;  2QE7 G;  4FK5 C;  3N2K A;  1R6N A;  3CSX A;  2GUZ A;  3ABU A;  4DR2 O;  2PY5 A;  1SQG A;  2PF4 E;  3G80 A;  1SER A;  3L73 H;  2RN9 A;  2CE4 A;  1RFY A;  1RM1 B;  2X6B A;  2UUA B;  4GUN A;  1FJG B;  3ASN C;  1ZAU A;  4UB6 Z;  5CB4 A;  4X66 B;  3LNM B;  1BGY H;  5IT9 N;  4FZ1 A;  2XOK G;  2BE3 A;  4FLX A;  1CP9 A;  2JGD B;  4W4K A;  2VRZ A;  4X64 O;  4CZZ A;  1H2L A;  4PI2 A;  3ASO C;  2Y69 C;  2EIK C;  4PDV A;  4QIW F;  2DYS C;  2KG7 B;  4J9Z B;  5CBH A;  1G4Y B;  4X1Y B;  5LGT A;  4DV4 B;  4LF4 O;  4UCV A;  3R66 A;  2BTQ A;  5B1B B;  2BCC H;  1TAE A;  1ZLZ A;  4X1K B;  4DUY O;  1A32 A;  1EZJ A;  3JAW A;  1HNZ B;  4MVR A;  4FPP A;  5KUM A;  1NTZ H;  4WFE A;  1L0L H;  3FYI B;  3AG3 C;  1W0J G;  3DC6 A;  2XAJ A;  1N0N A;  3P3N A;  4HYO A;  4IHJ A;  3U0Z A;  3N27 A;  3M99 B;  3T1H O;  4PJ0 Z;  1SQQ H;  1VQ6 V;  1B04 A;  2ADP A;  1VQ4 V;  5L3E A;  2CDY A;  2OCH A;  1BT8 A;  1NBM G;  1H2G A;  1D5A A;  3CB2 A;  5GON A;  3SJA C;  1NS1 A;  2CTQ A;  3E8H A;  4LF7 O;  3WFV A;  2HR3 A;  3D36 A;  1VEW A;  4U7N A;  1B6Q A;  3CJH B;  3DSQ A;  2UUB O;  3W7S A;  3J7A U;  2WLL B;  2P4V A;  5IYZ B;  2A0L A;  2EIM B;  2JEX A;  1YJW V;  4O4I B;  3H1J H;  1RPR A;  2B1G A;  4MTO A;  4R50 A;  3U11 A;  2IH3 C;  1TUE B;  4J7K A;  4B3T B;  4J7Z A;  1MOF A;  1YTF D;  2D3O W;  5IY5 B;  4FLY A;  1WJZ A;  4B3R B;  3E8B A;  2QTS A;  4BAY A;  2DN9 A;  4DK0 A;  1NH2 B;  4PA9 A;  1ZWI C;  1WPB A;  2YID A;  3GVM A;  5JJN B;  1Y4M A;  4LNU B;  3RYI B;  3W7W A;  4EFB A;  4R7C A;  4K8X A;  4UB8 Z;  4DV1 O;  1HR0 B;  1UJW B;  3KCY A;  5F2V O;  4B7E A;  4QJF B;  1MAB G;  5LHG A;  4H0L B;  1DLB A;  2JJ2 G;  1PNL A;  3VQW A;  1YXB A;  2WA4 A;  1MSW D;  1P7G A;  2LGQ A;  3FB8 C;  4LBE C;  2ITC C;  1SES A;  3I5D A;  5FNV A;  3AG4 C;  1JOY A;  3JD4 A;  1MZE A;  2OT5 A;  1N36 O;  4QPJ A;  4JGS A;  4UVA A;  1PP9 H;  3ZMV A;  4NKG B;  4P9P A;  4KL1 A;  3BA9 A;  2UXC B;  5EC1 C;  4FLU A;  3EFF K;  3HKE A;  3D3Q A;  4JAU A;  1VQK V;  2ZCE A;  1NJI W;  3FB5 C;  5CA3 A;  3ZMT A;  5IJ0 B;  5D5P A;  4E4E A;  1LUV A;  4TQD A;  4ZI7 B;  3RGB A;  3G67 A;  1LUW A;  4TUY A;  5J2T B;  2JEU A;  1I94 O;  2HEP A;  4CH4 A;  4JI0 B;  2DWE C;  2Q73 A;  4J42 A;  4LR3 A;  4JAS A;  3OUF A;  3DGE A;  5JJJ B;  1AR4 A;  3ZMU A;  2NN4 A;  1PPJ H;  3ABK C;  2W6J G;  4FLZ A;  2HVK C;  2K1E A;  2OCC C;  3LSS A;  3F7V C;  1X4T A;  3CC4 V;  4FM1 A;  4NYK A;  3N2K B;  4X9Q A;  2PYJ A;  4CS3 A;  3ETE A;  2VQE B;  1NR1 A;  2IH1 C;  4PEL A;  4O2B A;  4X89 A;  4AIL C;  1YIJ V;  4QNH B;  4DR4 B;  1RP3 B;  1GAX A;  3B40 A;  2P5O A;  1K4C C;  4GYC B;  5CB4 B;  1PD3 A;  1OCR C;  2ARH A;  2R9I A;  4DR1 B;  1P4R A;  4CH5 A;  1YCI A;  3H01 A;  3OMA B;  1BHA A;  3P3P A;  1YIT V;  2E74 B;  3UO2 A;  1JJO A;  1S5J A;  2ZXW B;  4JYA O;  5FLX N;  2HLD G;  3SYC A;  1EZV H;  3AK2 A;  1KKC A;  4GX0 A;  4JZG A;  1AP6 A;  3AK3 A;  2E3C A;  4PDM A;  1VAR A;  2AXT Z;  1OHH G;  4R8C A;  4JI4 B;  2H8P C;  3E2E A;  1VQM V;  2XTA A;  3JAT A;  1VF6 A;  4IHJ B;  2OWO A;  3CC7 V;  3ABT A;  3T1Y B;  2A7W A;  3OUS A;  1H8E G;  1QHT A;  2JIZ G;  3JD1 A;  2YXY A;  1XHX A;  4J7J A;  1JA8 A;  4KUM A;  4GKJ O;  3OMN B; 
#chains in the Genus database with same CATH homology
 2QKA A;  5AG2 A;  1I08 A;  2AW9 A;  3CEI A;  2CE4 A;  3K9S A;  1AR4 A;  1EM1 A;  4GUN A;  3LSU A;  1MA1 A;  3C3S A;  4X9Q A;  1QNM A;  1GN3 A;  1IX9 A;  1AR5 A;  1ZUQ A;  3QVN A;  3DC5 A;  4JYY A;  1MMM A;  1EN6 A;  2P4K A;  1GN6 A;  3MDS A;  4JZ2 A;  1P7G A;  1ZLZ A;  2RCV A;  1Y67 A;  1IXB A;  1JR9 A;  1MSD A;  3RN4 A;  1B06 A;  1EN5 A;  4C7U A;  1N0J A;  4FFK A;  3KKY A;  1BS3 A;  3C3T A;  4F6E A;  3OT7 A;  3DC6 A;  5A9G A;  1AP5 A;  1MNG A;  1N0N A;  3BFR A;  1AVM A;  1PM9 A;  1GN4 A;  1ZTE A;  2GDS A;  3AK2 A;  1KKC A;  4BR6 A;  1WB8 A;  4JZG A;  1AP6 A;  3AK3 A;  3TJT A;  1VAR A;  2ADP A;  2QKC A;  3AK1 A;  2CDY A;  1BT8 A;  1XIL A;  1IDS A;  3EVK A;  3IC9 A;  1XUQ A;  1XRE A;  1EN4 A;  1PL4 A;  1BSM A;  4YIP A;  1D5N A;  1VEW A;  1ZSP A;  1I0H A;  2ADQ B;  4E4E A;  1XDC A;  1GN2 A;  1LUV A;  1SZX A;  3KDR A;  1JA8 A;  1LUW A;  1WB7 A;  4YIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...