1SZXA

Role of hydrogen bonding in the active site of human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGFGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Role of hydrogen bonding in the active site of human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1szxA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1szxA02
1N0JA 4GUNA 1IDSA 1Y67A 3OT7A 2ADPA 2CDYA 4F6EA 1ZUQA 1ZLZA 1JA8A 1BSMA 1XILA 3C3TA 1SZXA 1IX9A 3RN4A 3DC6A 5AG2A 1ZSPA 1MMMA 1AVMA 2GDSA 1BT8A 1VARA 3AK3A 1GN2A 1WB8A 1GN4A 1KKCA 2CE4A 2RCVA 1MA1A 1WB7A 3K9SA 4X9QA 1LUWA 1GN3A 3EVKA 3AK2A 1EM1A 3BFRA 1I08A 1PM9A 4JYYA 1VEWA 1XUQA 1D5NA 3QVNA 3KKYA 1I0HA 1PL4A 3TJTA 1EN5A 4BR6A 1XDCA 2QKAA 3C3SA 1ZTEA 3LSUA 1XREA 1AP5A 1AR5A 3CEIA 2ADQB 3IC9A 1LUVA 2AW9A 4JZGA 1QNMA 4E4EA 1EN4A 4YIOA 2P4KA 1MNGA 1B06A 4JZ2A 1N0NA 2QKCA 4FFKA 1IXBA 1EN6A 1JR9A 4YIPA 5A9GA 1MSDA 4C7UA 3AK1A 1BS3A 1P7GA 1GN6A 3DC5A 1AR4A 1AP6A 3MDSA
chains in the Genus database with same CATH superfamily
2HVJC 1P84F 3W7SA 2CGNA 3STLC 1FXKB 2FYUH 1FFXA 1R6NA 1SQGA 1S76D 2CH7A 4W4KA 3U10A 3KG2A 3A0HZ 2RDCA 4W4LA 2CUGA 4NTYA 4YY3O 3C3TA 3UT5B 5CA0A 1IZ3A 1K5SA 4JAUA 2WAMA 4X1IA 1AVMA 1FJGO 1XBLA 2NLJC 2QM7A 4JI4B 4DUZB 4MW8A 1TVKA 1WLEA 5J9PC 2QDOA 2ZIOA 3FB7C 3L70H 5FLXN 2IJHA 4MVQA 1FXHA 4LF4O 4G28B 3RVZA 1M93A 4TV8B 4YXWG 4O4JB 3CMAV 3E8HA 4F4LA 5F2VO 3VQVA 1K92A 2PYJA 4PHZA 5IWAB 4B3RB 2X6BA 4HBNA 4X66O 3J7AU 4GX5A 5KHGA 1FAFA 5L3CA 1JMKC 1FOUA 4JI7O 2UXNA 3CC7V 2ODMA 3JD2A 3KCXA 1OZ0A 1COWG 5JJJB 2JGDB 1EN4A 1Y6XA 3FAVA 1K8AW 1BL8A 1VIBA 2IU0A 4LF5B 5IY5C 3RYFA 4OX9B 4LNUA 1GRJA 2P22C 4RUEA 1QVFU 2M7WA 1HR0O 4B08A 1Q82W 4BW5A 4GYCB 3K9AA 1W59A 1GN6A 1Q7YW 1AR4A 3CJHA 3MDSA 1K9MW 1NJIW 2HR3A 5CBGA 4DV2O 2K9PA 1GH6A 1NKDA 5KMGB 3U11A 2EILB 1KP2A 2EIMC 1TUBA 2DMXA 1BHAA 2XTAA 4BIUA 3WB2A 1OCRC 2YC0A 4EEQA 1OCZC 3X2QC 4LCUC 2Q5ZA 4B3MO 5EIBC 3FB5C 4NXNO 2F23A 3CHXA 4X1YB 2A3QA 1G1XB 1XMOO 3ZN1A 1Z5WA 1ENVA 4LF9B 4PI0A 4JI1B 4QPKA 2Q0AA 3OMNB 4UCTA 4QIWF 3CRRA 2OCHA 4ZHQB 1P49A 2XHBA 4GT1A 3ZS8C 3SPHA 4XDKA 4GKJB 3JD1A 2VQEO 2JS5A 3SYCA 5LYJB 2BOCC 2QEXV 5J2UA 4UB6Z 4IIJB 2V7QG 4J80A 3OTFA 2PI4A 3W7UA 1E1RG 4JI2B 1NS1A 4HNAB 1K5QA 2HVKC 1IBMB 5JH7A 5EK0A 2P67A 2YXHA 4I4TA 3ABLB 2PUSA 4UFZA 2PY5A 1T5EA 3AG7A 3IC7A 2GUZA 2BE3A 2OTLV 4DW0A 4DRXB 3AG4B 5LGTA 4K8ZA 1R3JC 4PI2A 4WCEV 2AW9A 3P3PA 4JGSA 2P7TC 2YEVB 4PA6A 1VQMV 3UO2A 5CA0B 1YDXA 2YS8A 3H01A 3CCVV 1SQXH 4IL6Z 1BZKA 1TAEA 2WLLB 5LOVB 2UUCO 2Q7HA 2KG7B 5B1AC 5BY1A 2N74A 1BS3A 2FL4A 2YUAA 4PDRA 3DSQA 3DXRA 3CXCU 1H5WA 4B3TO 3VQYA 1AR1B 1Y67A 4MSWC 4YJ2B 2ETNA 2UU9O 4K35A 1WAZA 1XQ8A 1X59A 1Y66A 2BCCH 3RYHA 4I9QA 4MTGA 3OUSA 1XI1A 1AI7A 2ZR2A 3L72H 2BSKA 4F6RA 2LP7A 3CCJV 2EJRA 2Y0IA 4DR6O 5EYPB 2QA4V 4WFBV 3ASNB 2F4VB 2VWJA 2WA4A 3IAYA 2QR4A 3ASOC 1N36B 4J11A 5KUKA 3UO3A 4PV1B 1MA1A 3GVMA 3AG1B 2N05A 1K34A 4KHPO 2E74B 1I94O 1MABG 3JAMN 1WA8B 2EBOA 2HJDA 1EZJA 1RP3B 4AQYB 5B66Z 3HKBB 5H6RA 3HKCB 2ZM6O 1QU7A 3B09A 3CJHB 3LSSA 4JI0O 2ZD9A 4DR1O 4X62B 2PZSA 2QWRB 4I0XA 4B7EA 3K59A 4DR2B 2Q8VA 1SA0A 2X7RB 4D7SA 4WFHA 3T1HO 4LFCO 2JEUA 4QGPA 4QPJA 1I5YA 1YEWA 5BMVA 3LSQA 3QG5A 5BZBA 1IBLB 4UCOA 4E4EA 4FLWA 5LXTB 2AZ0A 4HAMA 1GM9A 5L3FA 4LWSA 1NH2B 2P90A 2PGGA 1FD9A 1VQ4V 1Q8IA 4U3JA 3K0GA 1RPOA 4Z1VA 4J7KA 1N33B 3ZCCA 3OMAB 1Y74B 4DUZO 5EIBD 5KUMA 2CTWA 1P7GA 4MT8A 2E5LO 3I56V 2Y69B 2H8PC 5B3SC 1VF6C 1M4UA 2RMKB 2JRIA 1E79G 1AI4A 4LC1A 5TISZ 4DV1B 4JASA 2D2CB 4N23A 3BEHA 4LF7O 3D36A 5J2TA 1R6TA 1KQSU 1W2BU 2DQ0A 1KYOF 3GB7C 4XDLA 2GUZB 4JV5O 3DC6A 2DN9A 3SJCC 3ZRWB 2P6JA 2DJVA 3LDDA 1JVMA 4FLYA 2WLIB 4UCVA 5LMUO 2ZXWB 1U96A 3K9SA 4LF6O 3FB8C 3ZMUA 4J9YB 1CP9A 1RM1C 4I55A 2Q4PA 4TQFA 4WFFA 4JI3B 1ZAUA 4FLVA 2QGNA 3OW2U 1F23A 2YXLA 3SJBC 3NXSA 1I08A 1OV9A 2WLNA 3FKSG 1S72V 3M8AA 4GKKO 3D8CA 1D5NA 2F93B 2RQ6A 1ZX3A 4P9PA 4KL1A 3TJTA 1XOUA 2LW1A 3OTOB 1Y4MA 3OE7G 3BPZA 3SDLA 4JI8O 4RO2A 4CS4A 5EZYA 1VF6A 4IHJA 1AJNA 4O2BA 2R72A 4K3AA 4YHHO 2PI5A 3N2KB 4FFKA 3W7TA 2V1DA 2CTPA 4GX2A 1S3JA 2XAFA 4AILC 2OIEA 4DV6O 1JFFA 1F51A 1AP6A 1JQ0A 3K5LA 4FM1A 2ZE7A 3UQ8A 1MZFA 3OGCC 4L8JA 2AZ2A 4FPPA 2BTOA 4LH7A 5ITZA 1VQLV 3CCUV 1IBMO 5CBHA 3EHBB 4MVOA 3ABMC 2EILC 4R8CA 4DV0O 4JYBA 3CSXA 4PDMA 1YF2A 3K04A 2IU3A 1IX9A 2MW2B 2JK5C 4I50B 1SQPH 4MVZA 4RQFA 2MK3A 2YIDA 1BT8A 2AXTZ 1VARA 3SYAA 3AK3A 3RFRA 4OPAA 5BMVB 4DV4O 3TK1A 4IGGA 5BR8B 2X0LA 3OEEG 3CRQA 4CBCA 2AGAA 3BABA 2BTQA 1Y76B 1H2SB 3W7XA 5GONA 5LHGA 4J7ZA 1PPJH 1GM8A 4DR7B 2YXYA 2EIJB 1QLNA 3ZIAG 4FM2A 3G71V 2FTKA 1DF5A 4JTAB 1WN7A 3ABKB 3IGAC 1M90W 4JAVA 4LFBO 5KHHA 4BWAA 2A9HA 4WF9V 2WLHA 2XAQA 3G6BA 1M5IA 1PL4A 1US6A 5IJ9A 2C2AA 4PA9A 2ZKOA 3NR7A 3OD4A 4R50A 4JYAB 4RWUA 3AG2B 3F7VC 1W0KG 3T1CA 3ETEA 5H5NA 4FMTA 1M1KW 3E8BA 3TETA 2P4KA 3ICXA 3T1YO 4UVAA 3AG4C 1SERA 2KB1A 2Y4UA 4ZOLA 4PD4F 3FB6C 3CRMA 3CP1A 3OAAG 2XUMA 4LR3A 3FX7A 5IYCO 1A32A 1BCCH 5LP6B 5L3DA 4L87A 4DXWA 1O9HA 1SQBH 2ZNIA 4LBEC 1D5AA 1YJ9V 3E89A 4PDLA 2Y0PA 5LBQA 4LFAO 1JA8A 2VS0A 4UCUA 3ETGA 5E79Z 3ABUA 2WPDG 4AI8A 2OYQA 2VQFB 4I9WA 4H0LB 1K33A 2Z0AA 2IJJA 5H6QA 3RT3C 3HB3B 4TUYA 2F95B 1JOYA 1HNZO 2XAJA 1KD1W 3JCZA 2CE4A 3CCQV 4IYIA 2GHYA 3HKDB 4NVPA 3WG7C 1FYJA 1FFTB 1I7FA 3D3QA 3E22A 1OCOB 2DYRB 3ZEDA 1K97A 3OR7C 2CK3G 1HNWB 4I7ZB 3ZHUA 2RJZA 3L74H 4JPRA 1YXBA 1JFFB 1OJHA 3H1HH 1CXZB 4DR5B 1DF4A 1V54B 2M6YA 3CE2A 4DV1O 3TGUH 5IE9A 5D5QA 4TQDA 4WFAV 5KAFZ 3JALB 1AI6A 2DWEC 4D7TA 1QNMA 3C90A 3RGBA 1L8DA 2ZQMA 1B6QA 3B77A 4TV9B 3SPGA 3KCYA 5E1AC 1S5JA 4WFGA 5FNVA 2W0FC 1KMIZ 2LW7A 3QF7A 1OHHG 4MTFA 3N2GA 3PJSK 3K79A 3LDCA 1XNRO 2K1EA 2LFSA 2WLMA 2EIKB 5B1OA 4JI3O 4Z1MG 5GONB 1NR1A 2V4DA 1PNLA 4ZI7A 4EFBA 1I5XA 4BIZA 2CDYA 4CC5A 1AILA 4X88A 4GZRB 2FMLA 3ZHVA 1V55C 1YJNV 4CH6A 3AG3B 1VP7A 1X4TA 5LMNO 4LH6A 3I5DA 2HHHO 1R6KA 5IJ9B 3FFQA 4GLXA 5AG2A 4NXMB 2X6AA 1K4CC 4R7CA 3TCUA 4JI6O 3TXQA 3FD9A 2QTSA 3JD0A 2WLKA 4O4IB 3E8GA 1Q43A 4UB8Z 2JIZG 1WPBA 1XHZA 2HLDG 1Q81W 4ZBMA 1BHBA 3JD4A 1ORQC 4WBNB 1M57B 1R3LC 3AK2A 3W7WA 4FLTA 3BFRA 1M56C 2AHYA 2BOBC 4O2AA 3KDRA 4FVMA 5CN0A 5BXZA 3LNMB 1XMQO 1QLEB 3RYCB 2YI8A 2UXCB 4DUYO 4DR3B 3ZHQA 1N4CA 3H1LH 3K3WA 5B1BB 1VQKV 4X64O 2UXDB 3CRAA 1P4RA 2EX3A 3RYIB 1H38A 4G27B 5EBMC 3B8MA 2UUBO 5LA6B 4TT3G 4FM0A 4O4HB 3LNNA 2JJ2G 4RUFA 2W6IG 5CA1A 4MVRA 3FYEB 2A79B 2CAZC 3UM7A 1HNXB 3P3NA 3PN1A 1FFXB 4DV3B 3OMIB 3CX5F 2CH7B 1FPOA 1P7BA 4BAYA 2ARHA 3K06A 4LF8O 3E35A 3B8NA 3E83A 1S0VA 2UXBB 2LO1A 3G67A 2H3OA 4QJFB 3WFVA 4F6EA 4MTXA 4X1IB 1VQPV 3CYOA 3VQXA 1KKDA 5EC2C 2A7WA 3ZJZA 2JDIG 1XILA 2WLJA 3F7YC 1TVKB 2P06A 5L3BA 3WU2Z 1Q6UA 4B3SO 3HPLC 2UUAO 4D6TH 4CC6A 4DV5B 2Q7EA 5JJEB 3OUFA 4PDVA 1XL6A 3QO7A 3CCRV 2DYSB 1N32O 3BCCH 1O9GA 5IYZA 2GV9A 3G80A 3EVKA 4CH5A 4DR4B 1WP7A 1H2LA 1PV0A 2QM8A 1NTMH 4KP4A 4PA7A 3CWBH 3LDEA 4KXRA 1J5EO 2NR5A 4X65O 1XUQA 1KBHA 4K0KO 3QVNA 3SPJA 3ZX6A 2N04A 1YVWA 2DWDC 1AJPA 3FAVB 5JQGA 3RYFB 2Z5UA 4LNUB 4JI5B 5KLVH 2EZPA 1QHTA 2R9RB 1PL0A 1LUVA 2CTQA 3SYPA 1S77D 1OCCB 4UVCA 3RWRD 1JJ2U 1B06A 3EFFK 4NB5A 2ZIMA 2KQXA 3CPWU 3ZMZA 3AG2C 1RPRA 3SJQC 3HKEA 1MSDA 4DV7B 1SQFA 1TUBB 2QKSA 2OIGA 3HR0A 3O65A 3K58A 2HFEC 1UFIA 1KB9F 3J80N 5CB4A 4J10A 2EULA 5KAIZ 3OT7A 1FXVA 2XASA 2Z3YA 3JASA 1GM7A 5B5EZ 5JCOC 1DK1A 1SETA 5IJ0A 1E1QG 4X89A 3IFXA 1BSMA 4X1KA 3RVYA 4DR5O 4JI4O 4GX1A 5LP6C 4RAIA 1G8MA 3SYOA 4AHCA 3CCMV 2R9AA 3GWKC 1MMMA 3BA8A 1NQTA 2JVDA 3CCLV 5J2UB 3BA9A 3JAKA 4ICGA 5IWAO 2OTJV 1WB7A 4B3RO 2Q69A 1ZL8A 2Q0OC 1JJOA 3JD3A 4NTXA 5JH7B 1FXKC 1FJGB 2YSUB 4I4TB 3SPCA 1RSOA 2R70A 4XDJA 1K3EA 5JVDA 3K03A 1VQ8V 1PM9A 4J9ZB 5L3EA 2QWOB 1VEWA 1F7YA 2FKXA 3APQA 1OCOC 2DYRC 5EBWC 4LF4B 4LF5O 4XBFA 4OX9O 3JARA 1XDCA 2JJ1G 3WB0A 2EIMB 4UV9A 5HFMA 3CCSV 4Q20A 3J81N 1OCZB 2Q9LA 4X66B 5K1XA 1H2KA 1MNGA 3DXRB 3R65A 2QWQB 5JCOA 1AJQA 4U3FH 4JI7B 2DQ3A 1QQCA 4X20A 5CBFA 2ZE6A 3JAWA 1S5HC 3RYHB 1J95A 2VWKA 1PNMA 3MAQA 1UPGA 1N0JA 1L1FA 2BSKB 4F6RB 4MTOA 4ZKIA 1HR0B 4LF9O 3THOA 4JI1O 5KX5A 1ZUQA 1YZBA 3T4ZA 1K4DC 2RN9A 5IDJA 4DV2B 1R1BA 1K73W 1FXKA 4GKJO 1GKFA 1KUQA 5GTHZ 4EB6A 1S5LZ 3UKMA 4WFEA 1IURA 2RCVA 4JI2O 2IJKA 4NXNB 4ABMA 4KUMA 1XMOB 1BQ0A 1LUWA 5DECA 2YIBA 5IT9N 3SPIA 2L6LA 4EKWA 1K7DA 2P5OA 1URFA 1WP8A 2LFRA 2IH1C 2VRZA 4X8AA 5B1NA 4I0XB 4DV3O 4FZ0A 1SA0B 3MHHC 5B1AB 4TOIA 2IW5A 4H44B 3A2FA 3BVOA 2GBOA 2VQEB 4TV8A 2B1GA 4O4JA 2XAHA 4UUJC 4LWSB 2IH3C 3SR2C 1SF9A 4EFEA 1YTFD 4U3JB 3ZN0A 4GX0A 4DO2A 2HKOA 1TUEB 5LGUA 1SQQH 2OWOA 2YI9A 1TA8A 4BIOA 3S3XA 4K8XA 2UXXA 4J7JA 1IXBA 1YITV 3ASOB 4Z2WA 1GK9A 3AEIA 1Q6HA 2JGDA 3CRCA 2GTSA 2RNBA 3S3WA 3BY6A 3OM3B 4HYOA 5K1PA 5J2TB 3K5NA 2HP8A 4B7KA 3ABLC 3CC2V 5GW7A 1RSOB 2UUCB 2F4VO 2HJFC 4P2ZA 1N36O 1W0JG 1YJWV 1Q3EA 3L9DA 4B3TB 4N21A 1PP9H 5KMGA 1QCEA 2EZOA 4NTWA 2ITCC 2UU9B 3JARB 4QE7A 4JI5O 4I55B 1FS0G 1ZSPA 3KZIZ 2GDSA 4H33A 4DK0A 4AQYO 2DW4A 3ETQA 1L0NH 3H1IH 4X1YA 4DR6B 4MVUA 2YDEA 1CPYA 3H9VA 4X62O 2YIBD 4DR2O 1NBMG 3F5TA 2ZT9B 3JSNA 1RFYA 1IBLO 5LYJA 5EZYB 5CA3A 4KHPB 1I94B 1U97A 4IHJB 3B40A 4O2BB 4IIJA 3ASNC 5IYDO 3P30A 1N33O 5KX5B 5KA6A 1VQ7V 1AP5A 1NR7A 2ADQB 4HNAA 2ZM6B 1H2GA 4JI0B 4DR1B 3G6EV 4YIOA 1YCIA 3AG1C 1N0NA 3T1HB 4DRXA 4LFCB 4EB6B 2EINB 1JR9A 5GTIZ 3L71H 1OCCC 3ZMTA 2YEVA 3IJ4A 3CXHF 1IXMA 5ITZB 3BRCA 3RW0A 4ASUG 1LR1A 2X6CA 5KHKA 1RM1B 2WLLA 5LOVA 2Q67A 2KG7A 3BAAA 2H94A 2OCCB 1SESA 2WWWA 1JX9A 1Z5VA 1WPXA 3F5WC 2E5LB 4DYLA 4FZ1A 1FKAO 4YJ2A 2Q68A 2E3CA 2BTQB 2GTAA 2HG5C 3DTUB 2R9IA 4LF7B 3E8FA 4ZIBA 2F1MA 3QNEA 1GN4A 1KKCA 2Y69C 5EYPA 3ZRVA 1JPXA 3BHPA 4R6ZA 4I5SA 3VQWA 4JV5B 4OGQB 1EM1A 3M7MX 2B9ZA 2PTMA 2PYLA 3OTOO 3QO8A 3ML0A 2NN4A 4TWKA 5LMUB 3VOUA 2ZCEA 1VF5B 4LF6B 1I0HA 3WB1A 4G2KA 1WA8A 1B04A 1EN5A 3ZMSA 3HKBA 3LSUA 3HKCA 2Q7GA 1XREA 2DOSA 4ZOLB 4GKKB 2Q6AA 1THZA 3IC9A 4UCRA 3ZRXA 1BGYH 1BMFG 1DGSA 2ZXWC 1ZWIC 3ABMB 2LGWA 3N27A 4CS3A 5DN6G 2QE7G 4JI8B 3H1KH 4C7UA 2WA3A 1KU9A 5LXTA 3OFNG 1NTKH 2W6JG 1MG1A 4YHHB 1SS3A 2IBZH 2WSSG 1XL4A 4GUNA 1IDSA 1WJZA 5JJNB 1Y74A 2ADPA 3LUTB 1YIJV 2O57A 4PELA 2ILMA 3ZHSA 4MW3A 4Q6GA 4DV6B 1ZLZA 2E76B 4E2LA 4TUYB 5BR8O 2HEPA 3RBZA 1D2DA 1EFRG 1VQ5V 2XT9A 3D3IA 5C93A 1R3KC 4DR7O 2L35A 2IM9A 3E22B 5HFLA 1GN2A 5CMUA 3CB2A 3G4SV 4JF3A 1R73A 1MSWD 2E75B 1BQZA 4DV0B 1SQVH 4X9QA 4JTDB 2D3OW 3VBBA 1GN3A 1QVGU 3JYCA 1EZVH 3ZRWA 4PA3A 1F4NA 2WLIA 4CH4A 3QTCA 4GCZA 4UVBA 4DV4B 4MVMA 4JYAO 4JYYA 1N34B 3K57A 2KSDA 2PF4E 4FFBA 5A2QN 2ZR3A 2Y4TA 3APOA 2B5UA 3T4DA 2Q73A 2QKAA 5IYBO 3U0ZA 1ZTEA 4JTCB 4UCSA 5FNVB 1XNQB 4LFBB 1KP3A 3N2GB 3OEHG 3T2MA 1DTOA 3JCUZ 2QM4A 1IJGA 5EBLC 1UJWB 1PKXA 4IYHA 1Q6IA 1F4MA 1Q90D 2EIJC 1L0LH 4ZI7B 4O4LA 2Y48A 5A9GA 3ABKC 3L75H 1Q86W 1QR9A 5DM6V 3A0BZ 3N2KA 3T1YB 1NH2D 4PA4A 1JNBA 3WG7B 3CMEV 1QR8A 4FLZA 2VQFO 3R66A 5C8YA 2LJ2A 1NZ6A 4UV8A 3D36C 2P4VA 4H13B 4HZ3A 3SJAC 1KC8W 5FPRA 1SZXA 2GSMB 3A8TA 1IBKB 5LHHA 3RN4A 1CEZA 2YIAA 1GTOA 4O2AB 3E2EA 2JEXA 4LFAB 2AHZA 2ZE8A 1HNWO 2OT5A 4I50A 3M99B 1PNKA 3GWOA 5DEDA 3CD6V 1IVSA 4YJ3A 2NNUA 1KECA 2ZINA 3Q4HA 3ZMVA 4TSFG 1HNZB 3MD0A 3JSLA 2ZNJA 5H2FZ 4NKGB 1Y76A 2JGUA 3KKYA 2KKWA 1NVPD 4J42A 4YY3B 1H8HG 1HWYA 2B1IA 5IY5B 3B2EE 5CA1B 3CEIA 2ITDC 4QNHB 2W0XA 1QBZA 2JS3A 3FYIB 1V55B 5H9CA 3K5MA 2CGOA 4NYKA 1H2NA 2EJ7A 5FPOA 1WNSA 1ROPA 2F43G 1G4YB 2XAGA 3JATA 4P30A 3I55V 3O9OA 1OCRB 3E86A 3X2QB 3SGIA 5JWPA 1V54C 2EINC 1HDJA 1M56B 1NI8A 2A0LA 4NXMO 1HP8A 4U7OA 1XNRB 1Z2GA 1NVPB 5LP6A 1EBOA 4FFBB 2OCCC 2IJIA 2A06H 2ZDIC 2QJ1A 4FLXA 5IYZB 5KHIA 3TXSA 5D5PA 1XEQA 3ABTA 1DLBA 1Q5OA 1LNQA 1JCHA 4P9OA 1WB8A 3ZBHA 3CS5A 2EIKC 5LMNB 1TGOA 4FK5C 2UXCO 5FL7G 5LL6Y 4DR3O 2HHHB 5LHIA 4O4LB 4JI6B 4CH3A 2UXDO 2ATKC 5JQGB 4FJCC 1NT2B 4UXNA 3HKDA 1YHQV 2CTRA 5LGNA 1YI2V 4B3MB 2LGQA 3AG3C 3SYQA 3OR6C 3K5OA 3UT5A 3CC4V 5C8YB 4BR6A 4DK1A 4NR1A 1XMQB 3ETDA 1HNXO 3HKEB 4DW1A 1H8EG 2QWNB 5KA5A 1NU1H 4DUYB 3ZRSA 2F66C 2DE0X 3B4SA 2G38A 1M57C 2QKCA 4X64B 5CB4B 2UXBO 2YICA 3JALA 1NTZH 1R3IC 2LQTA 3JASB 2UUBB 4RQEA 1AI5A 1GO3F 3L73H 1QLEC 4TV9A 5IJ0B 3ZHTA 2ZDIA 3UCSC 4QE9A 2QSAA 4X1KB 5B1BC 1G6UA 4YJ3B 1VQ9V 1SC5B 4IT5A 3Q4HB 1MOFA 1N34O 2XOKG 4MS2A 4DV5O 4LF8B 3JAKB 1AROP 1MZEA 1H2MA 1M9NA 1XNQO 4DR4O 1ZL8B 4U7NA 1VQ6V 3EXAA 3H1JH 4BW9A 1VQOV 5KHJA 5JVDB 4OXSA 1PD3A 4JAAA 3DGEA 3OGIB 4B3SB 2QWPB 1AB3A 3JATB 4O4IA 5L3GA 2UUAB 3STZC 3CCEV 3QO5A 1SKVA 3K08A 3P32A 1YTFB 1SZTA 1GAXA 4WBNA 1N32B 2FB5A 1HW7A 1VF7A 2QTOA 3C3SA 3ZHRA 3RYCA 1AR5A 1J5EB 1XHXA 4X65B 1VMGA 1N8RW 1BE3H 4DV7O 4X20B 4CZZA 3MHSC 4K0KB 3K0DA 2XNDG 1B3QA 4JZGA 4ZHQA 4CS2A 3JAWB 4OPHA 4FLUA 2DYSC 1IBKO 4JZ2A 2ZE5A 4KFMA 3RYIA 4FIPC 1GMGA 5B3SB 1EN6A 4JYCA 4LP8A 1VQNV 4YIPA 1YSCA 4A5UB 5LA6A 4MVSA 3AK1A 1V9PA 4O4HA 3DC5A 4PJ0Z 5EC1C 4H37A 4J41A 3A0RA 1SRYA
chains in the Genus database with same CATH topology
1N0JA 4GUNA 1IDSA 1Y67A 3OT7A 2ADPA 2CDYA 4F6EA 1ZUQA 1ZLZA 1JA8A 1BSMA 1XILA 3C3TA 1SZXA 1IX9A 3RN4A 3DC6A 5AG2A 1ZSPA 1MMMA 1AVMA 2GDSA 1BT8A 1VARA 3AK3A 1GN2A 1WB8A 1GN4A 1KKCA 2CE4A 2RCVA 1MA1A 1WB7A 3K9SA 4X9QA 1LUWA 1GN3A 3EVKA 3AK2A 1EM1A 3BFRA 3KDRA 1I08A 1PM9A 4JYYA 1VEWA 1XUQA 1D5NA 3QVNA 3KKYA 1I0HA 1PL4A 3TJTA 1EN5A 4BR6A 1XDCA 2QKAA 3C3SA 1ZTEA 3LSUA 1XREA 1AP5A 1AR5A 3CEIA 2ADQB 3IC9A 1LUVA 2AW9A 4JZGA 1QNMA 4E4EA 1EN4A 4YIOA 2P4KA 1MNGA 1B06A 4JZ2A 1N0NA 2QKCA 4FFKA 1IXBA 1EN6A 1JR9A 4YIPA 5A9GA 1MSDA 4C7UA 3AK1A 1BS3A 1P7GA 1GN6A 3DC5A 1AR4A 1AP6A 3MDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0J A;  4GUN A;  1IDS A;  1Y67 A;  3OT7 A;  2ADP A;  2CDY A;  4F6E A;  1ZUQ A;  1ZLZ A;  1JA8 A;  1BSM A;  1XIL A;  3C3T A;  1SZX A;  1IX9 A;  3RN4 A;  3DC6 A;  5AG2 A;  1ZSP A;  1MMM A;  1AVM A;  2GDS A;  1BT8 A;  1VAR A;  3AK3 A;  1GN2 A;  1WB8 A;  1GN4 A;  1KKC A;  2CE4 A;  2RCV A;  1MA1 A;  1WB7 A;  3K9S A;  4X9Q A;  1LUW A;  1GN3 A;  3EVK A;  3AK2 A;  1EM1 A;  3BFR A;  1I08 A;  1PM9 A;  4JYY A;  1VEW A;  1XUQ A;  1D5N A;  3QVN A;  3KKY A;  1I0H A;  1PL4 A;  3TJT A;  1EN5 A;  4BR6 A;  1XDC A;  2QKA A;  3C3S A;  1ZTE A;  3LSU A;  1XRE A;  1AP5 A;  1AR5 A;  3CEI A;  2ADQ B;  3IC9 A;  1LUV A;  2AW9 A;  4JZG A;  1QNM A;  4E4E A;  1EN4 A;  4YIO A;  2P4K A;  1MNG A;  1B06 A;  4JZ2 A;  1N0N A;  2QKC A;  4FFK A;  1IXB A;  1EN6 A;  1JR9 A;  4YIP A;  5A9G A;  1MSD A;  4C7U A;  3AK1 A;  1BS3 A;  1P7G A;  1GN6 A;  3DC5 A;  1AR4 A;  1AP6 A;  3MDS A; 
#chains in the Genus database with same CATH topology
 2HVJ C;  1P84 F;  3W7S A;  2CGN A;  3STL C;  1FXK B;  2FYU H;  1FFX A;  1R6N A;  1SQG A;  1S76 D;  2CH7 A;  4W4K A;  3U10 A;  3KG2 A;  3A0H Z;  2RDC A;  4W4L A;  2CUG A;  4NTY A;  4YY3 O;  3C3T A;  3UT5 B;  5CA0 A;  1IZ3 A;  1K5S A;  4JAU A;  2WAM A;  4X1I A;  1AVM A;  1FJG O;  1XBL A;  2NLJ C;  2QM7 A;  4JI4 B;  4DUZ B;  4MW8 A;  1TVK A;  1WLE A;  5J9P C;  2QDO A;  2ZIO A;  3FB7 C;  3L70 H;  5FLX N;  2IJH A;  4MVQ A;  1FXH A;  4LF4 O;  4G28 B;  3RVZ A;  1M93 A;  4TV8 B;  4YXW G;  4O4J B;  3CMA V;  3E8H A;  4F4L A;  5F2V O;  3VQV A;  1K92 A;  2PYJ A;  4PHZ A;  5IWA B;  4B3R B;  2X6B A;  4HBN A;  4X66 O;  3J7A U;  4GX5 A;  5KHG A;  1FAF A;  5L3C A;  1JMK C;  1FOU A;  4JI7 O;  2UXN A;  3CC7 V;  2ODM A;  3JD2 A;  3KCX A;  1OZ0 A;  1COW G;  5JJJ B;  2JGD B;  1EN4 A;  1Y6X A;  3FAV A;  1K8A W;  1BL8 A;  1VIB A;  2IU0 A;  4LF5 B;  5IY5 C;  3RYF A;  4OX9 B;  4LNU A;  1GRJ A;  2P22 C;  4RUE A;  1QVF U;  2M7W A;  1HR0 O;  4B08 A;  1Q82 W;  4BW5 A;  4GYC B;  3K9A A;  1W59 A;  1GN6 A;  1Q7Y W;  1AR4 A;  3CJH A;  3MDS A;  1K9M W;  1NJI W;  2HR3 A;  5CBG A;  4DV2 O;  2K9P A;  1GH6 A;  1NKD A;  5KMG B;  3U11 A;  2EIL B;  1KP2 A;  2EIM C;  1TUB A;  2DMX A;  1BHA A;  2XTA A;  4BIU A;  3WB2 A;  1OCR C;  2YC0 A;  4EEQ A;  1OCZ C;  3X2Q C;  4LCU C;  2Q5Z A;  4B3M O;  5EIB C;  3FB5 C;  4NXN O;  2F23 A;  3CHX A;  4X1Y B;  2A3Q A;  1G1X B;  1XMO O;  3ZN1 A;  1Z5W A;  1ENV A;  4LF9 B;  4PI0 A;  4JI1 B;  4QPK A;  2Q0A A;  3OMN B;  4UCT A;  4QIW F;  3CRR A;  2OCH A;  4ZHQ B;  1P49 A;  2XHB A;  4GT1 A;  3ZS8 C;  3SPH A;  4XDK A;  4GKJ B;  3JD1 A;  2VQE O;  2JS5 A;  3SYC A;  5LYJ B;  2BOC C;  2QEX V;  5J2U A;  4UB6 Z;  4IIJ B;  2V7Q G;  4J80 A;  3OTF A;  2PI4 A;  3W7U A;  1E1R G;  4JI2 B;  1NS1 A;  4HNA B;  1K5Q A;  2HVK C;  1IBM B;  5JH7 A;  5EK0 A;  2P67 A;  2YXH A;  4I4T A;  3ABL B;  2PUS A;  4UFZ A;  2PY5 A;  1T5E A;  3AG7 A;  3IC7 A;  2GUZ A;  2BE3 A;  2OTL V;  4DW0 A;  4DRX B;  3AG4 B;  5LGT A;  4K8Z A;  1R3J C;  4PI2 A;  4WCE V;  2AW9 A;  3P3P A;  4JGS A;  2P7T C;  2YEV B;  4PA6 A;  1VQM V;  3UO2 A;  5CA0 B;  1YDX A;  2YS8 A;  3H01 A;  3CCV V;  1SQX H;  4IL6 Z;  1BZK A;  1TAE A;  2WLL B;  5LOV B;  2UUC O;  2Q7H A;  2KG7 B;  5B1A C;  5BY1 A;  2N74 A;  1BS3 A;  2FL4 A;  2YUA A;  4PDR A;  3DSQ A;  3DXR A;  3CXC U;  1H5W A;  4B3T O;  3VQY A;  1AR1 B;  1Y67 A;  4MSW C;  4YJ2 B;  2ETN A;  2UU9 O;  4K35 A;  1WAZ A;  1XQ8 A;  1X59 A;  1Y66 A;  2BCC H;  3RYH A;  4I9Q A;  4MTG A;  3OUS A;  1XI1 A;  1AI7 A;  2ZR2 A;  3L72 H;  2BSK A;  4F6R A;  2LP7 A;  3CCJ V;  2EJR A;  2Y0I A;  4DR6 O;  5EYP B;  2QA4 V;  4WFB V;  3ASN B;  2F4V B;  2VWJ A;  2WA4 A;  3IAY A;  2QR4 A;  3ASO C;  1N36 B;  4J11 A;  5KUK A;  3UO3 A;  4PV1 B;  1MA1 A;  3GVM A;  3AG1 B;  2N05 A;  1K34 A;  4KHP O;  2E74 B;  1I94 O;  1MAB G;  3JAM N;  1WA8 B;  2EBO A;  2HJD A;  1EZJ A;  1RP3 B;  4AQY B;  5B66 Z;  3HKB B;  5H6R A;  3HKC B;  2ZM6 O;  1QU7 A;  3B09 A;  3CJH B;  3LSS A;  4JI0 O;  2ZD9 A;  4DR1 O;  4X62 B;  2PZS A;  2QWR B;  4I0X A;  4B7E A;  3K59 A;  4DR2 B;  2Q8V A;  1SA0 A;  2X7R B;  4D7S A;  4WFH A;  3T1H O;  4LFC O;  2JEU A;  4QGP A;  4QPJ A;  1I5Y A;  1YEW A;  5BMV A;  3LSQ A;  3QG5 A;  5BZB A;  1IBL B;  4UCO A;  4E4E A;  4FLW A;  5LXT B;  2AZ0 A;  4HAM A;  1GM9 A;  5L3F A;  4LWS A;  1NH2 B;  2P90 A;  2PGG A;  1FD9 A;  1VQ4 V;  1Q8I A;  4U3J A;  3K0G A;  1RPO A;  4Z1V A;  4J7K A;  1N33 B;  3ZCC A;  3OMA B;  1Y74 B;  4DUZ O;  5EIB D;  5KUM A;  2CTW A;  1P7G A;  4MT8 A;  2E5L O;  3I56 V;  2Y69 B;  2H8P C;  5B3S C;  1VF6 C;  1M4U A;  2RMK B;  2JRI A;  1E79 G;  1AI4 A;  4LC1 A;  5TIS Z;  4DV1 B;  4JAS A;  2D2C B;  4N23 A;  3BEH A;  4LF7 O;  3D36 A;  5J2T A;  1R6T A;  1KQS U;  1W2B U;  2DQ0 A;  1KYO F;  3GB7 C;  4XDL A;  2GUZ B;  4JV5 O;  3DC6 A;  2DN9 A;  3SJC C;  3ZRW B;  2P6J A;  2DJV A;  3LDD A;  1JVM A;  4FLY A;  2WLI B;  4UCV A;  5LMU O;  2ZXW B;  1U96 A;  3K9S A;  4LF6 O;  3FB8 C;  3ZMU A;  4J9Y B;  1CP9 A;  1RM1 C;  4I55 A;  2Q4P A;  4TQF A;  4WFF A;  4JI3 B;  1ZAU A;  4FLV A;  2QGN A;  3OW2 U;  1F23 A;  2YXL A;  3SJB C;  3NXS A;  1I08 A;  1OV9 A;  2WLN A;  3FKS G;  1S72 V;  3M8A A;  4GKK O;  3D8C A;  1D5N A;  2F93 B;  2RQ6 A;  1ZX3 A;  4P9P A;  4KL1 A;  3TJT A;  1XOU A;  2LW1 A;  3OTO B;  1Y4M A;  3OE7 G;  3BPZ A;  3SDL A;  4JI8 O;  4RO2 A;  4CS4 A;  5EZY A;  1VF6 A;  4IHJ A;  1AJN A;  4O2B A;  2R72 A;  4K3A A;  4YHH O;  2PI5 A;  3N2K B;  4FFK A;  3W7T A;  2V1D A;  2CTP A;  4GX2 A;  1S3J A;  2XAF A;  4AIL C;  2OIE A;  4DV6 O;  1JFF A;  1F51 A;  1AP6 A;  1JQ0 A;  3K5L A;  4FM1 A;  2ZE7 A;  3UQ8 A;  1MZF A;  3OGC C;  4L8J A;  2AZ2 A;  4FPP A;  2BTO A;  4LH7 A;  5ITZ A;  1VQL V;  3CCU V;  1IBM O;  5CBH A;  3EHB B;  4MVO A;  3ABM C;  2EIL C;  4R8C A;  4DV0 O;  4JYB A;  3CSX A;  4PDM A;  1YF2 A;  3K04 A;  2IU3 A;  1IX9 A;  2MW2 B;  2JK5 C;  4I50 B;  1SQP H;  4MVZ A;  4RQF A;  2MK3 A;  2YID A;  1BT8 A;  2AXT Z;  1VAR A;  3SYA A;  3AK3 A;  3RFR A;  4OPA A;  5BMV B;  4DV4 O;  3TK1 A;  4IGG A;  5BR8 B;  2X0L A;  3OEE G;  3CRQ A;  4CBC A;  2AGA A;  3BAB A;  2BTQ A;  1Y76 B;  1H2S B;  3W7X A;  5GON A;  5LHG A;  4J7Z A;  1PPJ H;  1GM8 A;  4DR7 B;  2YXY A;  2EIJ B;  1QLN A;  3ZIA G;  4FM2 A;  3G71 V;  2FTK A;  1DF5 A;  4JTA B;  1WN7 A;  3ABK B;  3IGA C;  1M90 W;  4JAV A;  4LFB O;  5KHH A;  4BWA A;  2A9H A;  4WF9 V;  2WLH A;  2XAQ A;  3G6B A;  1M5I A;  1PL4 A;  1US6 A;  5IJ9 A;  2C2A A;  4PA9 A;  2ZKO A;  3NR7 A;  3OD4 A;  4R50 A;  4JYA B;  4RWU A;  3AG2 B;  3F7V C;  1W0K G;  3T1C A;  3ETE A;  5H5N A;  4FMT A;  1M1K W;  3E8B A;  3TET A;  2P4K A;  3ICX A;  3T1Y O;  4UVA A;  3AG4 C;  1SER A;  2KB1 A;  2Y4U A;  4ZOL A;  4PD4 F;  3FB6 C;  3CRM A;  3CP1 A;  3OAA G;  2XUM A;  4LR3 A;  3FX7 A;  5IYC O;  1A32 A;  1BCC H;  5LP6 B;  5L3D A;  4L87 A;  4DXW A;  1O9H A;  1SQB H;  2ZNI A;  4LBE C;  1D5A A;  1YJ9 V;  3E89 A;  4PDL A;  2Y0P A;  5LBQ A;  4LFA O;  1JA8 A;  2VS0 A;  4UCU A;  3ETG A;  5E79 Z;  3ABU A;  2WPD G;  4AI8 A;  2OYQ A;  2VQF B;  4I9W A;  4H0L B;  1K33 A;  2Z0A A;  2IJJ A;  5H6Q A;  3RT3 C;  3HB3 B;  4TUY A;  2F95 B;  1JOY A;  1HNZ O;  2XAJ A;  1KD1 W;  3JCZ A;  2CE4 A;  3CCQ V;  4IYI A;  2GHY A;  3HKD B;  4NVP A;  3WG7 C;  1FYJ A;  1FFT B;  1I7F A;  3D3Q A;  3E22 A;  1OCO B;  2DYR B;  3ZED A;  1K97 A;  3OR7 C;  2CK3 G;  1HNW B;  4I7Z B;  3ZHU A;  2RJZ A;  3L74 H;  4JPR A;  1YXB A;  1JFF B;  1OJH A;  3H1H H;  1CXZ B;  4DR5 B;  1DF4 A;  1V54 B;  2M6Y A;  3CE2 A;  4DV1 O;  3TGU H;  5IE9 A;  5D5Q A;  4TQD A;  4WFA V;  5KAF Z;  3JAL B;  1AI6 A;  2DWE C;  4D7T A;  1QNM A;  3C90 A;  3RGB A;  1L8D A;  2ZQM A;  1B6Q A;  3B77 A;  4TV9 B;  3SPG A;  3KCY A;  5E1A C;  1S5J A;  4WFG A;  5FNV A;  2W0F C;  1KMI Z;  2LW7 A;  3QF7 A;  1OHH G;  4MTF A;  3N2G A;  3PJS K;  3K79 A;  3LDC A;  1XNR O;  2K1E A;  2LFS A;  2WLM A;  2EIK B;  5B1O A;  4JI3 O;  4Z1M G;  5GON B;  1NR1 A;  2V4D A;  1PNL A;  4ZI7 A;  4EFB A;  1I5X A;  4BIZ A;  2CDY A;  4CC5 A;  1AIL A;  4X88 A;  4GZR B;  2FML A;  3ZHV A;  1V55 C;  1YJN V;  4CH6 A;  3AG3 B;  1VP7 A;  1X4T A;  5LMN O;  4LH6 A;  3I5D A;  2HHH O;  1R6K A;  5IJ9 B;  3FFQ A;  4GLX A;  5AG2 A;  4NXM B;  2X6A A;  1K4C C;  4R7C A;  3TCU A;  4JI6 O;  3TXQ A;  3FD9 A;  2QTS A;  3JD0 A;  2WLK A;  4O4I B;  3E8G A;  1Q43 A;  4UB8 Z;  2JIZ G;  1WPB A;  1XHZ A;  2HLD G;  1Q81 W;  4ZBM A;  1BHB A;  3JD4 A;  1ORQ C;  4WBN B;  1M57 B;  1R3L C;  3AK2 A;  3W7W A;  4FLT A;  3BFR A;  1M56 C;  2AHY A;  2BOB C;  4O2A A;  3KDR A;  4FVM A;  5CN0 A;  5BXZ A;  3LNM B;  1XMQ O;  1QLE B;  3RYC B;  2YI8 A;  2UXC B;  4DUY O;  4DR3 B;  3ZHQ A;  1N4C A;  3H1L H;  3K3W A;  5B1B B;  1VQK V;  4X64 O;  2UXD B;  3CRA A;  1P4R A;  2EX3 A;  3RYI B;  1H38 A;  4G27 B;  5EBM C;  3B8M A;  2UUB O;  5LA6 B;  4TT3 G;  4FM0 A;  4O4H B;  3LNN A;  2JJ2 G;  4RUF A;  2W6I G;  5CA1 A;  4MVR A;  3FYE B;  2A79 B;  2CAZ C;  3UM7 A;  1HNX B;  3P3N A;  3PN1 A;  1FFX B;  4DV3 B;  3OMI B;  3CX5 F;  2CH7 B;  1FPO A;  1P7B A;  4BAY A;  2ARH A;  3K06 A;  4LF8 O;  3E35 A;  3B8N A;  3E83 A;  1S0V A;  2UXB B;  2LO1 A;  3G67 A;  2H3O A;  4QJF B;  3WFV A;  4F6E A;  4MTX A;  4X1I B;  1VQP V;  3CYO A;  3VQX A;  1KKD A;  5EC2 C;  2A7W A;  3ZJZ A;  2JDI G;  1XIL A;  2WLJ A;  3F7Y C;  1TVK B;  2P06 A;  5L3B A;  3WU2 Z;  1Q6U A;  4B3S O;  3HPL C;  2UUA O;  4D6T H;  4CC6 A;  4DV5 B;  2Q7E A;  5JJE B;  3OUF A;  4PDV A;  1XL6 A;  3QO7 A;  3CCR V;  2DYS B;  1N32 O;  3BCC H;  1O9G A;  5IYZ A;  2GV9 A;  3G80 A;  3EVK A;  4CH5 A;  4DR4 B;  1WP7 A;  1H2L A;  1PV0 A;  2QM8 A;  1NTM H;  4KP4 A;  4PA7 A;  3CWB H;  3LDE A;  4KXR A;  1J5E O;  2NR5 A;  4X65 O;  1XUQ A;  1KBH A;  4K0K O;  3QVN A;  3SPJ A;  3ZX6 A;  2N04 A;  1YVW A;  2DWD C;  1AJP A;  3FAV B;  5JQG A;  3RYF B;  2Z5U A;  4LNU B;  4JI5 B;  5KLV H;  2EZP A;  1QHT A;  2R9R B;  1PL0 A;  1LUV A;  2CTQ A;  3SYP A;  1S77 D;  1OCC B;  4UVC A;  3RWR D;  1JJ2 U;  1B06 A;  3EFF K;  4NB5 A;  2ZIM A;  2KQX A;  3CPW U;  3ZMZ A;  3AG2 C;  1RPR A;  3SJQ C;  3HKE A;  1MSD A;  4DV7 B;  1SQF A;  1TUB B;  2QKS A;  2OIG A;  3HR0 A;  3O65 A;  3K58 A;  2HFE C;  1UFI A;  1KB9 F;  3J80 N;  5CB4 A;  4J10 A;  2EUL A;  5KAI Z;  3OT7 A;  1FXV A;  2XAS A;  2Z3Y A;  3JAS A;  1GM7 A;  5B5E Z;  5JCO C;  1DK1 A;  1SET A;  5IJ0 A;  1E1Q G;  4X89 A;  3IFX A;  1BSM A;  4X1K A;  3RVY A;  4DR5 O;  4JI4 O;  4GX1 A;  5LP6 C;  4RAI A;  1G8M A;  3SYO A;  4AHC A;  3CCM V;  2R9A A;  3GWK C;  1MMM A;  3BA8 A;  1NQT A;  2JVD A;  3CCL V;  5J2U B;  3BA9 A;  3JAK A;  4ICG A;  5IWA O;  2OTJ V;  1WB7 A;  4B3R O;  2Q69 A;  1ZL8 A;  2Q0O C;  1JJO A;  3JD3 A;  4NTX A;  5JH7 B;  1FXK C;  1FJG B;  2YSU B;  4I4T B;  3SPC A;  1RSO A;  2R70 A;  4XDJ A;  1K3E A;  5JVD A;  3K03 A;  1VQ8 V;  1PM9 A;  4J9Z B;  5L3E A;  2QWO B;  1VEW A;  1F7Y A;  2FKX A;  3APQ A;  1OCO C;  2DYR C;  5EBW C;  4LF4 B;  4LF5 O;  4XBF A;  4OX9 O;  3JAR A;  1XDC A;  2JJ1 G;  3WB0 A;  2EIM B;  4UV9 A;  5HFM A;  3CCS V;  4Q20 A;  3J81 N;  1OCZ B;  2Q9L A;  4X66 B;  5K1X A;  1H2K A;  1MNG A;  3DXR B;  3R65 A;  2QWQ B;  5JCO A;  1AJQ A;  4U3F H;  4JI7 B;  2DQ3 A;  1QQC A;  4X20 A;  5CBF A;  2ZE6 A;  3JAW A;  1S5H C;  3RYH B;  1J95 A;  2VWK A;  1PNM A;  3MAQ A;  1UPG A;  1N0J A;  1L1F A;  2BSK B;  4F6R B;  4MTO A;  4ZKI A;  1HR0 B;  4LF9 O;  3THO A;  4JI1 O;  5KX5 A;  1ZUQ A;  1YZB A;  3T4Z A;  1K4D C;  2RN9 A;  5IDJ A;  4DV2 B;  1R1B A;  1K73 W;  1FXK A;  4GKJ O;  1GKF A;  1KUQ A;  5GTH Z;  4EB6 A;  1S5L Z;  3UKM A;  4WFE A;  1IUR A;  2RCV A;  4JI2 O;  2IJK A;  4NXN B;  4ABM A;  4KUM A;  1XMO B;  1BQ0 A;  1LUW A;  5DEC A;  2YIB A;  5IT9 N;  3SPI A;  2L6L A;  4EKW A;  1K7D A;  2P5O A;  1URF A;  1WP8 A;  2LFR A;  2IH1 C;  2VRZ A;  4X8A A;  5B1N A;  4I0X B;  4DV3 O;  4FZ0 A;  1SA0 B;  3MHH C;  5B1A B;  4TOI A;  2IW5 A;  4H44 B;  3A2F A;  3BVO A;  2GBO A;  2VQE B;  4TV8 A;  2B1G A;  4O4J A;  2XAH A;  4UUJ C;  4LWS B;  2IH3 C;  3SR2 C;  1SF9 A;  4EFE A;  1YTF D;  4U3J B;  3ZN0 A;  4GX0 A;  4DO2 A;  2HKO A;  1TUE B;  5LGU A;  1SQQ H;  2OWO A;  2YI9 A;  1TA8 A;  4BIO A;  3S3X A;  4K8X A;  2UXX A;  4J7J A;  1IXB A;  1YIT V;  3ASO B;  4Z2W A;  1GK9 A;  3AEI A;  1Q6H A;  2JGD A;  3CRC A;  2GTS A;  2RNB A;  3S3W A;  3BY6 A;  3OM3 B;  4HYO A;  5K1P A;  5J2T B;  3K5N A;  2HP8 A;  4B7K A;  3ABL C;  3CC2 V;  5GW7 A;  1RSO B;  2UUC B;  2F4V O;  2HJF C;  4P2Z A;  1N36 O;  1W0J G;  1YJW V;  1Q3E A;  3L9D A;  4B3T B;  4N21 A;  1PP9 H;  5KMG A;  1QCE A;  2EZO A;  4NTW A;  2ITC C;  2UU9 B;  3JAR B;  4QE7 A;  4JI5 O;  4I55 B;  1FS0 G;  1ZSP A;  3KZI Z;  2GDS A;  4H33 A;  4DK0 A;  4AQY O;  2DW4 A;  3ETQ A;  1L0N H;  3H1I H;  4X1Y A;  4DR6 B;  4MVU A;  2YDE A;  1CPY A;  3H9V A;  4X62 O;  2YIB D;  4DR2 O;  1NBM G;  3F5T A;  2ZT9 B;  3JSN A;  1RFY A;  1IBL O;  5LYJ A;  5EZY B;  5CA3 A;  4KHP B;  1I94 B;  1U97 A;  4IHJ B;  3B40 A;  4O2B B;  4IIJ A;  3ASN C;  5IYD O;  3P30 A;  1N33 O;  5KX5 B;  5KA6 A;  1VQ7 V;  1AP5 A;  1NR7 A;  2ADQ B;  4HNA A;  2ZM6 B;  1H2G A;  4JI0 B;  4DR1 B;  3G6E V;  4YIO A;  1YCI A;  3AG1 C;  1N0N A;  3T1H B;  4DRX A;  4LFC B;  4EB6 B;  2EIN B;  1JR9 A;  5GTI Z;  3L71 H;  1OCC C;  3ZMT A;  2YEV A;  3IJ4 A;  3CXH F;  1IXM A;  5ITZ B;  3BRC A;  3RW0 A;  4ASU G;  1LR1 A;  2X6C A;  5KHK A;  1RM1 B;  2WLL A;  5LOV A;  2Q67 A;  2KG7 A;  3BAA A;  2H94 A;  2OCC B;  1SES A;  2WWW A;  1JX9 A;  1Z5V A;  1WPX A;  3F5W C;  2E5L B;  4DYL A;  4FZ1 A;  1FKA O;  4YJ2 A;  2Q68 A;  2E3C A;  2BTQ B;  2GTA A;  2HG5 C;  3DTU B;  2R9I A;  4LF7 B;  3E8F A;  4ZIB A;  2F1M A;  3QNE A;  1GN4 A;  1KKC A;  2Y69 C;  5EYP A;  3ZRV A;  1JPX A;  3BHP A;  4R6Z A;  4I5S A;  3VQW A;  4JV5 B;  4OGQ B;  1EM1 A;  3M7M X;  2B9Z A;  2PTM A;  2PYL A;  3OTO O;  3QO8 A;  3ML0 A;  2NN4 A;  4TWK A;  5LMU B;  3VOU A;  2ZCE A;  1VF5 B;  4LF6 B;  1I0H A;  3WB1 A;  4G2K A;  1WA8 A;  1B04 A;  1EN5 A;  3ZMS A;  3HKB A;  3LSU A;  3HKC A;  2Q7G A;  1XRE A;  2DOS A;  4ZOL B;  4GKK B;  2Q6A A;  1THZ A;  3IC9 A;  4UCR A;  3ZRX A;  1BGY H;  1BMF G;  1DGS A;  2ZXW C;  1ZWI C;  3ABM B;  2LGW A;  3N27 A;  4CS3 A;  5DN6 G;  2QE7 G;  4JI8 B;  3H1K H;  4C7U A;  2WA3 A;  1KU9 A;  5LXT A;  3OFN G;  1NTK H;  2W6J G;  1MG1 A;  4YHH B;  1SS3 A;  2IBZ H;  2WSS G;  1XL4 A;  4GUN A;  1IDS A;  1WJZ A;  5JJN B;  1Y74 A;  2ADP A;  3LUT B;  1YIJ V;  2O57 A;  4PEL A;  2ILM A;  3ZHS A;  4MW3 A;  4Q6G A;  4DV6 B;  1ZLZ A;  2E76 B;  4E2L A;  4TUY B;  5BR8 O;  2HEP A;  3RBZ A;  1D2D A;  1EFR G;  1VQ5 V;  2XT9 A;  3D3I A;  5C93 A;  1R3K C;  4DR7 O;  2L35 A;  2IM9 A;  3E22 B;  5HFL A;  1GN2 A;  5CMU A;  3CB2 A;  3G4S V;  4JF3 A;  1R73 A;  1MSW D;  2E75 B;  1BQZ A;  4DV0 B;  1SQV H;  4X9Q A;  4JTD B;  2D3O W;  3VBB A;  1GN3 A;  1QVG U;  3JYC A;  1EZV H;  3ZRW A;  4PA3 A;  1F4N A;  2WLI A;  4CH4 A;  3QTC A;  4GCZ A;  4UVB A;  4DV4 B;  4MVM A;  4JYA O;  4JYY A;  1N34 B;  3K57 A;  2KSD A;  2PF4 E;  4FFB A;  5A2Q N;  2ZR3 A;  2Y4T A;  3APO A;  2B5U A;  3T4D A;  2Q73 A;  2QKA A;  5IYB O;  3U0Z A;  1ZTE A;  4JTC B;  4UCS A;  5FNV B;  1XNQ B;  4LFB B;  1KP3 A;  3N2G B;  3OEH G;  3T2M A;  1DTO A;  3JCU Z;  2QM4 A;  1IJG A;  5EBL C;  1UJW B;  1PKX A;  4IYH A;  1Q6I A;  1F4M A;  1Q90 D;  2EIJ C;  1L0L H;  4ZI7 B;  4O4L A;  2Y48 A;  5A9G A;  3ABK C;  3L75 H;  1Q86 W;  1QR9 A;  5DM6 V;  3A0B Z;  3N2K A;  3T1Y B;  1NH2 D;  4PA4 A;  1JNB A;  3WG7 B;  3CME V;  1QR8 A;  4FLZ A;  2VQF O;  3R66 A;  5C8Y A;  2LJ2 A;  1NZ6 A;  4UV8 A;  3D36 C;  2P4V A;  4H13 B;  4HZ3 A;  3SJA C;  1KC8 W;  5FPR A;  1SZX A;  2GSM B;  3A8T A;  1IBK B;  5LHH A;  3RN4 A;  1CEZ A;  2YIA A;  1GTO A;  4O2A B;  3E2E A;  2JEX A;  4LFA B;  2AHZ A;  2ZE8 A;  1HNW O;  2OT5 A;  4I50 A;  3M99 B;  1PNK A;  3GWO A;  5DED A;  3CD6 V;  1IVS A;  4YJ3 A;  2NNU A;  1KEC A;  2ZIN A;  3Q4H A;  3ZMV A;  4TSF G;  1HNZ B;  3MD0 A;  3JSL A;  2ZNJ A;  5H2F Z;  4NKG B;  1Y76 A;  2JGU A;  3KKY A;  2KKW A;  1NVP D;  4J42 A;  4YY3 B;  1H8H G;  1HWY A;  2B1I A;  5IY5 B;  3B2E E;  5CA1 B;  3CEI A;  2ITD C;  4QNH B;  2W0X A;  1QBZ A;  2JS3 A;  3FYI B;  1V55 B;  5H9C A;  3K5M A;  2CGO A;  4NYK A;  1H2N A;  2EJ7 A;  5FPO A;  1WNS A;  1ROP A;  2F43 G;  1G4Y B;  2XAG A;  3JAT A;  4P30 A;  3I55 V;  3O9O A;  1OCR B;  3E86 A;  3X2Q B;  3SGI A;  5JWP A;  1V54 C;  2EIN C;  1HDJ A;  1M56 B;  1NI8 A;  2A0L A;  4NXM O;  1HP8 A;  4U7O A;  1XNR B;  1Z2G A;  1NVP B;  5LP6 A;  1EBO A;  4FFB B;  2OCC C;  2IJI A;  2A06 H;  2ZDI C;  2QJ1 A;  4FLX A;  5IYZ B;  5KHI A;  3TXS A;  5D5P A;  1XEQ A;  3ABT A;  1DLB A;  1Q5O A;  1LNQ A;  1JCH A;  4P9O A;  1WB8 A;  3ZBH A;  3CS5 A;  2EIK C;  5LMN B;  1TGO A;  4FK5 C;  2UXC O;  5FL7 G;  5LL6 Y;  4DR3 O;  2HHH B;  5LHI A;  4O4L B;  4JI6 B;  4CH3 A;  2UXD O;  2ATK C;  5JQG B;  4FJC C;  1NT2 B;  4UXN A;  3HKD A;  1YHQ V;  2CTR A;  5LGN A;  1YI2 V;  4B3M B;  2LGQ A;  3AG3 C;  3SYQ A;  3OR6 C;  3K5O A;  3UT5 A;  3CC4 V;  5C8Y B;  4BR6 A;  4DK1 A;  4NR1 A;  1XMQ B;  3ETD A;  1HNX O;  3HKE B;  4DW1 A;  1H8E G;  2QWN B;  5KA5 A;  1NU1 H;  4DUY B;  3ZRS A;  2F66 C;  2DE0 X;  3B4S A;  2G38 A;  1M57 C;  2QKC A;  4X64 B;  5CB4 B;  2UXB O;  2YIC A;  3JAL A;  1NTZ H;  1R3I C;  2LQT A;  3JAS B;  2UUB B;  4RQE A;  1AI5 A;  1GO3 F;  3L73 H;  1QLE C;  4TV9 A;  5IJ0 B;  3ZHT A;  2ZDI A;  3UCS C;  4QE9 A;  2QSA A;  4X1K B;  5B1B C;  1G6U A;  4YJ3 B;  1VQ9 V;  1SC5 B;  4IT5 A;  3Q4H B;  1MOF A;  1N34 O;  2XOK G;  4MS2 A;  4DV5 O;  4LF8 B;  3JAK B;  1ARO P;  1MZE A;  1H2M A;  1M9N A;  1XNQ O;  4DR4 O;  1ZL8 B;  4U7N A;  1VQ6 V;  3EXA A;  3H1J H;  4BW9 A;  1VQO V;  5KHJ A;  5JVD B;  4OXS A;  1PD3 A;  4JAA A;  3DGE A;  3OGI B;  4B3S B;  2QWP B;  1AB3 A;  3JAT B;  4O4I A;  5L3G A;  2UUA B;  3STZ C;  3CCE V;  3QO5 A;  1SKV A;  3K08 A;  3P32 A;  1YTF B;  1SZT A;  1GAX A;  4WBN A;  1N32 B;  2FB5 A;  1HW7 A;  1VF7 A;  2QTO A;  3C3S A;  3ZHR A;  3RYC A;  1AR5 A;  1J5E B;  1XHX A;  4X65 B;  1VMG A;  1N8R W;  1BE3 H;  4DV7 O;  4X20 B;  4CZZ A;  3MHS C;  4K0K B;  3K0D A;  2XND G;  1B3Q A;  4JZG A;  4ZHQ A;  4CS2 A;  3JAW B;  4OPH A;  4FLU A;  2DYS C;  1IBK O;  4JZ2 A;  2ZE5 A;  4KFM A;  3RYI A;  4FIP C;  1GMG A;  5B3S B;  1EN6 A;  4JYC A;  4LP8 A;  1VQN V;  4YIP A;  1YSC A;  4A5U B;  5LA6 A;  4MVS A;  3AK1 A;  1V9P A;  4O4H A;  3DC5 A;  4PJ0 Z;  5EC1 C;  4H37 A;  4J41 A;  3A0R A;  1SRY A; 
#chains in the Genus database with same CATH homology
 1N0J A;  4GUN A;  1IDS A;  1Y67 A;  3OT7 A;  2ADP A;  2CDY A;  4F6E A;  1ZUQ A;  1ZLZ A;  1JA8 A;  1BSM A;  1XIL A;  3C3T A;  1SZX A;  1IX9 A;  3RN4 A;  3DC6 A;  5AG2 A;  1ZSP A;  1MMM A;  1AVM A;  2GDS A;  1BT8 A;  1VAR A;  3AK3 A;  1GN2 A;  1WB8 A;  1GN4 A;  1KKC A;  2CE4 A;  2RCV A;  1MA1 A;  1WB7 A;  3K9S A;  4X9Q A;  1LUW A;  1GN3 A;  3EVK A;  3AK2 A;  1EM1 A;  3BFR A;  3KDR A;  1I08 A;  1PM9 A;  4JYY A;  1VEW A;  1XUQ A;  1D5N A;  3QVN A;  3KKY A;  1I0H A;  1PL4 A;  3TJT A;  1EN5 A;  4BR6 A;  1XDC A;  2QKA A;  3C3S A;  1ZTE A;  3LSU A;  1XRE A;  1AP5 A;  1AR5 A;  3CEI A;  2ADQ B;  3IC9 A;  1LUV A;  2AW9 A;  4JZG A;  1QNM A;  4E4E A;  1EN4 A;  4YIO A;  2P4K A;  1MNG A;  1B06 A;  4JZ2 A;  1N0N A;  2QKC A;  4FFK A;  1IXB A;  1EN6 A;  1JR9 A;  4YIP A;  5A9G A;  1MSD A;  4C7U A;  3AK1 A;  1BS3 A;  1P7G A;  1GN6 A;  3DC5 A;  1AR4 A;  1AP6 A;  3MDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...