1SZXA

Role of hydrogen bonding in the active site of human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGFGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Role of hydrogen bonding in the active site of human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1szxA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1szxA02
2GDSA 1VARA 3MDSA 3CEIA 1B06A 1QNMA 3KKYA 3QVNA 1BS3A 1BSMA 1Y67A 1AP5A 4E4EA 3C3SA 3DC5A 5A9GA 4JZ2A 1MA1A 1ZTEA 1GN6A 4C7UA 1AVMA 1VEWA 1ZLZA 1N0NA 3K9SA 1N0JA 1XUQA 1I08A 1P7GA 1JR9A 2ADPA 4YIPA 1D5NA 1SZXA 1EN5A 1AR4A 1GN2A 3BFRA 1BT8A 1AP6A 3EVKA 1PL4A 1MNGA 1ZSPA 2AW9A 1XILA 1IDSA 3AK2A 1MMMA 2ADQB 4YIOA 1XREA 1I0HA 2QKCA 3AK3A 1WB8A 2RCVA 3AK1A 4GUNA 1WB7A 3C3TA 4JYYA 4JZGA 2CE4A 1EN6A 2P4KA 1AR5A 3TJTA 4BR6A 1LUWA 3IC9A 1JA8A 1IXBA 1KKCA 4FFKA 5AG2A 3LSUA 1EN4A 1ZUQA 1EM1A 1GN3A 4X9QA 2QKAA 1XDCA 3RN4A 3DC6A 1IX9A 4F6EA 2CDYA 1PM9A 3OT7A 1LUVA 1GN4A 1MSDA
chains in the Genus database with same CATH superfamily
4MW3A 3N27A 3JCZA 2CUGA 1NKDA 3K59A 1XMQO 4P9OA 4JTDB 1PP9H 1B06A 4DRXA 2ZKOA 2E3CA 4AQYB 3O65A 3OFNG 2EIMB 1WPXA 3JAWB 4X1YB 1TVKB 4UVCA 2Z5UA 2OCCB 1XL4A 1XUQA 1FXKC 5DECA 5IJ0B 2XAGA 3B77A 5L3FA 1EN5A 3TK1A 1H2SB 4MVMA 4WFBV 4BAYA 4JAVA 4X64B 2ITDC 4GX2A 2UUAO 3THOA 4JI5B 1OZ0A 2H94A 1I7FA 3BABA 5L3GA 4DV3B 1MNGA 3OGIB 1I94B 1MMMA 4GZRB 2Y4TA 3K06A 3ZHRA 1WP8A 1SERA 2EJRA 3T4ZA 4K35A 3JAWA 3I55V 3C3TA 4PV1B 1TVKA 1I5YA 2P4KA 3ZRXA 3AEIA 1S5LZ 3TJTA 2YDEA 1KP2A 5IJ0A 1XBLA 4B3SO 2PI5A 4MTGA 3EHBB 3JD0A 4FFKA 3JSNA 4PHZA 4DV0O 4JV5O 1QLEC 3L70H 2HVKC 1SQQH 2L35A 1SQVH 1IX9A 2ZE8A 2BTOA 3SJBC 1XMOB 3JD3A 2AZ2A 1MSWD 1VF5B 5L3DA 5DN6G 3PJSK 1JJOA 2BOCC 1Q43A 4DK0A 4D7TA 4JF3A 4RUEA 3CWBH 4B3RO 1OCOC 3APQA 2Q9LA 2V7QG 3OUSA 2ZQMA 1AP5A 2WLLB 2BCCH 4AILC 3VQWA 1VQLV 2PYJA 3T1HO 2XAJA 3WG7B 3K9SA 4JYCA 3QNEA 4UB8Z 4YIPA 2A9HA 4WFGA 4QGPA 3L9DA 1H2LA 4CH4A 1QLEB 3CP1A 4PA6A 3FB8C 1GM8A 2JEXA 1O9GA 5KAIZ 2K1EA 4RUFA 1JOYA 1A32A 3LDDA 5CBHA 2W0XA 3AK3A 3VQYA 3B8NA 1NH2D 1G6UA 3E2EA 2WLLA 3BVOA 1D2DA 4I9QA 3SYAA 2CE4A 1EN6A 1OCOB 3L74H 5IDJA 3IC9A 2GUZB 5F2VO 1R3JC 4DO2A 4DR2O 2VRZA 1EZJA 4O4IB 1M90W 1KU9A 4FZ0A 3ABKC 4MVZA 1PD3A 2H8PC 1T5EA 3ABUA 4WFFA 2DMXA 2ZINA 4QNHB 4OX9O 3KG2A 2VWJA 2WLJA 1VQNV 2CGOA 2IJKA 1H38A 4EKWA 3TXQA 4IHJB 4Z2WA 3CB2A 3GWKC 3LNMB 1VQMV 4PD4F 2F4VB 4WF9V 5JJJB 2QSAA 4XDLA 2GUZA 1YITV 2E76B 4FPPA 3H1LH 2ZXWC 2UXCB 3OR7C 4O4IA 1HR0B 4LWSB 1NZ6A 1BSMA 1SA0B 4DV2B 1YSCA 4RAIA 3LSSA 3DC5A 2WSSG 2EULA 1EZVH 1W0KG 5EZYA 4I55B 3A8TA 4CZZA 3M8AA 2YXLA 2VQEB 1I5XA 3HKCB 1M4UA 4IHJA 3H1HH 2BSKB 4JI4B 4DUZO 2LFRA 4K8XA 3UM7A 2AHZA 1PL0A 1P84F 5LP6B 4DV4O 4HZ3A 1YDXA 5HFMA 2ADQB 1M56C 2DOSA 1DTOA 4DUYB 4LWSA 4FLVA 1I0HA 1SA0A 1N34B 2LW1A 4JAAA 2ZIMA 1GM9A 4W4LA 2RDCA 1KC8W 1W2BU 4I55A 3AG7A 3ZMSA 1QU7A 3JALB 1QCEA 1B04A 3HKCA 4X1IB 1JA8A 1H2KA 1PNMA 3H1KH 3CMAV 1SQGA 3K79A 4GX1A 2CAZC 4B3MO 4NTYA 4X1KA 1EM1A 2BSKA 1XEQA 2YIDA 4LF5O 4LF7O 4H44B 1SQBH 4YY3O 2DQ3A 4CS2A 4DR6B 5LP6A 2Q4PA 5LGTA 3CRRA 4I50B 2Z0AA 1NTMH 5FPOA 4IL6Z 4P30A 1JCHA 1P49A 3QTCA 4JI3B 3I56V 2UXDB 3T2MA 1AI5A 4B3TB 4D7SA 2GV9A 3SJAC 1KB9F 3ZHUA 4XDKA 1N36O 1WLEA 4MS2A 2DW4A 2UUCO 3JALA 4PDRA 3K04A 1YJWV 4X1IA 1BS3A 4NXMO 2IJIA 3CC7V 4TV8B 1JVMA 3OMNB 4NTXA 3SR2C 2ODMA 3QG5A 2P06A 4RQEA 2QWQB 1FFXB 2JS5A 2UU9B 4I50A 1GO3F 4WFHA 2WLIB 4DR5O 2LGQA 4JI6O 2ZR3A 3ZRWB 2QA4V 1RM1C 1MZFA 3TGUH 4UVBA 1YJ9V 1AB3A 4X66O 2UXBO 3QO7A 2ILMA 1S77D 5KMGB 4X65B 2X6CA 1IBKB 3AK2A 2F95B 4NXNB 2AGAA 3B09A 4TV8A 3GWOA 1SZTA 1NTZH 1HW7A 3FAVB 5GTIZ 4NR1A 3B2EE 2PTMA 2ZE6A 2JK5C 3BA8A 3WFVA 1QBZA 1KP3A 3AG2B 3B4SA 3FB5C 2WWWA 4J80A 4H13B 1FFXA 3D36C 4PDVA 3JAKB 1M5IA 3CE2A 4GX5A 3ZRWA 3BRCA 1L8DA 4YJ3B 2ATKC 2JGDB 3AG1C 3RN4A 1V55B 2WLNA 2KSDA 1BL8A 5KMGA 1LUVA 5KHJA 5LMNO 3SPIA 1IBMO 3HKBB 5LGUA 1YCIA 1WA8B 1DK1A 3BHPA 3FAVA 3UT5A 4JTCB 5CA1B 4MT8A 1OCCB 5EBWC 2XAFA 2OIGA 4DR3O 3JAKA 4HYOA 4UCVA 4YJ3A 2AZ0A 2JGDA 3CYOA 4C7UA 3C90A 4YXWG 1P7BA 4G27B 3E22B 2EILC 1N0JA 1I08A 3A0RA 1P7GA 1JR9A 3K03A 3HKBA 1RPRA 5A2QN 4FIPC 1WA8A 2XASA 3L71H 1KBHA 2HHHO 4JI8B 2JGUA 3CCSV 5LMUO 3BAAA 3G71V 1COWG 5CA1A 3SPGA 1YTFB 3ZMTA 2B1GA 4Z1VA 1EBOA 3CS5A 1OCZC 2RCVA 4WFAV 5LL6Y 1Q6UA 1GM7A 3F5TA 3RT3C 1Q86W 5KHHA 3F5WC 1ROPA 2HJDA 3FYEB 4BR6A 3FYIB 4R6ZA 4DV0B 4MVSA 4DV1B 4JV5B 1XNRO 4JYAO 1AI6A 3MD0A 5AG2A 4Q20A 1EN4A 3DSQA 1K8AW 3TCUA 4CBCA 3B40A 3T1YB 1VP7A 1G1XB 4FLWA 1R73A 2ZE5A 3ABTA 3X2QC 2ZE7A 2EILB 3RVYA 2OCCC 1GMGA 2Y48A 1IBLO 1R3LC 3GB7C 1AI4A 1Z5VA 1R3IC 1S5JA 2DJVA 1ZAUA 1URFA 4DR7O 3FB6C 4FM2A 2YUAA 4CS3A 3DTUB 2PGGA 2F23A 5L3BA 1US6A 4EB6B 5EC2C 2DWEC 5KA5A 2X6AA 1UPGA 4QPJA 1S72V 2R70A 5JQGB 1OCZB 5KHIA 1TUBB 1AI7A 4P2ZA 3OE7G 1GN6A 4GCZA 1JQ0A 4TV9B 1K73W 3H1JH 3RW0A 1W59A 1N0NA 2QE7G 3CMEV 5IYDO 1CXZB 2IU0A 4IIJB 4R8CA 2OTJV 2R9IA 2ZIOA 4B08A 1AR4A 1YVWA 1GN2A 3T1CA 1SQFA 4MTOA 1QLNA 2QM8A 3EVKA 3KDRA 1R6TA 3X2QB 1PKXA 4EB6A 3FB7C 1BHAA 1M9NA 2P7TC 1MOFA 5JQGA 4K3AA 1CP9A 4LF6O 3PN1A 3H9VA 2KB1A 1TUBA 4LFCO 1S0VA 1SQPH 3K08A 2FL4A 4TV9A 4GKJO 2JIZG 2C2AA 2Q0AA 1CPYA 3E35A 3OTOO 4OPHA 4ICGA 4FZ1A 1IXBA 4X89A 2QWOB 1L1FA 3ZHQA 1NR7A 3CCVV 1XDCA 2QGNA 1G8MA 1HNWB 2JVDA 1N33B 4JI2B 3APOA 1HNXO 4X1YA 2KKWA 2IH1C 3RYHB 1M57B 3WG7C 2K9PA 4LF9B 4RO2A 2P22C 2AHYA 2XAQA 4DV6O 2Z3YA 3UO2A 2YS8A 4BIOA 5TISZ 2IM9A 4GLXA 1S3JA 4I4TB 2BTQB 2WLKA 4ABMA 1NBMG 2IJHA 3RBZA 4MVOA 4KHPO 1KECA 1DF5A 4FLYA 2ZDIA 4DR1B 1KKDA 1NR1A 3OMAB 3CRMA 2EX3A 2HP8A 4LC1A 5IE9A 2HG5C 3ZEDA 4DUZB 1AR1B 4JI7O 3RYHA 5LHHA 1N32O 2B5UA 3M99B 3K0GA 3RYFB 2R72A 3JARB 2CH7B 5JJNB 2Y0IA 3VQVA 2AW9A 3P32A 4I4TA 2BTQA 3RYCB 2VQFO 1UJWB 2GSMB 3ZIAG 2QKCA 4WBNB 5EK0A 1KUQA 3O9OA 4B7KA 3RFRA 1ZX3A 2GBOA 4JZGA 3DXRB 3QF7A 1K9MW 4I5SA 4X20B 1V9PA 3CCRV 4B3MB 5CBFA 1SF9A 4OXSA 3CCMV 1B3QA 3ABLC 4YY3B 1YI2V 5EYPB 1ZUQA 3RYFA 1D5AA 4E2LA 4LR3A 1XQ8A 3JARA 1M93A 2CH7A 2YIBA 1Q81W 4QE9A 2JS3A 4PA3A 2QTOA 2RQ6A 4F6EA 1NJIW 2ZM6O 1N8RW 1DLBA 4Z1MG 4UCTA 3RYCA 4DV7B 4AQYO 1U96A 4ASUG 4N23A 4WBNA 4TT3G 1G4YB 3ML0A 4TQDA 2UUCB 4W4KA 5LA6B 4DW1A 3DXRA 5CMUA 4O4HB 3JD1A 4X20A 3WU2Z 4NXMB 1WN7A 1JPXA 2QWNB 5LP6C 4LF8B 1WJZA 2EJ7A 5EYPA 4K0KO 1AROP 1PNKA 2FYUH 3C3SA 5JCOC 3S3WA 4O2BB 4NKGB 1YJNV 4JI5O 1JFFB 1ZLZA 3S3XA 3G4SV 5IWAB 5KX5B 1H2MA 4X66B 2Q8VA 1SETA 2UXBB 3ABLB 4U7OA 2E5LO 3RYIB 2UUBO 1FJGO 5LA6A 1AP6A 3OW2U 4X62O 2N05A 4O4HA 4J41A 4TSFG 3SJCC 3IFXA 5CA3A 1AILA 4YHHO 2RJZA 4FLTA 3A0BZ 1P4RA 2Q6AA 3STZC 5L3EA 1FXVA 1PV0A 4PI2A 5B5EZ 1IXMA 2GHYA 2RNBA 1VQ6V 4GUNA 1WB7A 1VIBA 2Y69B 4LNUB 2YI8A 3JCUZ 2QEXV 2IW5A 2HVJC 4BW5A 2HKOA 2WA3A 4CC5A 1XMOO 4MTFA 3D3IA 1IVSA 1Y6XA 3RYIA 3CC4V 3OUFA 4DXWA 2RMKB 5H9CA 1VQ7V 2PI4A 1VQ9V 4FK5C 1VMGA 1H8EG 3DC6A 3G80A 2XUMA 5BMVB 2BOBC 4LP8A 2Y4UA 2JRIA 1MSDA 3OD4A 3BY6A 1PNLA 2ITCC 2XAHA 1Q6IA 4DV5B 2EIJB 1AJPA 4J7KA 3CC2V 4LNUA 4BWAA 3HKEB 2LJ2A 4CS4A 3DGEA 4L8JA 1Y66A 2GTAA 1SESA 3KCYA 3Q4HB 4MTXA 5H6RA 1J5EB 1YTFD 3W7WA 1L0LH 3HPLC 2OTLV 3BEHA 5JCOA 3VBBA 5A9GA 5EIBC 3OMIB 2OWOA 4PJ0Z 1KYOF 4UCUA 1FD9A 2IU3A 3JSLA 3AG2C 3SYPA 1HP8A 1LNQA 4QE7A 1IJGA 3OM3B 1BQZA 3CCLV 4GKKO 3BFRA 1QVGU 3WB0A 2H3OA 3HKDB 4RQFA 3HKEA 4LFAO 1XL6A 1V55C 4H0LB 3IAYA 3Q4HA 2ZD9A 1XNQO 4DW0A 2CK3G 1NH2B 4JYAB 4YJ2B 1Q8IA 5J2TB 2GTSA 3CCEV 2YXYA 2OT5A 4LCUC 1O9HA 5KUKA 2EZPA 1W0JG 1OCCC 2YEVB 4HAMA 4TWKA 1DF4A 1YZBA 2WLHA 2DN9A 3K0DA 3J81N 3RWRD 4KFMA 3W7UA 2HJFC 3CSXA 3T4DA 3HKDA 2JEUA 1F4MA 1K97A 2Q5ZA 1GN4A 4DR7B 2X0LA 1NS1A 5BR8B 3LSQA 4EFBA 2UXCO 1HR0O 1QR9A 1NU1H 2WLIA 3RGBA 4JYBA 1SC5B 5CBGA 5GW7A 5J2TA 2EINC 4UV8A 1HDJA 1JNBA 2FKXA 3KKYA 1QNMA 4GYCB 4UVAA 2IJJA 5IY5B 2YEVA 1OCRC 4J7ZA 1Y67A 1YXBA 4CH6A 1NVPB 3JYCA 2YC0A 4O4LB 1CEZA 3IC7A 3CXCU 5B1AB 2QKSA 1XMQB 4NTWA 5GTHZ 4JZ2A 1B6QA 2OYQA 3CXHF 2JJ2G 1JJ2U 2EBOA 2ADPA 4PDLA 5JH7B 4TQFA 4DUYO 5B1BB 5DEDA 3M7MX 1TUEB 5H2FZ 1R3KC 4LFBO 3P3PA 4EEQA 4N21A 2B9ZA 3JASB 5DM6V 1K4CC 1ZWIC 1R1BA 4PA4A 2V1DA 2DYRC 2UUAB 3SYOA 4O4LA 1OHHG 1KQSU 1VF7A 2CTRA 3G6EV 2EINB 4DR6O 3MAQA 5JH7A 2B1IA 1OCRB 4TOIA 1FXHA 5KHKA 4JI3O 3ZN1A 1HWYA 2UXDO 2QWRB 2CDYA 3W7XA 4B3SB 3D8CA 3G67A 1Q5OA 3JASA 5LGNA 3CJHB 3E22A 4F4LA 2G38A 1PPJH 2GDSA 4J10A 1KMIZ 5D5PA 1SKVA 5ITZB 4J9ZB 3ASOB 1H2NA 4ZOLB 5IT9N 5KUMA 2Q69A 2DE0X 3ZN0A 2P67A 3UQ8A 2CTQA 5K1XA 1SS3A 1F7YA 2YIBD 3CPWU 1F51A 4MVUA 1F23A 1TA8A 2DYRB 4LF4O 4QJFB 4B3RB 2XTAA 1H8HG 2WA4A 4BIZA 1RFYA 3LNNA 4I0XB 2LP7A 4KUMA 1GRJA 4IGGA 1Z5WA 1Y74B 1GAXA 5FL7G 2YIAA 3HB3B 3J80N 1IBKO 2F1MA 1IURA 1K3EA 1YF2A 2DYSB 3T1HB 3CHXA 5ITZA 3BPZA 4B7EA 4ZOLA 3H1IH 2ZDIC 1FS0G 1FFTB 4PA7A 3N2KB 1XOUA 1J95A 1M57C 2QJ1A 4K8ZA 5BY1A 2RN9A 1WNSA 3W7TA 4JI0O 1LR1A 1AR5A 4I0XA 4DR4O 5LBQA 1LUWA 4MW8A 1Y74A 2ETNA 2ZM6B 3ETQA 2ZT9B 4ZI7B 1K34A 4FMTA 1QVFU 3U11A 1XHXA 5D5QA 3CCQV 2QTSA 3N2GB 4DR2B 1AJQA 1RPOA 2Q73A 4U3FH 5LXTB 3I5DA 3N2KA 2JDIG 4AI8A 3EFFK 3UKMA 5KA6A 1HNZO 4BIUA 3SGIA 4IIJA 4OX9B 3ZRVA 3E8BA 2ZNIA 4K0KB 1Z2GA 2CTWA 3A2FA 5IJ9B 4PELA 2N74A 3QVNA 3ZMUA 4ZI7A 1YIJV 1RSOB 5KHGA 1NT2B 3SJQC 2P90A 4QIWF 2QDOA 2EIKB 3CCJV 1ZTEA 4PA9A 2E5LB 2UUBB 3N2GA 4JI8O 3A0HZ 5LXTA 1FJGB 2A0LA 3ABMC 4X62B 5L3CA 1NTKH 3D3QA 4R7CA 2XHBA 1TGOA 4YHHB 3K3WA 4O4JB 5J2UB 3NXSA 3CCUV 2QR4A 2VWKA 4UB6Z 5IJ9A 4RWUA 4R50A 4DV1O 4HNAB 4O2AB 4J7JA 5IYZB 4FLXA 1RSOA 3ZHSA 4MVRA 1K92A 3WB1A 2CGNA 2Q7HA 2YXHA 4DV4B 1AJNA 3T1YO 1FXKB 3ZJZA 4J11A 4KP4A 1SRYA 1VQ8V 4ZBMA 2YSUB 4A5UB 2PYLA 3ICXA 4JAUA 2L6LA 4J9YB 4UCRA 2QKAA 4I7ZB 3SPCA 3K58A 4O4JA 1S5HC 5J2UA 3ZHVA 3OT7A 2A7WA 2YI9A 3K57A 4FJCC 1M1KW 1GTOA 1K5SA 3ABMB 4HNAA 4O2AA 3FD9A 1IZ3A 5IYZA 3CRAA 3MHHC 2LFSA 1Q90D 4LF5B 4LF7B 4JI1O 1RP3B 3MDSA 5IYBO 3KCXA 1FXKA 2FMLA 4J42A 3FKSG 1H2GA 5E79Z 5CA0B 2O57A 3CD6V 4EFEA 1ENVA 2Q68A 5CB4B 3CRCA 5FPRA 2N04A 1OV9A 1DGSA 1NQTA 3U0ZA 1N36B 3K9AA 3AG4C 2Y69C 3K5OA 4GKKB 1VEWA 2HLDG 4FM1A 4P9PA 2EZOA 5B1OA 3R65A 1FPOA 2UXNA 3SYCA 4LFAB 1ZL8B 1BT8A 1E1QG 4NVPA 3ZMZA 4U3JB 5B3SC 1XNQB 1ZSPA 5CA0A 1X59A 1VF6C 1XILA 2MK3A 3P30A 4X64O 4DR5B 1FOUA 5GONB 4JI6B 1WAZA 3CX5F 4YIOA 5CB4A 1TAEA 4LBEC 1BE3H 5EIBD 3UCSC 3E86A 3AG3C 4DV3O 5C8YB 5EZYB 3CRQA 4JYYA 1I94O 2D2CB 3SPJA 2A3QA 3ZMVA 4BW9A 2EIJC 3E8HA 4D6TH 2HFEC 1HNWO 4IT5A 4KXRA 1N33O 4JI2O 5E1AC 4XBFA 3LDCA 3LSUA 4OPAA 1ZL8A 4FLZA 2JJ1G 1GN3A 2PZSA 4LF9O 4U3JA 3ZX6A 1BZKA 4UXNA 3OAAG 3AG4B 3OTFA 2E75B 5EBMC 4O2BA 1NVPD 1Q6HA 2FB5A 3ZHTA 5GONA 1QQCA 1JFFA 4MVQA 5LHGA 2QM7A 1S76D 5LHIA 5KX5A 5C8YA 3OGCC 2Q0OC 4JGSA 4UFZA 3BA9A 1VQKV 2CTPA 3KZIZ 5LMNB 4DR1O 5B3SB 4FM0A 4UCSA 2LW7A 5EC1C 1IBMB 4JASA 4F6RB 3ABKB 3E89A 4X1KB 3ZBHA 1GKFA 4X8AA 3AG3B 5EBLC 1MABG 1Q82W 1JMKC 1VQOV 4UUJC 2W6JG 4DR3B 1NI8A 2WPDG 2A79B 1BMFG 5HFLA 5BXZA 4LFBB 3VOUA 1Y76B 3SPHA 1BCCH 4MSWC 1Q7YW 2XNDG 1PL4A 2ZXWB 5K1PA 4ZHQB 4F6RA 2P6JA 1VF6A 5BMVA 2PF4E 3QO5A 3E83A 3L73H 1WB8A 2DWDC 2HHHB 3F7YC 1WPBA 1THZA 5LMUB 5C93A 4QPKA 3IGAC 2WAMA 4PI0A 1KKCA 3VQXA 2WLMA 4WFEA 5H6QA 1GK9A 5IY5C 4X9QA 4DV7O 1H5WA 3ETDA 4H33A 3L72H 2X7RB 4UCOA 5JVDB 5BZBA 5LYJB 1Y76A 3P3NA 2XOKG 2LQTA 1PM9A 5B1AC 1XNRB 2R9AA 3NR7A 5J9PC 1M56B 4ZHQA 5FNVB 3K5LA 4LF8O 2HR3A 1YEWA 3WB2A 2HEPA 1VARA 3FFQA 5B1BC 3K5NA 1MZEA 1BGYH 1FYJA 4LF4B 5H5NA 3CEIA 5KAFZ 1IBLB 3U10A 4NB5A 2KG7B 5IWAO 3ZRSA 4JPRA 1VQPV 2YICA 2ZCEA 1N4CA 2PUSA 2W6IG 2F4VO 3OEEG 2F93B 1YHQV 2OIEA 1KD1W 5LYJA 5JVDA 2PY5A 3IJ4A 5B1NA 1AVMA 1OJHA 1FKAO 2NNUA 4DV2O 5FNVA 3ETEA 4YJ2A 1QR8A 2QWPB 4CH3A 3MHSC 4FFBB 3UT5B 4U7NA 3SYQA 2VQEO 3TXSA 1U97A 1XI1A 2NLJC 4CH5A 3EXAA 1BHBA 4JI4O 1IDSA 3ZS8C 1VQ4V 2KG7A 1X4TA 4JI0B 1XREA 3JAMN 4DR4B 2ZR2A 4WCEV 1K7DA 2LGWA 2BE3A 2Y0PA 1K33A 1N34O 1VQ5V 3FX7A 3ASOC 4LF6B 1V54C 3OR6C 1RM1B 1BQ0A 3UO3A 4FFBA 1Y4MA 4AHCA 4LFCB 1XHZA 2NN4A 2LO1A 4GKJB 2MW2B 4DV5O 2F43G 4KL1A 3W7SA 3OTOB 4XDJA 2UXXA 1HNZB 1F4NA 4JTAB 3JATB 3E8FA 4IYIA 5LOVB 2R9RB 1J5EO 4LH7A 1HNXB 3TETA 1SQXH 3OEHG 2DYSC 4GT1A 2NR5A 5JJEB 4B3TO 3RVZA 3BCCH 3H01A 3L75H 4H37A 3STLC 3G6BA 1K4DC 3ZCCA 3AG1B 3HR0A 4E4EA 4PDMA 4DV6B 5CN0A 2Q67A 4ZKIA 4Q6GA 1MA1A 4G2KA 5B66Z 3B8MA 1QHTA 1Q3EA 4KHPB 3JATA 3JD4A 1D5NA 3ASNC 4G28B 5LOVA 5IYCO 1SZXA 1V54B 3GVMA 2FTKA 4ZIBA 1MG1A 4FVMA 4FLUA 1GH6A 4L87A 2F66C 2UU9O 2AXTZ 2Q7EA 2IH3C 3D36A 4JI7B 2V4DA 2ZNJA 3F7VC 3E8GA 1N32B 1K5QA 2X6BA 4TUYB 2ARHA 3LUTB 4DK1A 1ORQC 5KLVH 2EIMC 1FAFA 4X65O 2A06H 3ETGA 3AK1A 3SDLA 4HBNA 3CJHA 1WP7A 2E74B 2QM4A 4NXNO 3J7AU 4UV9A 5FLXN 1R6KA 4OGQB 2DQ0A 4X88A 1E1RG 1EFRG 2D3OW 5JWPA 2VQFB 2W0FC 2M6YA 4DRXB 2OCHA 3JD2A 3K5MA 2IBZH 4NYKA 4I9WA 5BR8O 2P5OA 4CC6A 4LH6A 1R6NA 1JX9A 3R66A 3QO8A 4IYHA 1L0NH 2XT9A 2EIKC 2VS0A 4JI1B 2Q7GA 2M7WA 4DYLA 1UFIA 2P4VA 4TUYA 2KQXA 1E79G 3LDEA 3ASNB 4GX0A
chains in the Genus database with same CATH topology
2GDSA 1VARA 3MDSA 3CEIA 1B06A 1QNMA 3KKYA 3QVNA 1BS3A 1BSMA 1Y67A 1AP5A 4E4EA 3C3SA 3DC5A 5A9GA 4JZ2A 1MA1A 1ZTEA 1GN6A 4C7UA 1AVMA 1VEWA 1ZLZA 1N0NA 3K9SA 1N0JA 1XUQA 1I08A 1P7GA 1JR9A 2ADPA 4YIPA 1D5NA 1SZXA 1EN5A 1AR4A 1GN2A 3BFRA 1BT8A 1AP6A 3EVKA 3KDRA 1PL4A 1MNGA 1ZSPA 2AW9A 1XILA 1IDSA 3AK2A 1MMMA 2ADQB 4YIOA 1XREA 1I0HA 2QKCA 3AK3A 1WB8A 2RCVA 3AK1A 4GUNA 1WB7A 3C3TA 4JYYA 4JZGA 2CE4A 1EN6A 2P4KA 1AR5A 3TJTA 4BR6A 1LUWA 3IC9A 1JA8A 1IXBA 1KKCA 4FFKA 5AG2A 3LSUA 1EN4A 1ZUQA 1EM1A 1GN3A 4X9QA 2QKAA 1XDCA 3RN4A 3DC6A 1IX9A 4F6EA 2CDYA 1PM9A 3OT7A 1LUVA 1GN4A 1MSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDS A;  1VAR A;  3MDS A;  3CEI A;  1B06 A;  1QNM A;  3KKY A;  3QVN A;  1BS3 A;  1BSM A;  1Y67 A;  1AP5 A;  4E4E A;  3C3S A;  3DC5 A;  5A9G A;  4JZ2 A;  1MA1 A;  1ZTE A;  1GN6 A;  4C7U A;  1AVM A;  1VEW A;  1ZLZ A;  1N0N A;  3K9S A;  1N0J A;  1XUQ A;  1I08 A;  1P7G A;  1JR9 A;  2ADP A;  4YIP A;  1D5N A;  1SZX A;  1EN5 A;  1AR4 A;  1GN2 A;  3BFR A;  1BT8 A;  1AP6 A;  3EVK A;  1PL4 A;  1MNG A;  1ZSP A;  2AW9 A;  1XIL A;  1IDS A;  3AK2 A;  1MMM A;  2ADQ B;  4YIO A;  1XRE A;  1I0H A;  2QKC A;  3AK3 A;  1WB8 A;  2RCV A;  3AK1 A;  4GUN A;  1WB7 A;  3C3T A;  4JYY A;  4JZG A;  2CE4 A;  1EN6 A;  2P4K A;  1AR5 A;  3TJT A;  4BR6 A;  1LUW A;  3IC9 A;  1JA8 A;  1IXB A;  1KKC A;  4FFK A;  5AG2 A;  3LSU A;  1EN4 A;  1ZUQ A;  1EM1 A;  1GN3 A;  4X9Q A;  2QKA A;  1XDC A;  3RN4 A;  3DC6 A;  1IX9 A;  4F6E A;  2CDY A;  1PM9 A;  3OT7 A;  1LUV A;  1GN4 A;  1MSD A; 
#chains in the Genus database with same CATH topology
 4MW3 A;  3N27 A;  3JCZ A;  2CUG A;  1NKD A;  3K59 A;  1XMQ O;  4P9O A;  4JTD B;  1PP9 H;  1B06 A;  4DRX A;  2ZKO A;  2E3C A;  4AQY B;  3O65 A;  3OFN G;  2EIM B;  1WPX A;  3JAW B;  4X1Y B;  1TVK B;  4UVC A;  2Z5U A;  2OCC B;  1XL4 A;  1XUQ A;  1FXK C;  5DEC A;  5IJ0 B;  2XAG A;  3B77 A;  5L3F A;  1EN5 A;  3TK1 A;  1H2S B;  4MVM A;  4WFB V;  4BAY A;  4JAV A;  4X64 B;  2ITD C;  4GX2 A;  2UUA O;  3THO A;  4JI5 B;  1OZ0 A;  2H94 A;  1I7F A;  3BAB A;  5L3G A;  4DV3 B;  1MNG A;  3OGI B;  1I94 B;  1MMM A;  4GZR B;  2Y4T A;  3K06 A;  3ZHR A;  1WP8 A;  1SER A;  2EJR A;  3T4Z A;  4K35 A;  3JAW A;  3I55 V;  3C3T A;  4PV1 B;  1TVK A;  1I5Y A;  2P4K A;  3ZRX A;  3AEI A;  1S5L Z;  3TJT A;  2YDE A;  1KP2 A;  5IJ0 A;  1XBL A;  4B3S O;  2PI5 A;  4MTG A;  3EHB B;  3JD0 A;  4FFK A;  3JSN A;  4PHZ A;  4DV0 O;  4JV5 O;  1QLE C;  3L70 H;  2HVK C;  1SQQ H;  2L35 A;  1SQV H;  1IX9 A;  2ZE8 A;  2BTO A;  3SJB C;  1XMO B;  3JD3 A;  2AZ2 A;  1MSW D;  1VF5 B;  5L3D A;  5DN6 G;  3PJS K;  1JJO A;  2BOC C;  1Q43 A;  4DK0 A;  4D7T A;  4JF3 A;  4RUE A;  3CWB H;  4B3R O;  1OCO C;  3APQ A;  2Q9L A;  2V7Q G;  3OUS A;  2ZQM A;  1AP5 A;  2WLL B;  2BCC H;  4AIL C;  3VQW A;  1VQL V;  2PYJ A;  3T1H O;  2XAJ A;  3WG7 B;  3K9S A;  4JYC A;  3QNE A;  4UB8 Z;  4YIP A;  2A9H A;  4WFG A;  4QGP A;  3L9D A;  1H2L A;  4CH4 A;  1QLE B;  3CP1 A;  4PA6 A;  3FB8 C;  1GM8 A;  2JEX A;  1O9G A;  5KAI Z;  2K1E A;  4RUF A;  1JOY A;  1A32 A;  3LDD A;  5CBH A;  2W0X A;  3AK3 A;  3VQY A;  3B8N A;  1NH2 D;  1G6U A;  3E2E A;  2WLL A;  3BVO A;  1D2D A;  4I9Q A;  3SYA A;  2CE4 A;  1EN6 A;  1OCO B;  3L74 H;  5IDJ A;  3IC9 A;  2GUZ B;  5F2V O;  1R3J C;  4DO2 A;  4DR2 O;  2VRZ A;  1EZJ A;  4O4I B;  1M90 W;  1KU9 A;  4FZ0 A;  3ABK C;  4MVZ A;  1PD3 A;  2H8P C;  1T5E A;  3ABU A;  4WFF A;  2DMX A;  2ZIN A;  4QNH B;  4OX9 O;  3KG2 A;  2VWJ A;  2WLJ A;  1VQN V;  2CGO A;  2IJK A;  1H38 A;  4EKW A;  3TXQ A;  4IHJ B;  4Z2W A;  3CB2 A;  3GWK C;  3LNM B;  1VQM V;  4PD4 F;  2F4V B;  4WF9 V;  5JJJ B;  2QSA A;  4XDL A;  2GUZ A;  1YIT V;  2E76 B;  4FPP A;  3H1L H;  2ZXW C;  2UXC B;  3OR7 C;  4O4I A;  1HR0 B;  4LWS B;  1NZ6 A;  1BSM A;  1SA0 B;  4DV2 B;  1YSC A;  4RAI A;  3LSS A;  3DC5 A;  2WSS G;  2EUL A;  1EZV H;  1W0K G;  5EZY A;  4I55 B;  3A8T A;  4CZZ A;  3M8A A;  2YXL A;  2VQE B;  1I5X A;  3HKC B;  1M4U A;  4IHJ A;  3H1H H;  2BSK B;  4JI4 B;  4DUZ O;  2LFR A;  4K8X A;  3UM7 A;  2AHZ A;  1PL0 A;  1P84 F;  5LP6 B;  4DV4 O;  4HZ3 A;  1YDX A;  5HFM A;  2ADQ B;  1M56 C;  2DOS A;  1DTO A;  4DUY B;  4LWS A;  4FLV A;  1I0H A;  1SA0 A;  1N34 B;  2LW1 A;  4JAA A;  2ZIM A;  1GM9 A;  4W4L A;  2RDC A;  1KC8 W;  1W2B U;  4I55 A;  3AG7 A;  3ZMS A;  1QU7 A;  3JAL B;  1QCE A;  1B04 A;  3HKC A;  4X1I B;  1JA8 A;  1H2K A;  1PNM A;  3H1K H;  3CMA V;  1SQG A;  3K79 A;  4GX1 A;  2CAZ C;  4B3M O;  4NTY A;  4X1K A;  1EM1 A;  2BSK A;  1XEQ A;  2YID A;  4LF5 O;  4LF7 O;  4H44 B;  1SQB H;  4YY3 O;  2DQ3 A;  4CS2 A;  4DR6 B;  5LP6 A;  2Q4P A;  5LGT A;  3CRR A;  4I50 B;  2Z0A A;  1NTM H;  5FPO A;  4IL6 Z;  4P30 A;  1JCH A;  1P49 A;  3QTC A;  4JI3 B;  3I56 V;  2UXD B;  3T2M A;  1AI5 A;  4B3T B;  4D7S A;  2GV9 A;  3SJA C;  1KB9 F;  3ZHU A;  4XDK A;  1N36 O;  1WLE A;  4MS2 A;  2DW4 A;  2UUC O;  3JAL A;  4PDR A;  3K04 A;  1YJW V;  4X1I A;  1BS3 A;  4NXM O;  2IJI A;  3CC7 V;  4TV8 B;  1JVM A;  3OMN B;  4NTX A;  3SR2 C;  2ODM A;  3QG5 A;  2P06 A;  4RQE A;  2QWQ B;  1FFX B;  2JS5 A;  2UU9 B;  4I50 A;  1GO3 F;  4WFH A;  2WLI B;  4DR5 O;  2LGQ A;  4JI6 O;  2ZR3 A;  3ZRW B;  2QA4 V;  1RM1 C;  1MZF A;  3TGU H;  4UVB A;  1YJ9 V;  1AB3 A;  4X66 O;  2UXB O;  3QO7 A;  2ILM A;  1S77 D;  5KMG B;  4X65 B;  2X6C A;  1IBK B;  3AK2 A;  2F95 B;  4NXN B;  2AGA A;  3B09 A;  4TV8 A;  3GWO A;  1SZT A;  1NTZ H;  1HW7 A;  3FAV B;  5GTI Z;  4NR1 A;  3B2E E;  2PTM A;  2ZE6 A;  2JK5 C;  3BA8 A;  3WFV A;  1QBZ A;  1KP3 A;  3AG2 B;  3B4S A;  3FB5 C;  2WWW A;  4J80 A;  4H13 B;  1FFX A;  3D36 C;  4PDV A;  3JAK B;  1M5I A;  3CE2 A;  4GX5 A;  3ZRW A;  3BRC A;  1L8D A;  4YJ3 B;  2ATK C;  2JGD B;  3AG1 C;  3RN4 A;  1V55 B;  2WLN A;  2KSD A;  1BL8 A;  5KMG A;  1LUV A;  5KHJ A;  5LMN O;  3SPI A;  1IBM O;  3HKB B;  5LGU A;  1YCI A;  1WA8 B;  1DK1 A;  3BHP A;  3FAV A;  3UT5 A;  4JTC B;  5CA1 B;  4MT8 A;  1OCC B;  5EBW C;  2XAF A;  2OIG A;  4DR3 O;  3JAK A;  4HYO A;  4UCV A;  4YJ3 A;  2AZ0 A;  2JGD A;  3CYO A;  4C7U A;  3C90 A;  4YXW G;  1P7B A;  4G27 B;  3E22 B;  2EIL C;  1N0J A;  1I08 A;  3A0R A;  1P7G A;  1JR9 A;  3K03 A;  3HKB A;  1RPR A;  5A2Q N;  4FIP C;  1WA8 A;  2XAS A;  3L71 H;  1KBH A;  2HHH O;  4JI8 B;  2JGU A;  3CCS V;  5LMU O;  3BAA A;  3G71 V;  1COW G;  5CA1 A;  3SPG A;  1YTF B;  3ZMT A;  2B1G A;  4Z1V A;  1EBO A;  3CS5 A;  1OCZ C;  2RCV A;  4WFA V;  5LL6 Y;  1Q6U A;  1GM7 A;  3F5T A;  3RT3 C;  1Q86 W;  5KHH A;  3F5W C;  1ROP A;  2HJD A;  3FYE B;  4BR6 A;  3FYI B;  4R6Z A;  4DV0 B;  4MVS A;  4DV1 B;  4JV5 B;  1XNR O;  4JYA O;  1AI6 A;  3MD0 A;  5AG2 A;  4Q20 A;  1EN4 A;  3DSQ A;  1K8A W;  3TCU A;  4CBC A;  3B40 A;  3T1Y B;  1VP7 A;  1G1X B;  4FLW A;  1R73 A;  2ZE5 A;  3ABT A;  3X2Q C;  2ZE7 A;  2EIL B;  3RVY A;  2OCC C;  1GMG A;  2Y48 A;  1IBL O;  1R3L C;  3GB7 C;  1AI4 A;  1Z5V A;  1R3I C;  1S5J A;  2DJV A;  1ZAU A;  1URF A;  4DR7 O;  3FB6 C;  4FM2 A;  2YUA A;  4CS3 A;  3DTU B;  2PGG A;  2F23 A;  5L3B A;  1US6 A;  4EB6 B;  5EC2 C;  2DWE C;  5KA5 A;  2X6A A;  1UPG A;  4QPJ A;  1S72 V;  2R70 A;  5JQG B;  1OCZ B;  5KHI A;  1TUB B;  1AI7 A;  4P2Z A;  3OE7 G;  1GN6 A;  4GCZ A;  1JQ0 A;  4TV9 B;  1K73 W;  3H1J H;  3RW0 A;  1W59 A;  1N0N A;  2QE7 G;  3CME V;  5IYD O;  1CXZ B;  2IU0 A;  4IIJ B;  4R8C A;  2OTJ V;  2R9I A;  2ZIO A;  4B08 A;  1AR4 A;  1YVW A;  1GN2 A;  3T1C A;  1SQF A;  4MTO A;  1QLN A;  2QM8 A;  3EVK A;  3KDR A;  1R6T A;  3X2Q B;  1PKX A;  4EB6 A;  3FB7 C;  1BHA A;  1M9N A;  2P7T C;  1MOF A;  5JQG A;  4K3A A;  1CP9 A;  4LF6 O;  3PN1 A;  3H9V A;  2KB1 A;  1TUB A;  4LFC O;  1S0V A;  1SQP H;  3K08 A;  2FL4 A;  4TV9 A;  4GKJ O;  2JIZ G;  2C2A A;  2Q0A A;  1CPY A;  3E35 A;  3OTO O;  4OPH A;  4ICG A;  4FZ1 A;  1IXB A;  4X89 A;  2QWO B;  1L1F A;  3ZHQ A;  1NR7 A;  3CCV V;  1XDC A;  2QGN A;  1G8M A;  1HNW B;  2JVD A;  1N33 B;  4JI2 B;  3APO A;  1HNX O;  4X1Y A;  2KKW A;  2IH1 C;  3RYH B;  1M57 B;  3WG7 C;  2K9P A;  4LF9 B;  4RO2 A;  2P22 C;  2AHY A;  2XAQ A;  4DV6 O;  2Z3Y A;  3UO2 A;  2YS8 A;  4BIO A;  5TIS Z;  2IM9 A;  4GLX A;  1S3J A;  4I4T B;  2BTQ B;  2WLK A;  4ABM A;  1NBM G;  2IJH A;  3RBZ A;  4MVO A;  4KHP O;  1KEC A;  1DF5 A;  4FLY A;  2ZDI A;  4DR1 B;  1KKD A;  1NR1 A;  3OMA B;  3CRM A;  2EX3 A;  2HP8 A;  4LC1 A;  5IE9 A;  2HG5 C;  3ZED A;  4DUZ B;  1AR1 B;  4JI7 O;  3RYH A;  5LHH A;  1N32 O;  2B5U A;  3M99 B;  3K0G A;  3RYF B;  2R72 A;  3JAR B;  2CH7 B;  5JJN B;  2Y0I A;  3VQV A;  2AW9 A;  3P32 A;  4I4T A;  2BTQ A;  3RYC B;  2VQF O;  1UJW B;  2GSM B;  3ZIA G;  2QKC A;  4WBN B;  5EK0 A;  1KUQ A;  3O9O A;  4B7K A;  3RFR A;  1ZX3 A;  2GBO A;  4JZG A;  3DXR B;  3QF7 A;  1K9M W;  4I5S A;  4X20 B;  1V9P A;  3CCR V;  4B3M B;  5CBF A;  1SF9 A;  4OXS A;  3CCM V;  1B3Q A;  3ABL C;  4YY3 B;  1YI2 V;  5EYP B;  1ZUQ A;  3RYF A;  1D5A A;  4E2L A;  4LR3 A;  1XQ8 A;  3JAR A;  1M93 A;  2CH7 A;  2YIB A;  1Q81 W;  4QE9 A;  2JS3 A;  4PA3 A;  2QTO A;  2RQ6 A;  4F6E A;  1NJI W;  2ZM6 O;  1N8R W;  1DLB A;  4Z1M G;  4UCT A;  3RYC A;  4DV7 B;  4AQY O;  1U96 A;  4ASU G;  4N23 A;  4WBN A;  4TT3 G;  1G4Y B;  3ML0 A;  4TQD A;  2UUC B;  4W4K A;  5LA6 B;  4DW1 A;  3DXR A;  5CMU A;  4O4H B;  3JD1 A;  4X20 A;  3WU2 Z;  4NXM B;  1WN7 A;  1JPX A;  2QWN B;  5LP6 C;  4LF8 B;  1WJZ A;  2EJ7 A;  5EYP A;  4K0K O;  1ARO P;  1PNK A;  2FYU H;  3C3S A;  5JCO C;  3S3W A;  4O2B B;  4NKG B;  1YJN V;  4JI5 O;  1JFF B;  1ZLZ A;  3S3X A;  3G4S V;  5IWA B;  5KX5 B;  1H2M A;  4X66 B;  2Q8V A;  1SET A;  2UXB B;  3ABL B;  4U7O A;  2E5L O;  3RYI B;  2UUB O;  1FJG O;  5LA6 A;  1AP6 A;  3OW2 U;  4X62 O;  2N05 A;  4O4H A;  4J41 A;  4TSF G;  3SJC C;  3IFX A;  5CA3 A;  1AIL A;  4YHH O;  2RJZ A;  4FLT A;  3A0B Z;  1P4R A;  2Q6A A;  3STZ C;  5L3E A;  1FXV A;  1PV0 A;  4PI2 A;  5B5E Z;  1IXM A;  2GHY A;  2RNB A;  1VQ6 V;  4GUN A;  1WB7 A;  1VIB A;  2Y69 B;  4LNU B;  2YI8 A;  3JCU Z;  2QEX V;  2IW5 A;  2HVJ C;  4BW5 A;  2HKO A;  2WA3 A;  4CC5 A;  1XMO O;  4MTF A;  3D3I A;  1IVS A;  1Y6X A;  3RYI A;  3CC4 V;  3OUF A;  4DXW A;  2RMK B;  5H9C A;  1VQ7 V;  2PI4 A;  1VQ9 V;  4FK5 C;  1VMG A;  1H8E G;  3DC6 A;  3G80 A;  2XUM A;  5BMV B;  2BOB C;  4LP8 A;  2Y4U A;  2JRI A;  1MSD A;  3OD4 A;  3BY6 A;  1PNL A;  2ITC C;  2XAH A;  1Q6I A;  4DV5 B;  2EIJ B;  1AJP A;  4J7K A;  3CC2 V;  4LNU A;  4BWA A;  3HKE B;  2LJ2 A;  4CS4 A;  3DGE A;  4L8J A;  1Y66 A;  2GTA A;  1SES A;  3KCY A;  3Q4H B;  4MTX A;  5H6R A;  1J5E B;  1YTF D;  3W7W A;  1L0L H;  3HPL C;  2OTL V;  3BEH A;  5JCO A;  3VBB A;  5A9G A;  5EIB C;  3OMI B;  2OWO A;  4PJ0 Z;  1KYO F;  4UCU A;  1FD9 A;  2IU3 A;  3JSL A;  3AG2 C;  3SYP A;  1HP8 A;  1LNQ A;  4QE7 A;  1IJG A;  3OM3 B;  1BQZ A;  3CCL V;  4GKK O;  3BFR A;  1QVG U;  3WB0 A;  2H3O A;  3HKD B;  4RQF A;  3HKE A;  4LFA O;  1XL6 A;  1V55 C;  4H0L B;  3IAY A;  3Q4H A;  2ZD9 A;  1XNQ O;  4DW0 A;  2CK3 G;  1NH2 B;  4JYA B;  4YJ2 B;  1Q8I A;  5J2T B;  2GTS A;  3CCE V;  2YXY A;  2OT5 A;  4LCU C;  1O9H A;  5KUK A;  2EZP A;  1W0J G;  1OCC C;  2YEV B;  4HAM A;  4TWK A;  1DF4 A;  1YZB A;  2WLH A;  2DN9 A;  3K0D A;  3J81 N;  3RWR D;  4KFM A;  3W7U A;  2HJF C;  3CSX A;  3T4D A;  3HKD A;  2JEU A;  1F4M A;  1K97 A;  2Q5Z A;  1GN4 A;  4DR7 B;  2X0L A;  1NS1 A;  5BR8 B;  3LSQ A;  4EFB A;  2UXC O;  1HR0 O;  1QR9 A;  1NU1 H;  2WLI A;  3RGB A;  4JYB A;  1SC5 B;  5CBG A;  5GW7 A;  5J2T A;  2EIN C;  4UV8 A;  1HDJ A;  1JNB A;  2FKX A;  3KKY A;  1QNM A;  4GYC B;  4UVA A;  2IJJ A;  5IY5 B;  2YEV A;  1OCR C;  4J7Z A;  1Y67 A;  1YXB A;  4CH6 A;  1NVP B;  3JYC A;  2YC0 A;  4O4L B;  1CEZ A;  3IC7 A;  3CXC U;  5B1A B;  2QKS A;  1XMQ B;  4NTW A;  5GTH Z;  4JZ2 A;  1B6Q A;  2OYQ A;  3CXH F;  2JJ2 G;  1JJ2 U;  2EBO A;  2ADP A;  4PDL A;  5JH7 B;  4TQF A;  4DUY O;  5B1B B;  5DED A;  3M7M X;  1TUE B;  5H2F Z;  1R3K C;  4LFB O;  3P3P A;  4EEQ A;  4N21 A;  2B9Z A;  3JAS B;  5DM6 V;  1K4C C;  1ZWI C;  1R1B A;  4PA4 A;  2V1D A;  2DYR C;  2UUA B;  3SYO A;  4O4L A;  1OHH G;  1KQS U;  1VF7 A;  2CTR A;  3G6E V;  2EIN B;  4DR6 O;  3MAQ A;  5JH7 A;  2B1I A;  1OCR B;  4TOI A;  1FXH A;  5KHK A;  4JI3 O;  3ZN1 A;  1HWY A;  2UXD O;  2QWR B;  2CDY A;  3W7X A;  4B3S B;  3D8C A;  3G67 A;  1Q5O A;  3JAS A;  5LGN A;  3CJH B;  3E22 A;  4F4L A;  2G38 A;  1PPJ H;  2GDS A;  4J10 A;  1KMI Z;  5D5P A;  1SKV A;  5ITZ B;  4J9Z B;  3ASO B;  1H2N A;  4ZOL B;  5IT9 N;  5KUM A;  2Q69 A;  2DE0 X;  3ZN0 A;  2P67 A;  3UQ8 A;  2CTQ A;  5K1X A;  1SS3 A;  1F7Y A;  2YIB D;  3CPW U;  1F51 A;  4MVU A;  1F23 A;  1TA8 A;  2DYR B;  4LF4 O;  4QJF B;  4B3R B;  2XTA A;  1H8H G;  2WA4 A;  4BIZ A;  1RFY A;  3LNN A;  4I0X B;  2LP7 A;  4KUM A;  1GRJ A;  4IGG A;  1Z5W A;  1Y74 B;  1GAX A;  5FL7 G;  2YIA A;  3HB3 B;  3J80 N;  1IBK O;  2F1M A;  1IUR A;  1K3E A;  1YF2 A;  2DYS B;  3T1H B;  3CHX A;  5ITZ A;  3BPZ A;  4B7E A;  4ZOL A;  3H1I H;  2ZDI C;  1FS0 G;  1FFT B;  4PA7 A;  3N2K B;  1XOU A;  1J95 A;  1M57 C;  2QJ1 A;  4K8Z A;  5BY1 A;  2RN9 A;  1WNS A;  3W7T A;  4JI0 O;  1LR1 A;  1AR5 A;  4I0X A;  4DR4 O;  5LBQ A;  1LUW A;  4MW8 A;  1Y74 A;  2ETN A;  2ZM6 B;  3ETQ A;  2ZT9 B;  4ZI7 B;  1K34 A;  4FMT A;  1QVF U;  3U11 A;  1XHX A;  5D5Q A;  3CCQ V;  2QTS A;  3N2G B;  4DR2 B;  1AJQ A;  1RPO A;  2Q73 A;  4U3F H;  5LXT B;  3I5D A;  3N2K A;  2JDI G;  4AI8 A;  3EFF K;  3UKM A;  5KA6 A;  1HNZ O;  4BIU A;  3SGI A;  4IIJ A;  4OX9 B;  3ZRV A;  3E8B A;  2ZNI A;  4K0K B;  1Z2G A;  2CTW A;  3A2F A;  5IJ9 B;  4PEL A;  2N74 A;  3QVN A;  3ZMU A;  4ZI7 A;  1YIJ V;  1RSO B;  5KHG A;  1NT2 B;  3SJQ C;  2P90 A;  4QIW F;  2QDO A;  2EIK B;  3CCJ V;  1ZTE A;  4PA9 A;  2E5L B;  2UUB B;  3N2G A;  4JI8 O;  3A0H Z;  5LXT A;  1FJG B;  2A0L A;  3ABM C;  4X62 B;  5L3C A;  1NTK H;  3D3Q A;  4R7C A;  2XHB A;  1TGO A;  4YHH B;  3K3W A;  4O4J B;  5J2U B;  3NXS A;  3CCU V;  2QR4 A;  2VWK A;  4UB6 Z;  5IJ9 A;  4RWU A;  4R50 A;  4DV1 O;  4HNA B;  4O2A B;  4J7J A;  5IYZ B;  4FLX A;  1RSO A;  3ZHS A;  4MVR A;  1K92 A;  3WB1 A;  2CGN A;  2Q7H A;  2YXH A;  4DV4 B;  1AJN A;  3T1Y O;  1FXK B;  3ZJZ A;  4J11 A;  4KP4 A;  1SRY A;  1VQ8 V;  4ZBM A;  2YSU B;  4A5U B;  2PYL A;  3ICX A;  4JAU A;  2L6L A;  4J9Y B;  4UCR A;  2QKA A;  4I7Z B;  3SPC A;  3K58 A;  4O4J A;  1S5H C;  5J2U A;  3ZHV A;  3OT7 A;  2A7W A;  2YI9 A;  3K57 A;  4FJC C;  1M1K W;  1GTO A;  1K5S A;  3ABM B;  4HNA A;  4O2A A;  3FD9 A;  1IZ3 A;  5IYZ A;  3CRA A;  3MHH C;  2LFS A;  1Q90 D;  4LF5 B;  4LF7 B;  4JI1 O;  1RP3 B;  3MDS A;  5IYB O;  3KCX A;  1FXK A;  2FML A;  4J42 A;  3FKS G;  1H2G A;  5E79 Z;  5CA0 B;  2O57 A;  3CD6 V;  4EFE A;  1ENV A;  2Q68 A;  5CB4 B;  3CRC A;  5FPR A;  2N04 A;  1OV9 A;  1DGS A;  1NQT A;  3U0Z A;  1N36 B;  3K9A A;  3AG4 C;  2Y69 C;  3K5O A;  4GKK B;  1VEW A;  2HLD G;  4FM1 A;  4P9P A;  2EZO A;  5B1O A;  3R65 A;  1FPO A;  2UXN A;  3SYC A;  4LFA B;  1ZL8 B;  1BT8 A;  1E1Q G;  4NVP A;  3ZMZ A;  4U3J B;  5B3S C;  1XNQ B;  1ZSP A;  5CA0 A;  1X59 A;  1VF6 C;  1XIL A;  2MK3 A;  3P30 A;  4X64 O;  4DR5 B;  1FOU A;  5GON B;  4JI6 B;  1WAZ A;  3CX5 F;  4YIO A;  5CB4 A;  1TAE A;  4LBE C;  1BE3 H;  5EIB D;  3UCS C;  3E86 A;  3AG3 C;  4DV3 O;  5C8Y B;  5EZY B;  3CRQ A;  4JYY A;  1I94 O;  2D2C B;  3SPJ A;  2A3Q A;  3ZMV A;  4BW9 A;  2EIJ C;  3E8H A;  4D6T H;  2HFE C;  1HNW O;  4IT5 A;  4KXR A;  1N33 O;  4JI2 O;  5E1A C;  4XBF A;  3LDC A;  3LSU A;  4OPA A;  1ZL8 A;  4FLZ A;  2JJ1 G;  1GN3 A;  2PZS A;  4LF9 O;  4U3J A;  3ZX6 A;  1BZK A;  4UXN A;  3OAA G;  3AG4 B;  3OTF A;  2E75 B;  5EBM C;  4O2B A;  1NVP D;  1Q6H A;  2FB5 A;  3ZHT A;  5GON A;  1QQC A;  1JFF A;  4MVQ A;  5LHG A;  2QM7 A;  1S76 D;  5LHI A;  5KX5 A;  5C8Y A;  3OGC C;  2Q0O C;  4JGS A;  4UFZ A;  3BA9 A;  1VQK V;  2CTP A;  3KZI Z;  5LMN B;  4DR1 O;  5B3S B;  4FM0 A;  4UCS A;  2LW7 A;  5EC1 C;  1IBM B;  4JAS A;  4F6R B;  3ABK B;  3E89 A;  4X1K B;  3ZBH A;  1GKF A;  4X8A A;  3AG3 B;  5EBL C;  1MAB G;  1Q82 W;  1JMK C;  1VQO V;  4UUJ C;  2W6J G;  4DR3 B;  1NI8 A;  2WPD G;  2A79 B;  1BMF G;  5HFL A;  5BXZ A;  4LFB B;  3VOU A;  1Y76 B;  3SPH A;  1BCC H;  4MSW C;  1Q7Y W;  2XND G;  1PL4 A;  2ZXW B;  5K1P A;  4ZHQ B;  4F6R A;  2P6J A;  1VF6 A;  5BMV A;  2PF4 E;  3QO5 A;  3E83 A;  3L73 H;  1WB8 A;  2DWD C;  2HHH B;  3F7Y C;  1WPB A;  1THZ A;  5LMU B;  5C93 A;  4QPK A;  3IGA C;  2WAM A;  4PI0 A;  1KKC A;  3VQX A;  2WLM A;  4WFE A;  5H6Q A;  1GK9 A;  5IY5 C;  4X9Q A;  4DV7 O;  1H5W A;  3ETD A;  4H33 A;  3L72 H;  2X7R B;  4UCO A;  5JVD B;  5BZB A;  5LYJ B;  1Y76 A;  3P3N A;  2XOK G;  2LQT A;  1PM9 A;  5B1A C;  1XNR B;  2R9A A;  3NR7 A;  5J9P C;  1M56 B;  4ZHQ A;  5FNV B;  3K5L A;  4LF8 O;  2HR3 A;  1YEW A;  3WB2 A;  2HEP A;  1VAR A;  3FFQ A;  5B1B C;  3K5N A;  1MZE A;  1BGY H;  1FYJ A;  4LF4 B;  5H5N A;  3CEI A;  5KAF Z;  1IBL B;  3U10 A;  4NB5 A;  2KG7 B;  5IWA O;  3ZRS A;  4JPR A;  1VQP V;  2YIC A;  2ZCE A;  1N4C A;  2PUS A;  2W6I G;  2F4V O;  3OEE G;  2F93 B;  1YHQ V;  2OIE A;  1KD1 W;  5LYJ A;  5JVD A;  2PY5 A;  3IJ4 A;  5B1N A;  1AVM A;  1OJH A;  1FKA O;  2NNU A;  4DV2 O;  5FNV A;  3ETE A;  4YJ2 A;  1QR8 A;  2QWP B;  4CH3 A;  3MHS C;  4FFB B;  3UT5 B;  4U7N A;  3SYQ A;  2VQE O;  3TXS A;  1U97 A;  1XI1 A;  2NLJ C;  4CH5 A;  3EXA A;  1BHB A;  4JI4 O;  1IDS A;  3ZS8 C;  1VQ4 V;  2KG7 A;  1X4T A;  4JI0 B;  1XRE A;  3JAM N;  4DR4 B;  2ZR2 A;  4WCE V;  1K7D A;  2LGW A;  2BE3 A;  2Y0P A;  1K33 A;  1N34 O;  1VQ5 V;  3FX7 A;  3ASO C;  4LF6 B;  1V54 C;  3OR6 C;  1RM1 B;  1BQ0 A;  3UO3 A;  4FFB A;  1Y4M A;  4AHC A;  4LFC B;  1XHZ A;  2NN4 A;  2LO1 A;  4GKJ B;  2MW2 B;  4DV5 O;  2F43 G;  4KL1 A;  3W7S A;  3OTO B;  4XDJ A;  2UXX A;  1HNZ B;  1F4N A;  4JTA B;  3JAT B;  3E8F A;  4IYI A;  5LOV B;  2R9R B;  1J5E O;  4LH7 A;  1HNX B;  3TET A;  1SQX H;  3OEH G;  2DYS C;  4GT1 A;  2NR5 A;  5JJE B;  4B3T O;  3RVZ A;  3BCC H;  3H01 A;  3L75 H;  4H37 A;  3STL C;  3G6B A;  1K4D C;  3ZCC A;  3AG1 B;  3HR0 A;  4E4E A;  4PDM A;  4DV6 B;  5CN0 A;  2Q67 A;  4ZKI A;  4Q6G A;  1MA1 A;  4G2K A;  5B66 Z;  3B8M A;  1QHT A;  1Q3E A;  4KHP B;  3JAT A;  3JD4 A;  1D5N A;  3ASN C;  4G28 B;  5LOV A;  5IYC O;  1SZX A;  1V54 B;  3GVM A;  2FTK A;  4ZIB A;  1MG1 A;  4FVM A;  4FLU A;  1GH6 A;  4L87 A;  2F66 C;  2UU9 O;  2AXT Z;  2Q7E A;  2IH3 C;  3D36 A;  4JI7 B;  2V4D A;  2ZNJ A;  3F7V C;  3E8G A;  1N32 B;  1K5Q A;  2X6B A;  4TUY B;  2ARH A;  3LUT B;  4DK1 A;  1ORQ C;  5KLV H;  2EIM C;  1FAF A;  4X65 O;  2A06 H;  3ETG A;  3AK1 A;  3SDL A;  4HBN A;  3CJH A;  1WP7 A;  2E74 B;  2QM4 A;  4NXN O;  3J7A U;  4UV9 A;  5FLX N;  1R6K A;  4OGQ B;  2DQ0 A;  4X88 A;  1E1R G;  1EFR G;  2D3O W;  5JWP A;  2VQF B;  2W0F C;  2M6Y A;  4DRX B;  2OCH A;  3JD2 A;  3K5M A;  2IBZ H;  4NYK A;  4I9W A;  5BR8 O;  2P5O A;  4CC6 A;  4LH6 A;  1R6N A;  1JX9 A;  3R66 A;  3QO8 A;  4IYH A;  1L0N H;  2XT9 A;  2EIK C;  2VS0 A;  4JI1 B;  2Q7G A;  2M7W A;  4DYL A;  1UFI A;  2P4V A;  4TUY A;  2KQX A;  1E79 G;  3LDE A;  3ASN B;  4GX0 A; 
#chains in the Genus database with same CATH homology
 2GDS A;  1VAR A;  3MDS A;  3CEI A;  1B06 A;  1QNM A;  3KKY A;  3QVN A;  1BS3 A;  1BSM A;  1Y67 A;  1AP5 A;  4E4E A;  3C3S A;  3DC5 A;  5A9G A;  4JZ2 A;  1MA1 A;  1ZTE A;  1GN6 A;  4C7U A;  1AVM A;  1VEW A;  1ZLZ A;  1N0N A;  3K9S A;  1N0J A;  1XUQ A;  1I08 A;  1P7G A;  1JR9 A;  2ADP A;  4YIP A;  1D5N A;  1SZX A;  1EN5 A;  1AR4 A;  1GN2 A;  3BFR A;  1BT8 A;  1AP6 A;  3EVK A;  3KDR A;  1PL4 A;  1MNG A;  1ZSP A;  2AW9 A;  1XIL A;  1IDS A;  3AK2 A;  1MMM A;  2ADQ B;  4YIO A;  1XRE A;  1I0H A;  2QKC A;  3AK3 A;  1WB8 A;  2RCV A;  3AK1 A;  4GUN A;  1WB7 A;  3C3T A;  4JYY A;  4JZG A;  2CE4 A;  1EN6 A;  2P4K A;  1AR5 A;  3TJT A;  4BR6 A;  1LUW A;  3IC9 A;  1JA8 A;  1IXB A;  1KKC A;  4FFK A;  5AG2 A;  3LSU A;  1EN4 A;  1ZUQ A;  1EM1 A;  1GN3 A;  4X9Q A;  2QKA A;  1XDC A;  3RN4 A;  3DC6 A;  1IX9 A;  4F6E A;  2CDY A;  1PM9 A;  3OT7 A;  1LUV A;  1GN4 A;  1MSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...