1SZXA

Role of hydrogen bonding in the active site of human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGFGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Role of hydrogen bonding in the active site of human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1szxA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1szxA02
1QNMA 1MA1A 1MSDA 2CDYA 1VARA 5A9GA 1I08A 1WB8A 3AK3A 1N0NA 1JA8A 1EN5A 1I0HA 3IC9A 1GN6A 1XUQA 1MMMA 1PL4A 1JR9A 3QVNA 2RCVA 1IXBA 3LSUA 2ADPA 1LUWA 1ZLZA 2QKAA 1PM9A 1GN3A 1ZUQA 1XDCA 1SZXA 3BFRA 1GN2A 2P4KA 1P7GA 4JZ2A 1WB7A 1EN4A 3CEIA 3KKYA 1BS3A 1AP6A 1LUVA 1AR5A 4BR6A 1ZTEA 1B06A 1IDSA 3C3SA 1VEWA 1N0JA 1EN6A 3K9SA 4FFKA 4GUNA 3C3TA 4JYYA 4E4EA 1XREA 2ADQB 1XILA 4X9QA 1BSMA 1AVMA 3EVKA 3AK1A 1EM1A 4C7UA 1BT8A 1ZSPA 1AP5A 1MNGA 5AG2A 3DC6A 4F6EA 3RN4A 2CE4A 3MDSA 4JZGA 2QKCA 1Y67A 1IX9A 4YIPA 2AW9A 3OT7A 2GDSA 1KKCA 4YIOA 1D5NA 3AK2A 3TJTA 3DC5A 1GN4A 1AR4A
chains in the Genus database with same CATH superfamily
2CGOA 3RGBA 1K5QA 2CDYA 4MVZA 4GKKB 1YSCA 4DO2A 5B1BC 3BA8A 1TVKA 4TV8B 2AXTZ 4JTCB 3O9OA 5JQGB 5LYJA 4F4LA 3N27A 4CH5A 2AHYA 4LNUB 2JGDA 2UUBO 2H94A 5LGTA 4FLYA 2A3QA 4IHJB 3FYIB 2OCHA 2E74B 3LSUA 2DN9A 4U3JB 2PI5A 4JI6B 1JQ0A 1KYOF 1U97A 1GN2A 1GM7A 4PA3A 1P7GA 2NR5A 1P4RA 1EN4A 1NR1A 2QJ1A 1E1RG 4B7KA 1SQFA 4PA4A 3KCYA 4LBEC 3H1LH 4X1KB 1O9HA 4GT1A 3CCUV 2NN4A 2CGNA 1SQXH 1DLBA 1KP3A 1KECA 1FXKA 1NH2D 2ZXWB 3C3SA 3D8CA 2XT9A 3A0RA 1FFTB 4TQFA 2Q6AA 1XNQB 2CTPA 3UT5A 1S5LZ 4L87A 1NJIW 4P30A 4LH7A 5L3BA 4JPRA 5ITZA 4JYYA 4LF6O 2VQFO 4LFBB 2Q0OC 3CRRA 1GM8A 3SPHA 3K03A 1JCHA 1QCEA 1L8DA 1J95A 3SGIA 2IJHA 4O4HA 2LFRA 1R3IC 5IJ9A 5LMUB 3FKSG 1ZX3A 3JATA 2CTQA 3JD0A 1FOUA 2AW9A 4JTAB 4UCOA 1VQMV 1YHQV 1BQ0A 3K0GA 1XHZA 1R6TA 2ZE8A 1FJGO 1G4YB 2WLLA 1FXVA 5H9CA 2BOCC 3NR7A 5F2VO 2JIZG 3CJHB 2D2CB 3I55V 5IJ0B 2GUZA 3JAKA 4ZKIA 3L71H 4F6RB 1BMFG 1I0HA 1DTOA 1XQ8A 3SDLA 1Q6UA 4LH6A 4X20A 3ZRVA 3CC4V 4AI8A 1ZWIC 4DV3O 1Q82W 1ZUQA 4J10A 3KCXA 4XBFA 2QWQB 1N4CA 4P2ZA 4DR4O 2PGGA 4LF5O 1B6QA 2YICA 4KFMA 1MZFA 3CP1A 3L72H 2EILB 2W0XA 4ZHQB 1EZJA 2BTQA 4ICGA 5KHIA 4MTXA 4XDLA 4CS3A 3A0HZ 4WCEV 3WG7B 3CE2A 4FLUA 4FM1A 3K9SA 2EILC 3JAWB 3OEHG 3GB7C 5DN6G 4FZ1A 3ZMZA 4DR7B 1WJZA 2MW2B 2GTAA 2P67A 1FAFA 2QSAA 1EM1A 4DR6B 4R6ZA 3OR6C 3A8TA 4NXNB 2R9RB 4CH6A 4JGSA 3M7MX 2CE4A 2XOKG 2EIJC 2GHYA 4ZBMA 4FLVA 2OTLV 1DF5A 4DK1A 4L8JA 4QNHB 3L9DA 3E8BA 4FM0A 1Q8IA 2UU9O 5KAFZ 3DSQA 4TQDA 1Y74B 5EZYA 3CCRV 2FB5A 3F5TA 1GN4A 2Y4UA 2QA4V 1IVSA 3OUSA 2WLNA 4DR1B 4YY3B 5J2UB 3THOA 3CRAA 4JI4O 5L3FA 1XEQA 4JF3A 2UUAO 1H2GA 1XOUA 3N2GB 4DV1B 1Q90D 3OD4A 2QM7A 3AG2B 3BABA 1BZKA 2EJ7A 3ZS8C 4UVBA 1GN6A 2A9HA 4MTGA 3ETDA 1ZAUA 1E1QG 1WPBA 3FD9A 1IXBA 1LUWA 5CA0B 3K06A 1M93A 2VWKA 4UVCA 2DJVA 3NXSA 3IC7A 3AG2C 4MS2A 1VQNV 5BXZA 1SZXA 4JYAB 2P4KA 1FFXA 1WB7A 3CMEV 4LF4O 4DV5B 1JX9A 1Z5VA 4O4HB 2GSMB 1QR9A 1LUVA 5EBWC 2CK3G 4PV1B 3SYOA 5KMGA 3HKDB 3QO7A 4TUYB 1IDSA 4NB5A 5LA6B 3B77A 2L6LA 2YC0A 3LDDA 4YHHO 3QO5A 1SESA 5LXTA 5EIBC 4CC5A 1E79G 3JALB 5B3SC 1HW7A 3J80N 4JI8O 4JI1B 3HKBB 5GONA 2GUZB 2LGQA 1BT8A 4GKKO 3VQVA 4TSFG 2UUBB 1M4UA 2ZE5A 4AILC 2JGUA 1JPXA 4I9QA 4LFCB 1YEWA 2WPDG 1LNQA 1VF6A 1K4CC 1KQSU 5GTIZ 3Q4HB 4RO2A 1QR8A 2ZQMA 3TK1A 5L3DA 1GH6A 3SYCA 3K3WA 4LCUC 4KL1A 2QM8A 3CC2V 3OMNB 2IJKA 2IJJA 2N74A 3CRMA 4U7NA 2KB1A 5J2TB 1N0NA 3SYQA 5H5NA 1XUQA 1Q43A 2Q9LA 1PPJH 1XNQO 1OJHA 1RSOB 3QTCA 2YUAA 4LC1A 3ZEDA 2ZT9B 4MW8A 1NH2B 3EHBB 1VQ7V 5KUKA 4LFBO 1EZVH 3SJBC 1BS3A 1AP6A 1AR5A 3AG1B 5B1AB 3CCEV 4FIPC 3ZRWB 1AB3A 1N32O 4EFEA 5LMUO 3ML0A 4IIJB 4O4IA 1XNRO 2F43G 2DWEC 2BE3A 4O4LB 2ZD9A 4O2AA 2W6JG 4N21A 5B1AC 1BHAA 4FFKA 1K4DC 2LO1A 4I4TB 2CH7A 1HNWO 2Y69B 3G67A 1P84F 2V7QG 4TV8A 3RVZA 4CH3A 4KUMA 3FFQA 3EXAA 5JQGA 1MNGA 2HG5C 4OX9O 3ABKC 1P49A 3MD0A 3J81N 4KHPO 2RNBA 4LNUA 3DC6A 2ZR3A 2Y69C 4QJFB 4DV3B 3JASB 4IHJA 2PY5A 1G1XB 1HNZO 3W7SA 5KHGA 2QKSA 3VQYA 3UM7A 4U3JA 4JV5B 4LF5B 5IWAB 3AK2A 2KSDA 4D6TH 2XUMA 3MHHC 2XTAA 1NQTA 2P4VA 2IH1C 4X1KA 4TV9B 2ARHA 5KHKA 1YJNV 4MVSA 2LGWA 3GVMA 1KU9A 2RJZA 3ASNB 3E86A 4PELA 3T1CA 5LMNB 1YF2A 1S5JA 3HPLC 2EIMC 3ASNC 1XMOO 3OEEG 2B9ZA 3CC7V 4UFZA 1RM1B 1Z5WA 1VQ6V 1TA8A 4MVRA 3VOUA 2P6JA 4EB6A 4NXNO 3ZHUA 5E1AC 1JVMA 3W7UA 2UU9B 1IURA 3HR0A 2AZ2A 2CTWA 3TETA 1RM1C 1SQBH 4MVQA 5A2QN 1G6UA 2OT5A 4TWKA 4I55B 2HEPA 5L3GA 2RDCA 2G38A 2UUAB 2HR3A 2IU0A 5LHHA 2W0FC 3R66A 4UCSA 4R50A 5IJ0A 3KDRA 4J11A 2WLHA 4F6RA 1S77D 2P06A 1HDJA 4DV1O 3H1JH 2YDEA 2WLIB 1H2KA 4J7ZA 1AI4A 1I94O 4GX2A 1AJQA 2IU3A 2QKCA 1OCOC 1Y4MA 5EIBD 2GDSA 5E79Z 3LUTB 2QWOB 4YIOA 5D5PA 1JMKC 3SPJA 4D7TA 1IBLO 3L75H 1GK9A 5LOVB 3M8AA 4JYAO 4GX5A 5A9GA 4UXNA 2HFEC 4DV5O 1YDXA 2Q7GA 4ZHQA 5JJJB 3CCSV 2VRZA 1BQZA 5B1BB 3RYCA 3K5NA 4BIUA 2O57A 5H6RA 2RCVA 3B8NA 1M56B 4FFBB 4OXSA 3JAWA 4FMTA 3FB6C 4JI8B 2CH7B 4D7SA 1PM9A 3I56V 1GN3A 4G2KA 4XDKA 2Q0AA 4OPHA 3ZHVA 4Z1MG 2ZKOA 1PKXA 4X8AA 1RPRA 3K5OA 1M56C 1OCCB 4JI1O 1VQ9V 5GTHZ 2PI4A 1SS3A 2N05A 3OM3B 3OTOB 3APOA 4LFCO 2EULA 1NZ6A 1OCCC 4W4LA 1FXHA 2YXYA 2PYJA 3RBZA 2ITDC 4Z2WA 4JI5O 4QE7A 1Y74A 1WPXA 3H9VA 2BOBC 4FLXA 5DEDA 2HJFC 1GTOA 4X9QA 3MHSC 4Z1VA 2XAHA 5J2UA 1AI6A 3X2QB 3A2FA 4UVAA 3N2GA 1FYJA 4RWUA 2KKWA 2V1DA 1X59A 5CN0A 4IYHA 2E75B 3ABTA 3C90A 4DV2B 3X2QC 5CA0A 2EINB 1KKCA 4LF9O 5K1XA 5FLXN 1LR1A 3G80A 1S0VA 1YJ9V 2Q7EA 1KB9F 4PHZA 3ZMTA 4X89A 1MSDA 3WFVA 2CUGA 5LGNA 1YVWA 1WP7A 2EINC 1N32B 3UKMA 2HKOA 3CSXA 3GWKC 4EB6B 3HKDA 3RW0A 4TUYA 1XNRB 3OGCC 1V55B 2EJRA 1XI1A 2WLKA 3B4SA 5D5QA 4KXRA 2XNDG 5LA6A 1VF7A 1BL8A 2ZR2A 1I5XA 2RQ6A 1HNWB 4G27B 3M99B 1OCRB 4K3AA 1V55C 4JI2O 1H38A 2Q67A 4FVMA 3JALA 1Q6HA 2JVDA 4OX9B 1K8AW 1MG1A 2ZCEA 3HKBA 1D2DA 3EFFK 4KHPB 4K0KO 5HFMA 2MK3A 1H2MA 1OCRC 1YZBA 1HNZB 1AILA 4BR6A 4PA7A 4LFAO 5CB4B 2ZINA 2BSKB 1UJWB 3BVOA 3IFXA 1NVPB 3F7VC 2M6YA 5LL6Y 1N0JA 1GKFA 3Q4HA 4O2BB 3L74H 2GTSA 3O65A 5L3EA 1QLEC 1YI2V 3G71V 4JV5O 2WA3A 5IWAO 1KC8W 3BA9A 1S5HC 3JARB 4J42A 5KA5A 4PA9A 3BRCA 3HKEB 1NR7A 2FKXA 5J2TA 1WLEA 1OCZC 2QDOA 3RYCB 4F6EA 1NKDA 4EFBA 1XMOB 2JK5C 2UXDO 1F4NA 5LMNO 4R8CA 5JH7A 3VBBA 3RT3C 1RSOA 3E8FA 1CXZB 4P9PA 4Q6GA 2EIJB 2A7WA 3E22B 3RWRD 1JNBA 3OAAG 5JWPA 2D3OW 4RUEA 2Q68A 2Y48A 5L3CA 3E89A 1W0JG 3CD6V 4MW3A 4PI0A 3ZRWA 1YIJV 3ABLB 2JRIA 5KX5B 4IIJA 3LSQA 1NTMH 2A79B 1MMMA 3D3IA 4O4LA 2YI9A 2XAGA 2E5LO 3E2EA 4I4TA 3ABLC 4NTWA 4ZIBA 3D36C 1N8RW 2YIDA 2P22C 3CRCA 3CCJV 4YJ3B 1YITV 4UCUA 2ZDIC 3ZMUA 3RYFB 1N34O 4TT3G 1I94B 1WP8A 4PD4F 3OMAB 3K59A 4MTOA 2EIKC 3ZHSA 4PJ0Z 1HR0B 4DXWA 3JASA 3CWBH 1IXMA 1IBLB 3ETEA 1KP2A 1K5SA 3AG3B 3CS5A 4J7JA 2Q69A 2AHZA 1O9GA 3FYEB 2Z3YA 5B1NA 1F7YA 4DRXB 1K3EA 4XDJA 4E4EA 5FPRA 3AG3C 3AK1A 5IY5B 1FXKC 4TV9A 5IDJA 1ORQC 3ZRXA 4B3SB 2E76B 5B3SB 1SC5B 2QM4A 4GYCB 4J41A 5JCOA 1R3KC 4HAMA 5IY5C 3ABUA 3ABMB 4EKWA 4G28B 1KUQA 3G6EV 3S3WA 4LF8O 1NBMG 2ZE7A 4B3MO 1MABG 1VQ8V 3CMAV 3BHPA 1VIBA 4WF9V 3ABMC 4DV4B 4DUYB 3U10A 3DGEA 2VWJA 3K08A 4AHCA 2KQXA 4LR3A 3H1KH 1M57B 3ZMVA 3K5LA 4GZRB 2N04A 4JI5B 2DQ0A 3SJQC 3VQWA 1VQPV 3OTOO 1SQQH 1YXBA 2R70A 1WNSA 1US6A 2XAFA 1ZLZA 2QKAA 1M57C 4I55A 4A5UB 1YTFD 2LQTA 1AROP 4U7OA 2LP7A 4DR3B 4I50B 2VS0A 1WA8B 4HZ3A 3WU2Z 4LWSB 1GM9A 1VQ5V 2HVKC 2WLIA 4LF9B 3P3NA 1ZL8B 5JH7B 2PF4E 3JCUZ 4FM2A 3B40A 4DV2O 1CPYA 3ZHRA 5LOVA 5CA3A 5KAIZ 4BW9A 3IGAC 4W4KA 3IAYA 2OIGA 3UO2A 5EC1C 3BPZA 3W7TA 4RQEA 3N2KB 4X62B 2OIEA 2P7TC 1K33A 1HWYA 4X88A 4QIWF 4RUFA 4JI2B 4X65O 2R9AA 4ZOLB 4FFBA 3ABKB 4JAUA 1QLNA 1NVPD 4K0KB 3WB2A 5CBHA 2WAMA 3SPGA 4UCTA 2IBZH 2X0LA 1VP7A 1DK1A 4LFAB 3K0DA 3BY6A 4X64O 1TGOA 2QE7G 4ZI7B 4CZZA 2UXBO 3L70H 1AR1B 3JD4A 5KHJA 4JI7B 3KZIZ 4UCVA 3A0BZ 2UXNA 1W0KG 3HKCB 2ZIOA 1VQOV 2Y0PA 1X4TA 3E35A 5EBMC 3KG2A 1XBLA 1SQVH 1IBKO 4DV7B 2ADPA 2YXHA 5BMVB 2ZM6O 2RN9A 3ICXA 1PNMA 2WLJA 1IBMB 1YCIA 4NTXA 3CEIA 2EIMB 2QGNA 1VQLV 1MZEA 4E2LA 1BCCH 4FK5C 3BCCH 2UXDB 1ZTEA 4BIOA 1JFFA 1OV9A 2BCCH 5KUMA 1S76D 4LP8A 4DV0O 2F93B 2HHHO 4GKJB 3ZBHA 1RFYA 2P90A 2FL4A 2JJ1G 2KG7B 5EC2C 4UB8Z 5FNVB 5BZBA 5H2FZ 3T2MA 5CBFA 3U11A 1XREA 1XILA 2EX3A 4J9ZB 1R3JC 4C7UA 1QVFU 4JI3B 5IT9N 4DR5O 1PNLA 1R1BA 3JSNA 2E5LB 4BWAA 4MVMA 1H5WA 4MVUA 1WN7A 2A06H 4IT5A 4X1YB 1G8MA 3B09A 1Y67A 4B3TO 1SQGA 1SZTA 4NXMB 1K92A 1TUBB 1VQKV 3MAQA 1N34B 4UV8A 4RQFA 5DM6V 2F66C 3R65A 3JD3A 1OCOB 2VQEB 4MVOA 4HBNA 1I08A 4JYCA 3K04A 1H8EG 1UPGA 2DMXA 5K1PA 1VF6C 2B1GA 3F7YC 5CB4A 2BSKA 1N33B 2Y4TA 3G4SV 1HR0O 3AEIA 3IC9A 5HFLA 3QVNA 2OWOA 4O2BA 3WB0A 2YS8A 2X6AA 3JARA 1H8HG 3OTFA 4JZ2A 1ENVA 5IYBO 4KP4A 3FB5C 3HKEA 4CBCA 2JDIG 4H0LB 4FPPA 1WAZA 2PTMA 1SA0B 4FLWA 4HYOA 2L35A 3TCUA 1PNKA 4QPKA 1XL4A 1TUEB 2OTJV 2IM9A 1GO3F 1L0NH 4B3SO 5C93A 1HP8A 4LF8B 2X6CA 3UO3A 2AGAA 4B3MB 2YEVB 3DTUB 2JS5A 4I0XB 1K73W 1EN6A 2DE0X 1QQCA 4WFAV 4X1IB 3WB1A 3E22A 3C3TA 4H33A 1AJNA 2M7WA 1BSMA 2EZPA 4WBNB 3OFNG 4DV4O 4DUYO 4BIZA 1OZ0A 4NYKA 1S3JA 3AG4C 3VQXA 1ROPA 5KX5A 3H01A 3D36A 3RN4A 2QWRB 3MDSA 2FYUH 3QF7A 2F23A 2ZDIA 3UCSC 3CX5F 1F4MA 1NU1H 5IYCO 1MOFA 4YIPA 3OT7A 1B04A 3APQA 4PDMA 3OR7C 4P9OA 3SJAC 5IE9A 4YJ3A 3SYAA 1QNMA 5C8YA 3JAMN 3ETGA 5JJEB 3GWOA 3RYFA 5FL7G 1CEZA 4IGGA 4DR3O 1JFFB 4QGPA 1WB8A 1PP9H 1PV0A 3JD1A 2YI8A 4AQYB 3RYHB 5KHHA 1YTFB 3FX7A 1EN5A 2OCCB 5EYPB 4IL6Z 1I5YA 2X7RB 4QPJA 1HNXO 3T1HB 2W6IG 5IYZB 1Q3EA 4DW0A 4DRXA 3B8MA 4LF7O 1JOYA 2OCCC 2YIBD 2Q5ZA 4NKGB 4J80A 3P30A 1U96A 1V9PA 2ZXWC 5H6QA 2IJIA 2Z0AA 3KKYA 1K97A 2HJDA 4X65B 4X62O 3QNEA 2DW4A 1DGSA 3TXSA 1KMIZ 4GX1A 4PA6A 3E8GA 2P5OA 1NS1A 2OYQA 2Q7HA 1NT2B 4X64B 5IYDO 4DK0A 3QO8A 1Y66A 2UXBB 1PL0A 4J9YB 4DV6O 3G6BA 2XHBA 2EZOA 3EVKA 4UUJC 1QLEB 2PYLA 2Z5UA 5LHGA 1Q81W 3CXCU 1YJWV 5AG2A 1IBKB 4JI7O 5LP6B 3ETQA 2ZIMA 3CYOA 5JVDB 3H1IH 2ZM6B 2UXXA 4I5SA 1OCZB 4DV7O 4R7CA 1XMQB 5LP6C 3TJTA 3DXRB 2CTRA 3ZIAG 3CCQV 2E3CA 3FAVA 4DYLA 2HP8A 1MA1A 4I50A 1VARA 5BR8O 1F51A 4DR2B 1T5EA 1IBMO 4YJ2B 4DV0B 4FLTA 1VQ4V 1WA8A 2HHHB 1AJPA 2QTOA 2F4VO 1NI8A 4LWSA 2R72A 2QTSA 3STLC 2UXCB 1H2SB 3U0ZA 2GV9A 1ZL8A 1RPOA 2QWPB 4GKJO 1GMGA 3AG7A 1P7BA 1SKVA 3FB7C 1F23A 3F5WC 1R6KA 3ZHQA 3TXQA 3RYIB 1J5EB 2B1IA 3BFRA 1SETA 4DR5B 4PDRA 2QEXV 3N2KA 3CCLV 5J9PC 1TVKB 4JI3O 3WG7C 5LHIA 1RP3B 2HVJC 4B3TB 3UQ8A 5LYJB 4ZOLA 2DOSA 2JGDB 2YIBA 1GRJA 2EIKB 1Y76A 2UUCO 2QR4A 5DECA 5C8YB 4GCZA 4NXMO 3FB8C 4ABMA 4ZI7A 5B1OA 3H1HH 1H2NA 2Y0IA 3RVYA 2VQEO 2JEUA 2WA4A 1Y6XA 5CMUA 1CP9A 1AP5A 4K8XA 3TGUH 3HKCA 2ITCC 4N23A 3T1YB 4DUZB 2K1EA 5GW7A 4JI0B 1FD9A 1FXKB 3SJCC 1N33O 2CAZC 1K7DA 4GX0A 5B5EZ 1N36O 4B7EA 4I9WA 5BMVA 3UT5B 2LFSA 1OHHG 1VMGA 3SPCA 1QHTA 5ITZB 1Q6IA 1AR4A 3PN1A 4HNAA 3S3XA 4OPAA 4B3RB 2X6BA 1NTKH 2H8PC 3P3PA 3K9AA 4UCRA 5LGUA 3ASOB 5KLVH 1COWG 1BHBA 4WFGA 1R73A 5IJ9B 3ZHTA 1MSWD 3K58A 1QBZA 2DWDC 1JR9A 2KG7A 5FNVA 3JATB 4QE9A 3ZJZA 5LBQA 4H37A 3LSSA 3ASOC 4WFFA 4X66O 1R3LC 3HB3B 5CA1A 2QWNB 2WLLB 3PJSK 3CCVV 1VF5B 4FLZA 4ASUG 3P32A 4WFBV 2ILMA 1AI5A 1B06A 1IZ3A 3JAKB 4IYIA 3E8HA 2JS3A 2XASA 2ZE6A 3LNNA 4YXWG 4X1YA 1V54B 4X20B 1TUBA 3FAVB 4H44B 1GAXA 3LDEA 3E83A 5EK0A 1V54C 4TOIA 1IJGA 4FJCC 1AI7A 4JI6O 4CS2A 1THZA 2XAJA 2B5UA 5EBLC 1HNXB 2EBOA 3CPWU 3W7WA 4AQYO 2BTQB 3B2EE 5KA6A 4LF7B 3JD2A 4O4JA 2PZSA 3I5DA 4PDVA 3T1HO 3STZC 3LDCA 2Q4PA 4CC6A 4LF6B 2VQFB 1D5NA 1SF9A 4WFEA 1UFIA 2DYSB 4U3FH 3JSLA 3QG5A 1R6NA 2NNUA 2PUSA 1SA0A 3ZMSA 2IH3C 1K9MW 1EBOA 4I7ZB 2DYSC 2JJ2G 1KBHA 1H2LA 2YEVA 3LNMB 4I0XA 1A32A 1Y76B 3K79A 1XL6A 1PL4A 3K5MA 2FMLA 4DV6B 4X1IA 2ETNA 4J7KA 4H13B 1FJGB 4MSWC 5BY1A 2ZNJA 3SR2C 5EZYB 3OE7G 2NLJC 3AG1C 2Q8VA 4WBNA 2JEXA 5CBGA 3SYPA 4RAIA 3T4DA 2LW1A 2YSUB 2FTKA 3JYCA 2AZ0A 1M90W 3OW2U 3L73H 2ODMA 4MTFA 1KD1W 4B08A 1VEWA 1Q7YW 1QVGU 1BE3H 4EEQA 4PDLA 5BR8B 2C2AA 1XHXA 2WLMA 4HNAB 4BW5A 4CS4A 1XMQO 2F4VB 2F1MA 2ADQB 4DR4B 1AVMA 3JCZA 1FFXB 4JTDB 1NTZH 1JJOA 4DR2O 1D5AA 1BGYH 3T4ZA 1W2BU 3RYHA 4UB6Z 3ZN1A 2WSSG 3CHXA 5KMGB 1S72V 2UXCO 1M9NA 2Q73A 5EYPA 2GBOA 5JJNB 4NTYA 4JZGA 3BAAA 1FKAO 5IYZA 1IX9A 1Q86W 3SPIA 1M5IA 1PD3A 2YIAA 2IW5A 4JAVA 4OGQB 5CA1B 4JASA 3DC5A 3CRQA 5B66Z 5LXTB 1J5EO 4WFHA 4NVPA 5GONB 5JCOC 4DR7O 2A0LA 4Q20A 3AK3A 1W59A 4DR6O 2R9IA 1JA8A 3CB2A 2UUCB 2ZNIA 5FPOA 3ZN0A 3IJ4A 2HLDG 3ZRSA 4UV9A 4BAYA 2YXLA 1TAEA 1URFA 4DW1A 2H3OA 1M1KW 5TISZ 1XDCA 3OMIB 2F95B 1B3QA 1SQPH 2K9PA 3CXHF 2WWWA 4JI4B 4CH4A 1N36B 3CJHA 5LP6A 1L0LH 4K8ZA 4JYBA 4K35A 1L1FA 4DR1O 4O4JB 5JVDA 4YY3O 3T1YO 1Q5OA 2LJ2A 4DUZO 4JI0O 2DQ3A 4GLXA 1QU7A 1Z2GA 2DYRB 1K34A 3K57A 2ATKC 3D3QA 4MT8A 3J7AU 2RMKB 1SRYA 3DXRA 4GUNA 3ZX6A 1I7FA 3ZCCA 4LF4B 1FPOA 2DYRC 4NR1A 3BEHA 4YJ2A 3OGIB 4B3RO 1ZSPA 4PI2A 1JJ2U 2BTOA 3RFRA 2LW7A 2V4DA 4X66B 4O4IB 3AG4B 4YHHB 3CCMV 3OUFA 4O2AB 4JAAA 1KKDA 3RYIA 1FS0G 1SERA 4FZ0A 3W7XA 1DF4A 1EFRG 2XAQA
chains in the Genus database with same CATH topology
1QNMA 1MA1A 1MSDA 2CDYA 1VARA 5A9GA 1I08A 1WB8A 3AK3A 1N0NA 1JA8A 1EN5A 1I0HA 3IC9A 1GN6A 1XUQA 1MMMA 1PL4A 1JR9A 3QVNA 2RCVA 1IXBA 3LSUA 2ADPA 1LUWA 1ZLZA 2QKAA 1PM9A 1GN3A 1ZUQA 1XDCA 1SZXA 3BFRA 1GN2A 2P4KA 1P7GA 4JZ2A 1WB7A 1EN4A 3CEIA 3KKYA 1BS3A 1AP6A 1LUVA 1AR5A 4BR6A 1ZTEA 1B06A 1IDSA 3C3SA 1VEWA 1N0JA 1EN6A 3K9SA 4FFKA 4GUNA 3C3TA 4JYYA 4E4EA 1XREA 2ADQB 1XILA 4X9QA 1BSMA 1AVMA 3EVKA 3AK1A 1EM1A 4C7UA 1BT8A 1ZSPA 1AP5A 3KDRA 1MNGA 5AG2A 3DC6A 4F6EA 3RN4A 2CE4A 3MDSA 4JZGA 2QKCA 1Y67A 1IX9A 4YIPA 2AW9A 3OT7A 2GDSA 1KKCA 4YIOA 1D5NA 3AK2A 3TJTA 3DC5A 1GN4A 1AR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNM A;  1MA1 A;  1MSD A;  2CDY A;  1VAR A;  5A9G A;  1I08 A;  1WB8 A;  3AK3 A;  1N0N A;  1JA8 A;  1EN5 A;  1I0H A;  3IC9 A;  1GN6 A;  1XUQ A;  1MMM A;  1PL4 A;  1JR9 A;  3QVN A;  2RCV A;  1IXB A;  3LSU A;  2ADP A;  1LUW A;  1ZLZ A;  2QKA A;  1PM9 A;  1GN3 A;  1ZUQ A;  1XDC A;  1SZX A;  3BFR A;  1GN2 A;  2P4K A;  1P7G A;  4JZ2 A;  1WB7 A;  1EN4 A;  3CEI A;  3KKY A;  1BS3 A;  1AP6 A;  1LUV A;  1AR5 A;  4BR6 A;  1ZTE A;  1B06 A;  1IDS A;  3C3S A;  1VEW A;  1N0J A;  1EN6 A;  3K9S A;  4FFK A;  4GUN A;  3C3T A;  4JYY A;  4E4E A;  1XRE A;  2ADQ B;  1XIL A;  4X9Q A;  1BSM A;  1AVM A;  3EVK A;  3AK1 A;  1EM1 A;  4C7U A;  1BT8 A;  1ZSP A;  1AP5 A;  1MNG A;  5AG2 A;  3DC6 A;  4F6E A;  3RN4 A;  2CE4 A;  3MDS A;  4JZG A;  2QKC A;  1Y67 A;  1IX9 A;  4YIP A;  2AW9 A;  3OT7 A;  2GDS A;  1KKC A;  4YIO A;  1D5N A;  3AK2 A;  3TJT A;  3DC5 A;  1GN4 A;  1AR4 A; 
#chains in the Genus database with same CATH topology
 2CGO A;  3RGB A;  1K5Q A;  2CDY A;  4MVZ A;  4GKK B;  1YSC A;  4DO2 A;  5B1B C;  3BA8 A;  1TVK A;  4TV8 B;  2AXT Z;  4JTC B;  3O9O A;  5JQG B;  5LYJ A;  4F4L A;  3N27 A;  4CH5 A;  2AHY A;  4LNU B;  2JGD A;  2UUB O;  2H94 A;  5LGT A;  4FLY A;  2A3Q A;  4IHJ B;  3FYI B;  2OCH A;  2E74 B;  3LSU A;  2DN9 A;  4U3J B;  2PI5 A;  4JI6 B;  1JQ0 A;  1KYO F;  1U97 A;  1GN2 A;  1GM7 A;  4PA3 A;  1P7G A;  2NR5 A;  1P4R A;  1EN4 A;  1NR1 A;  2QJ1 A;  1E1R G;  4B7K A;  1SQF A;  4PA4 A;  3KCY A;  4LBE C;  3H1L H;  4X1K B;  1O9H A;  4GT1 A;  3CCU V;  2NN4 A;  2CGN A;  1SQX H;  1DLB A;  1KP3 A;  1KEC A;  1FXK A;  1NH2 D;  2ZXW B;  3C3S A;  3D8C A;  2XT9 A;  3A0R A;  1FFT B;  4TQF A;  2Q6A A;  1XNQ B;  2CTP A;  3UT5 A;  1S5L Z;  4L87 A;  1NJI W;  4P30 A;  4LH7 A;  5L3B A;  4JPR A;  5ITZ A;  4JYY A;  4LF6 O;  2VQF O;  4LFB B;  2Q0O C;  3CRR A;  1GM8 A;  3SPH A;  3K03 A;  1JCH A;  1QCE A;  1L8D A;  1J95 A;  3SGI A;  2IJH A;  4O4H A;  2LFR A;  1R3I C;  5IJ9 A;  5LMU B;  3FKS G;  1ZX3 A;  3JAT A;  2CTQ A;  3JD0 A;  1FOU A;  2AW9 A;  4JTA B;  4UCO A;  1VQM V;  1YHQ V;  1BQ0 A;  3K0G A;  1XHZ A;  1R6T A;  2ZE8 A;  1FJG O;  1G4Y B;  2WLL A;  1FXV A;  5H9C A;  2BOC C;  3NR7 A;  5F2V O;  2JIZ G;  3CJH B;  2D2C B;  3I55 V;  5IJ0 B;  2GUZ A;  3JAK A;  4ZKI A;  3L71 H;  4F6R B;  1BMF G;  1I0H A;  1DTO A;  1XQ8 A;  3SDL A;  1Q6U A;  4LH6 A;  4X20 A;  3ZRV A;  3CC4 V;  4AI8 A;  1ZWI C;  4DV3 O;  1Q82 W;  1ZUQ A;  4J10 A;  3KCX A;  4XBF A;  2QWQ B;  1N4C A;  4P2Z A;  4DR4 O;  2PGG A;  4LF5 O;  1B6Q A;  2YIC A;  4KFM A;  1MZF A;  3CP1 A;  3L72 H;  2EIL B;  2W0X A;  4ZHQ B;  1EZJ A;  2BTQ A;  4ICG A;  5KHI A;  4MTX A;  4XDL A;  4CS3 A;  3A0H Z;  4WCE V;  3WG7 B;  3CE2 A;  4FLU A;  4FM1 A;  3K9S A;  2EIL C;  3JAW B;  3OEH G;  3GB7 C;  5DN6 G;  4FZ1 A;  3ZMZ A;  4DR7 B;  1WJZ A;  2MW2 B;  2GTA A;  2P67 A;  1FAF A;  2QSA A;  1EM1 A;  4DR6 B;  4R6Z A;  3OR6 C;  3A8T A;  4NXN B;  2R9R B;  4CH6 A;  4JGS A;  3M7M X;  2CE4 A;  2XOK G;  2EIJ C;  2GHY A;  4ZBM A;  4FLV A;  2OTL V;  1DF5 A;  4DK1 A;  4L8J A;  4QNH B;  3L9D A;  3E8B A;  4FM0 A;  1Q8I A;  2UU9 O;  5KAF Z;  3DSQ A;  4TQD A;  1Y74 B;  5EZY A;  3CCR V;  2FB5 A;  3F5T A;  1GN4 A;  2Y4U A;  2QA4 V;  1IVS A;  3OUS A;  2WLN A;  4DR1 B;  4YY3 B;  5J2U B;  3THO A;  3CRA A;  4JI4 O;  5L3F A;  1XEQ A;  4JF3 A;  2UUA O;  1H2G A;  1XOU A;  3N2G B;  4DV1 B;  1Q90 D;  3OD4 A;  2QM7 A;  3AG2 B;  3BAB A;  1BZK A;  2EJ7 A;  3ZS8 C;  4UVB A;  1GN6 A;  2A9H A;  4MTG A;  3ETD A;  1ZAU A;  1E1Q G;  1WPB A;  3FD9 A;  1IXB A;  1LUW A;  5CA0 B;  3K06 A;  1M93 A;  2VWK A;  4UVC A;  2DJV A;  3NXS A;  3IC7 A;  3AG2 C;  4MS2 A;  1VQN V;  5BXZ A;  1SZX A;  4JYA B;  2P4K A;  1FFX A;  1WB7 A;  3CME V;  4LF4 O;  4DV5 B;  1JX9 A;  1Z5V A;  4O4H B;  2GSM B;  1QR9 A;  1LUV A;  5EBW C;  2CK3 G;  4PV1 B;  3SYO A;  5KMG A;  3HKD B;  3QO7 A;  4TUY B;  1IDS A;  4NB5 A;  5LA6 B;  3B77 A;  2L6L A;  2YC0 A;  3LDD A;  4YHH O;  3QO5 A;  1SES A;  5LXT A;  5EIB C;  4CC5 A;  1E79 G;  3JAL B;  5B3S C;  1HW7 A;  3J80 N;  4JI8 O;  4JI1 B;  3HKB B;  5GON A;  2GUZ B;  2LGQ A;  1BT8 A;  4GKK O;  3VQV A;  4TSF G;  2UUB B;  1M4U A;  2ZE5 A;  4AIL C;  2JGU A;  1JPX A;  4I9Q A;  4LFC B;  1YEW A;  2WPD G;  1LNQ A;  1VF6 A;  1K4C C;  1KQS U;  5GTI Z;  3Q4H B;  4RO2 A;  1QR8 A;  2ZQM A;  3TK1 A;  5L3D A;  1GH6 A;  3SYC A;  3K3W A;  4LCU C;  4KL1 A;  2QM8 A;  3CC2 V;  3OMN B;  2IJK A;  2IJJ A;  2N74 A;  3CRM A;  4U7N A;  2KB1 A;  5J2T B;  1N0N A;  3SYQ A;  5H5N A;  1XUQ A;  1Q43 A;  2Q9L A;  1PPJ H;  1XNQ O;  1OJH A;  1RSO B;  3QTC A;  2YUA A;  4LC1 A;  3ZED A;  2ZT9 B;  4MW8 A;  1NH2 B;  3EHB B;  1VQ7 V;  5KUK A;  4LFB O;  1EZV H;  3SJB C;  1BS3 A;  1AP6 A;  1AR5 A;  3AG1 B;  5B1A B;  3CCE V;  4FIP C;  3ZRW B;  1AB3 A;  1N32 O;  4EFE A;  5LMU O;  3ML0 A;  4IIJ B;  4O4I A;  1XNR O;  2F43 G;  2DWE C;  2BE3 A;  4O4L B;  2ZD9 A;  4O2A A;  2W6J G;  4N21 A;  5B1A C;  1BHA A;  4FFK A;  1K4D C;  2LO1 A;  4I4T B;  2CH7 A;  1HNW O;  2Y69 B;  3G67 A;  1P84 F;  2V7Q G;  4TV8 A;  3RVZ A;  4CH3 A;  4KUM A;  3FFQ A;  3EXA A;  5JQG A;  1MNG A;  2HG5 C;  4OX9 O;  3ABK C;  1P49 A;  3MD0 A;  3J81 N;  4KHP O;  2RNB A;  4LNU A;  3DC6 A;  2ZR3 A;  2Y69 C;  4QJF B;  4DV3 B;  3JAS B;  4IHJ A;  2PY5 A;  1G1X B;  1HNZ O;  3W7S A;  5KHG A;  2QKS A;  3VQY A;  3UM7 A;  4U3J A;  4JV5 B;  4LF5 B;  5IWA B;  3AK2 A;  2KSD A;  4D6T H;  2XUM A;  3MHH C;  2XTA A;  1NQT A;  2P4V A;  2IH1 C;  4X1K A;  4TV9 B;  2ARH A;  5KHK A;  1YJN V;  4MVS A;  2LGW A;  3GVM A;  1KU9 A;  2RJZ A;  3ASN B;  3E86 A;  4PEL A;  3T1C A;  5LMN B;  1YF2 A;  1S5J A;  3HPL C;  2EIM C;  3ASN C;  1XMO O;  3OEE G;  2B9Z A;  3CC7 V;  4UFZ A;  1RM1 B;  1Z5W A;  1VQ6 V;  1TA8 A;  4MVR A;  3VOU A;  2P6J A;  4EB6 A;  4NXN O;  3ZHU A;  5E1A C;  1JVM A;  3W7U A;  2UU9 B;  1IUR A;  3HR0 A;  2AZ2 A;  2CTW A;  3TET A;  1RM1 C;  1SQB H;  4MVQ A;  5A2Q N;  1G6U A;  2OT5 A;  4TWK A;  4I55 B;  2HEP A;  5L3G A;  2RDC A;  2G38 A;  2UUA B;  2HR3 A;  2IU0 A;  5LHH A;  2W0F C;  3R66 A;  4UCS A;  4R50 A;  5IJ0 A;  3KDR A;  4J11 A;  2WLH A;  4F6R A;  1S77 D;  2P06 A;  1HDJ A;  4DV1 O;  3H1J H;  2YDE A;  2WLI B;  1H2K A;  4J7Z A;  1AI4 A;  1I94 O;  4GX2 A;  1AJQ A;  2IU3 A;  2QKC A;  1OCO C;  1Y4M A;  5EIB D;  2GDS A;  5E79 Z;  3LUT B;  2QWO B;  4YIO A;  5D5P A;  1JMK C;  3SPJ A;  4D7T A;  1IBL O;  3L75 H;  1GK9 A;  5LOV B;  3M8A A;  4JYA O;  4GX5 A;  5A9G A;  4UXN A;  2HFE C;  4DV5 O;  1YDX A;  2Q7G A;  4ZHQ A;  5JJJ B;  3CCS V;  2VRZ A;  1BQZ A;  5B1B B;  3RYC A;  3K5N A;  4BIU A;  2O57 A;  5H6R A;  2RCV A;  3B8N A;  1M56 B;  4FFB B;  4OXS A;  3JAW A;  4FMT A;  3FB6 C;  4JI8 B;  2CH7 B;  4D7S A;  1PM9 A;  3I56 V;  1GN3 A;  4G2K A;  4XDK A;  2Q0A A;  4OPH A;  3ZHV A;  4Z1M G;  2ZKO A;  1PKX A;  4X8A A;  1RPR A;  3K5O A;  1M56 C;  1OCC B;  4JI1 O;  1VQ9 V;  5GTH Z;  2PI4 A;  1SS3 A;  2N05 A;  3OM3 B;  3OTO B;  3APO A;  4LFC O;  2EUL A;  1NZ6 A;  1OCC C;  4W4L A;  1FXH A;  2YXY A;  2PYJ A;  3RBZ A;  2ITD C;  4Z2W A;  4JI5 O;  4QE7 A;  1Y74 A;  1WPX A;  3H9V A;  2BOB C;  4FLX A;  5DED A;  2HJF C;  1GTO A;  4X9Q A;  3MHS C;  4Z1V A;  2XAH A;  5J2U A;  1AI6 A;  3X2Q B;  3A2F A;  4UVA A;  3N2G A;  1FYJ A;  4RWU A;  2KKW A;  2V1D A;  1X59 A;  5CN0 A;  4IYH A;  2E75 B;  3ABT A;  3C90 A;  4DV2 B;  3X2Q C;  5CA0 A;  2EIN B;  1KKC A;  4LF9 O;  5K1X A;  5FLX N;  1LR1 A;  3G80 A;  1S0V A;  1YJ9 V;  2Q7E A;  1KB9 F;  4PHZ A;  3ZMT A;  4X89 A;  1MSD A;  3WFV A;  2CUG A;  5LGN A;  1YVW A;  1WP7 A;  2EIN C;  1N32 B;  3UKM A;  2HKO A;  3CSX A;  3GWK C;  4EB6 B;  3HKD A;  3RW0 A;  4TUY A;  1XNR B;  3OGC C;  1V55 B;  2EJR A;  1XI1 A;  2WLK A;  3B4S A;  5D5Q A;  4KXR A;  2XND G;  5LA6 A;  1VF7 A;  1BL8 A;  2ZR2 A;  1I5X A;  2RQ6 A;  1HNW B;  4G27 B;  3M99 B;  1OCR B;  4K3A A;  1V55 C;  4JI2 O;  1H38 A;  2Q67 A;  4FVM A;  3JAL A;  1Q6H A;  2JVD A;  4OX9 B;  1K8A W;  1MG1 A;  2ZCE A;  3HKB A;  1D2D A;  3EFF K;  4KHP B;  4K0K O;  5HFM A;  2MK3 A;  1H2M A;  1OCR C;  1YZB A;  1HNZ B;  1AIL A;  4BR6 A;  4PA7 A;  4LFA O;  5CB4 B;  2ZIN A;  2BSK B;  1UJW B;  3BVO A;  3IFX A;  1NVP B;  3F7V C;  2M6Y A;  5LL6 Y;  1N0J A;  1GKF A;  3Q4H A;  4O2B B;  3L74 H;  2GTS A;  3O65 A;  5L3E A;  1QLE C;  1YI2 V;  3G71 V;  4JV5 O;  2WA3 A;  5IWA O;  1KC8 W;  3BA9 A;  1S5H C;  3JAR B;  4J42 A;  5KA5 A;  4PA9 A;  3BRC A;  3HKE B;  1NR7 A;  2FKX A;  5J2T A;  1WLE A;  1OCZ C;  2QDO A;  3RYC B;  4F6E A;  1NKD A;  4EFB A;  1XMO B;  2JK5 C;  2UXD O;  1F4N A;  5LMN O;  4R8C A;  5JH7 A;  3VBB A;  3RT3 C;  1RSO A;  3E8F A;  1CXZ B;  4P9P A;  4Q6G A;  2EIJ B;  2A7W A;  3E22 B;  3RWR D;  1JNB A;  3OAA G;  5JWP A;  2D3O W;  4RUE A;  2Q68 A;  2Y48 A;  5L3C A;  3E89 A;  1W0J G;  3CD6 V;  4MW3 A;  4PI0 A;  3ZRW A;  1YIJ V;  3ABL B;  2JRI A;  5KX5 B;  4IIJ A;  3LSQ A;  1NTM H;  2A79 B;  1MMM A;  3D3I A;  4O4L A;  2YI9 A;  2XAG A;  2E5L O;  3E2E A;  4I4T A;  3ABL C;  4NTW A;  4ZIB A;  3D36 C;  1N8R W;  2YID A;  2P22 C;  3CRC A;  3CCJ V;  4YJ3 B;  1YIT V;  4UCU A;  2ZDI C;  3ZMU A;  3RYF B;  1N34 O;  4TT3 G;  1I94 B;  1WP8 A;  4PD4 F;  3OMA B;  3K59 A;  4MTO A;  2EIK C;  3ZHS A;  4PJ0 Z;  1HR0 B;  4DXW A;  3JAS A;  3CWB H;  1IXM A;  1IBL B;  3ETE A;  1KP2 A;  1K5S A;  3AG3 B;  3CS5 A;  4J7J A;  2Q69 A;  2AHZ A;  1O9G A;  3FYE B;  2Z3Y A;  5B1N A;  1F7Y A;  4DRX B;  1K3E A;  4XDJ A;  4E4E A;  5FPR A;  3AG3 C;  3AK1 A;  5IY5 B;  1FXK C;  4TV9 A;  5IDJ A;  1ORQ C;  3ZRX A;  4B3S B;  2E76 B;  5B3S B;  1SC5 B;  2QM4 A;  4GYC B;  4J41 A;  5JCO A;  1R3K C;  4HAM A;  5IY5 C;  3ABU A;  3ABM B;  4EKW A;  4G28 B;  1KUQ A;  3G6E V;  3S3W A;  4LF8 O;  1NBM G;  2ZE7 A;  4B3M O;  1MAB G;  1VQ8 V;  3CMA V;  3BHP A;  1VIB A;  4WF9 V;  3ABM C;  4DV4 B;  4DUY B;  3U10 A;  3DGE A;  2VWJ A;  3K08 A;  4AHC A;  2KQX A;  4LR3 A;  3H1K H;  1M57 B;  3ZMV A;  3K5L A;  4GZR B;  2N04 A;  4JI5 B;  2DQ0 A;  3SJQ C;  3VQW A;  1VQP V;  3OTO O;  1SQQ H;  1YXB A;  2R70 A;  1WNS A;  1US6 A;  2XAF A;  1ZLZ A;  2QKA A;  1M57 C;  4I55 A;  4A5U B;  1YTF D;  2LQT A;  1ARO P;  4U7O A;  2LP7 A;  4DR3 B;  4I50 B;  2VS0 A;  1WA8 B;  4HZ3 A;  3WU2 Z;  4LWS B;  1GM9 A;  1VQ5 V;  2HVK C;  2WLI A;  4LF9 B;  3P3N A;  1ZL8 B;  5JH7 B;  2PF4 E;  3JCU Z;  4FM2 A;  3B40 A;  4DV2 O;  1CPY A;  3ZHR A;  5LOV A;  5CA3 A;  5KAI Z;  4BW9 A;  3IGA C;  4W4K A;  3IAY A;  2OIG A;  3UO2 A;  5EC1 C;  3BPZ A;  3W7T A;  4RQE A;  3N2K B;  4X62 B;  2OIE A;  2P7T C;  1K33 A;  1HWY A;  4X88 A;  4QIW F;  4RUF A;  4JI2 B;  4X65 O;  2R9A A;  4ZOL B;  4FFB A;  3ABK B;  4JAU A;  1QLN A;  1NVP D;  4K0K B;  3WB2 A;  5CBH A;  2WAM A;  3SPG A;  4UCT A;  2IBZ H;  2X0L A;  1VP7 A;  1DK1 A;  4LFA B;  3K0D A;  3BY6 A;  4X64 O;  1TGO A;  2QE7 G;  4ZI7 B;  4CZZ A;  2UXB O;  3L70 H;  1AR1 B;  3JD4 A;  5KHJ A;  4JI7 B;  3KZI Z;  4UCV A;  3A0B Z;  2UXN A;  1W0K G;  3HKC B;  2ZIO A;  1VQO V;  2Y0P A;  1X4T A;  3E35 A;  5EBM C;  3KG2 A;  1XBL A;  1SQV H;  1IBK O;  4DV7 B;  2ADP A;  2YXH A;  5BMV B;  2ZM6 O;  2RN9 A;  3ICX A;  1PNM A;  2WLJ A;  1IBM B;  1YCI A;  4NTX A;  3CEI A;  2EIM B;  2QGN A;  1VQL V;  1MZE A;  4E2L A;  1BCC H;  4FK5 C;  3BCC H;  2UXD B;  1ZTE A;  4BIO A;  1JFF A;  1OV9 A;  2BCC H;  5KUM A;  1S76 D;  4LP8 A;  4DV0 O;  2F93 B;  2HHH O;  4GKJ B;  3ZBH A;  1RFY A;  2P90 A;  2FL4 A;  2JJ1 G;  2KG7 B;  5EC2 C;  4UB8 Z;  5FNV B;  5BZB A;  5H2F Z;  3T2M A;  5CBF A;  3U11 A;  1XRE A;  1XIL A;  2EX3 A;  4J9Z B;  1R3J C;  4C7U A;  1QVF U;  4JI3 B;  5IT9 N;  4DR5 O;  1PNL A;  1R1B A;  3JSN A;  2E5L B;  4BWA A;  4MVM A;  1H5W A;  4MVU A;  1WN7 A;  2A06 H;  4IT5 A;  4X1Y B;  1G8M A;  3B09 A;  1Y67 A;  4B3T O;  1SQG A;  1SZT A;  4NXM B;  1K92 A;  1TUB B;  1VQK V;  3MAQ A;  1N34 B;  4UV8 A;  4RQF A;  5DM6 V;  2F66 C;  3R65 A;  3JD3 A;  1OCO B;  2VQE B;  4MVO A;  4HBN A;  1I08 A;  4JYC A;  3K04 A;  1H8E G;  1UPG A;  2DMX A;  5K1P A;  1VF6 C;  2B1G A;  3F7Y C;  5CB4 A;  2BSK A;  1N33 B;  2Y4T A;  3G4S V;  1HR0 O;  3AEI A;  3IC9 A;  5HFL A;  3QVN A;  2OWO A;  4O2B A;  3WB0 A;  2YS8 A;  2X6A A;  3JAR A;  1H8H G;  3OTF A;  4JZ2 A;  1ENV A;  5IYB O;  4KP4 A;  3FB5 C;  3HKE A;  4CBC A;  2JDI G;  4H0L B;  4FPP A;  1WAZ A;  2PTM A;  1SA0 B;  4FLW A;  4HYO A;  2L35 A;  3TCU A;  1PNK A;  4QPK A;  1XL4 A;  1TUE B;  2OTJ V;  2IM9 A;  1GO3 F;  1L0N H;  4B3S O;  5C93 A;  1HP8 A;  4LF8 B;  2X6C A;  3UO3 A;  2AGA A;  4B3M B;  2YEV B;  3DTU B;  2JS5 A;  4I0X B;  1K73 W;  1EN6 A;  2DE0 X;  1QQC A;  4WFA V;  4X1I B;  3WB1 A;  3E22 A;  3C3T A;  4H33 A;  1AJN A;  2M7W A;  1BSM A;  2EZP A;  4WBN B;  3OFN G;  4DV4 O;  4DUY O;  4BIZ A;  1OZ0 A;  4NYK A;  1S3J A;  3AG4 C;  3VQX A;  1ROP A;  5KX5 A;  3H01 A;  3D36 A;  3RN4 A;  2QWR B;  3MDS A;  2FYU H;  3QF7 A;  2F23 A;  2ZDI A;  3UCS C;  3CX5 F;  1F4M A;  1NU1 H;  5IYC O;  1MOF A;  4YIP A;  3OT7 A;  1B04 A;  3APQ A;  4PDM A;  3OR7 C;  4P9O A;  3SJA C;  5IE9 A;  4YJ3 A;  3SYA A;  1QNM A;  5C8Y A;  3JAM N;  3ETG A;  5JJE B;  3GWO A;  3RYF A;  5FL7 G;  1CEZ A;  4IGG A;  4DR3 O;  1JFF B;  4QGP A;  1WB8 A;  1PP9 H;  1PV0 A;  3JD1 A;  2YI8 A;  4AQY B;  3RYH B;  5KHH A;  1YTF B;  3FX7 A;  1EN5 A;  2OCC B;  5EYP B;  4IL6 Z;  1I5Y A;  2X7R B;  4QPJ A;  1HNX O;  3T1H B;  2W6I G;  5IYZ B;  1Q3E A;  4DW0 A;  4DRX A;  3B8M A;  4LF7 O;  1JOY A;  2OCC C;  2YIB D;  2Q5Z A;  4NKG B;  4J80 A;  3P30 A;  1U96 A;  1V9P A;  2ZXW C;  5H6Q A;  2IJI A;  2Z0A A;  3KKY A;  1K97 A;  2HJD A;  4X65 B;  4X62 O;  3QNE A;  2DW4 A;  1DGS A;  3TXS A;  1KMI Z;  4GX1 A;  4PA6 A;  3E8G A;  2P5O A;  1NS1 A;  2OYQ A;  2Q7H A;  1NT2 B;  4X64 B;  5IYD O;  4DK0 A;  3QO8 A;  1Y66 A;  2UXB B;  1PL0 A;  4J9Y B;  4DV6 O;  3G6B A;  2XHB A;  2EZO A;  3EVK A;  4UUJ C;  1QLE B;  2PYL A;  2Z5U A;  5LHG A;  1Q81 W;  3CXC U;  1YJW V;  5AG2 A;  1IBK B;  4JI7 O;  5LP6 B;  3ETQ A;  2ZIM A;  3CYO A;  5JVD B;  3H1I H;  2ZM6 B;  2UXX A;  4I5S A;  1OCZ B;  4DV7 O;  4R7C A;  1XMQ B;  5LP6 C;  3TJT A;  3DXR B;  2CTR A;  3ZIA G;  3CCQ V;  2E3C A;  3FAV A;  4DYL A;  2HP8 A;  1MA1 A;  4I50 A;  1VAR A;  5BR8 O;  1F51 A;  4DR2 B;  1T5E A;  1IBM O;  4YJ2 B;  4DV0 B;  4FLT A;  1VQ4 V;  1WA8 A;  2HHH B;  1AJP A;  2QTO A;  2F4V O;  1NI8 A;  4LWS A;  2R72 A;  2QTS A;  3STL C;  2UXC B;  1H2S B;  3U0Z A;  2GV9 A;  1ZL8 A;  1RPO A;  2QWP B;  4GKJ O;  1GMG A;  3AG7 A;  1P7B A;  1SKV A;  3FB7 C;  1F23 A;  3F5W C;  1R6K A;  3ZHQ A;  3TXQ A;  3RYI B;  1J5E B;  2B1I A;  3BFR A;  1SET A;  4DR5 B;  4PDR A;  2QEX V;  3N2K A;  3CCL V;  5J9P C;  1TVK B;  4JI3 O;  3WG7 C;  5LHI A;  1RP3 B;  2HVJ C;  4B3T B;  3UQ8 A;  5LYJ B;  4ZOL A;  2DOS A;  2JGD B;  2YIB A;  1GRJ A;  2EIK B;  1Y76 A;  2UUC O;  2QR4 A;  5DEC A;  5C8Y B;  4GCZ A;  4NXM O;  3FB8 C;  4ABM A;  4ZI7 A;  5B1O A;  3H1H H;  1H2N A;  2Y0I A;  3RVY A;  2VQE O;  2JEU A;  2WA4 A;  1Y6X A;  5CMU A;  1CP9 A;  1AP5 A;  4K8X A;  3TGU H;  3HKC A;  2ITC C;  4N23 A;  3T1Y B;  4DUZ B;  2K1E A;  5GW7 A;  4JI0 B;  1FD9 A;  1FXK B;  3SJC C;  1N33 O;  2CAZ C;  1K7D A;  4GX0 A;  5B5E Z;  1N36 O;  4B7E A;  4I9W A;  5BMV A;  3UT5 B;  2LFS A;  1OHH G;  1VMG A;  3SPC A;  1QHT A;  5ITZ B;  1Q6I A;  1AR4 A;  3PN1 A;  4HNA A;  3S3X A;  4OPA A;  4B3R B;  2X6B A;  1NTK H;  2H8P C;  3P3P A;  3K9A A;  4UCR A;  5LGU A;  3ASO B;  5KLV H;  1COW G;  1BHB A;  4WFG A;  1R73 A;  5IJ9 B;  3ZHT A;  1MSW D;  3K58 A;  1QBZ A;  2DWD C;  1JR9 A;  2KG7 A;  5FNV A;  3JAT B;  4QE9 A;  3ZJZ A;  5LBQ A;  4H37 A;  3LSS A;  3ASO C;  4WFF A;  4X66 O;  1R3L C;  3HB3 B;  5CA1 A;  2QWN B;  2WLL B;  3PJS K;  3CCV V;  1VF5 B;  4FLZ A;  4ASU G;  3P32 A;  4WFB V;  2ILM A;  1AI5 A;  1B06 A;  1IZ3 A;  3JAK B;  4IYI A;  3E8H A;  2JS3 A;  2XAS A;  2ZE6 A;  3LNN A;  4YXW G;  4X1Y A;  1V54 B;  4X20 B;  1TUB A;  3FAV B;  4H44 B;  1GAX A;  3LDE A;  3E83 A;  5EK0 A;  1V54 C;  4TOI A;  1IJG A;  4FJC C;  1AI7 A;  4JI6 O;  4CS2 A;  1THZ A;  2XAJ A;  2B5U A;  5EBL C;  1HNX B;  2EBO A;  3CPW U;  3W7W A;  4AQY O;  2BTQ B;  3B2E E;  5KA6 A;  4LF7 B;  3JD2 A;  4O4J A;  2PZS A;  3I5D A;  4PDV A;  3T1H O;  3STZ C;  3LDC A;  2Q4P A;  4CC6 A;  4LF6 B;  2VQF B;  1D5N A;  1SF9 A;  4WFE A;  1UFI A;  2DYS B;  4U3F H;  3JSL A;  3QG5 A;  1R6N A;  2NNU A;  2PUS A;  1SA0 A;  3ZMS A;  2IH3 C;  1K9M W;  1EBO A;  4I7Z B;  2DYS C;  2JJ2 G;  1KBH A;  1H2L A;  2YEV A;  3LNM B;  4I0X A;  1A32 A;  1Y76 B;  3K79 A;  1XL6 A;  1PL4 A;  3K5M A;  2FML A;  4DV6 B;  4X1I A;  2ETN A;  4J7K A;  4H13 B;  1FJG B;  4MSW C;  5BY1 A;  2ZNJ A;  3SR2 C;  5EZY B;  3OE7 G;  2NLJ C;  3AG1 C;  2Q8V A;  4WBN A;  2JEX A;  5CBG A;  3SYP A;  4RAI A;  3T4D A;  2LW1 A;  2YSU B;  2FTK A;  3JYC A;  2AZ0 A;  1M90 W;  3OW2 U;  3L73 H;  2ODM A;  4MTF A;  1KD1 W;  4B08 A;  1VEW A;  1Q7Y W;  1QVG U;  1BE3 H;  4EEQ A;  4PDL A;  5BR8 B;  2C2A A;  1XHX A;  2WLM A;  4HNA B;  4BW5 A;  4CS4 A;  1XMQ O;  2F4V B;  2F1M A;  2ADQ B;  4DR4 B;  1AVM A;  3JCZ A;  1FFX B;  4JTD B;  1NTZ H;  1JJO A;  4DR2 O;  1D5A A;  1BGY H;  3T4Z A;  1W2B U;  3RYH A;  4UB6 Z;  3ZN1 A;  2WSS G;  3CHX A;  5KMG B;  1S72 V;  2UXC O;  1M9N A;  2Q73 A;  5EYP A;  2GBO A;  5JJN B;  4NTY A;  4JZG A;  3BAA A;  1FKA O;  5IYZ A;  1IX9 A;  1Q86 W;  3SPI A;  1M5I A;  1PD3 A;  2YIA A;  2IW5 A;  4JAV A;  4OGQ B;  5CA1 B;  4JAS A;  3DC5 A;  3CRQ A;  5B66 Z;  5LXT B;  1J5E O;  4WFH A;  4NVP A;  5GON B;  5JCO C;  4DR7 O;  2A0L A;  4Q20 A;  3AK3 A;  1W59 A;  4DR6 O;  2R9I A;  1JA8 A;  3CB2 A;  2UUC B;  2ZNI A;  5FPO A;  3ZN0 A;  3IJ4 A;  2HLD G;  3ZRS A;  4UV9 A;  4BAY A;  2YXL A;  1TAE A;  1URF A;  4DW1 A;  2H3O A;  1M1K W;  5TIS Z;  1XDC A;  3OMI B;  2F95 B;  1B3Q A;  1SQP H;  2K9P A;  3CXH F;  2WWW A;  4JI4 B;  4CH4 A;  1N36 B;  3CJH A;  5LP6 A;  1L0L H;  4K8Z A;  4JYB A;  4K35 A;  1L1F A;  4DR1 O;  4O4J B;  5JVD A;  4YY3 O;  3T1Y O;  1Q5O A;  2LJ2 A;  4DUZ O;  4JI0 O;  2DQ3 A;  4GLX A;  1QU7 A;  1Z2G A;  2DYR B;  1K34 A;  3K57 A;  2ATK C;  3D3Q A;  4MT8 A;  3J7A U;  2RMK B;  1SRY A;  3DXR A;  4GUN A;  3ZX6 A;  1I7F A;  3ZCC A;  4LF4 B;  1FPO A;  2DYR C;  4NR1 A;  3BEH A;  4YJ2 A;  3OGI B;  4B3R O;  1ZSP A;  4PI2 A;  1JJ2 U;  2BTO A;  3RFR A;  2LW7 A;  2V4D A;  4X66 B;  4O4I B;  3AG4 B;  4YHH B;  3CCM V;  3OUF A;  4O2A B;  4JAA A;  1KKD A;  3RYI A;  1FS0 G;  1SER A;  4FZ0 A;  3W7X A;  1DF4 A;  1EFR G;  2XAQ A; 
#chains in the Genus database with same CATH homology
 1QNM A;  1MA1 A;  1MSD A;  2CDY A;  1VAR A;  5A9G A;  1I08 A;  1WB8 A;  3AK3 A;  1N0N A;  1JA8 A;  1EN5 A;  1I0H A;  3IC9 A;  1GN6 A;  1XUQ A;  1MMM A;  1PL4 A;  1JR9 A;  3QVN A;  2RCV A;  1IXB A;  3LSU A;  2ADP A;  1LUW A;  1ZLZ A;  2QKA A;  1PM9 A;  1GN3 A;  1ZUQ A;  1XDC A;  1SZX A;  3BFR A;  1GN2 A;  2P4K A;  1P7G A;  4JZ2 A;  1WB7 A;  1EN4 A;  3CEI A;  3KKY A;  1BS3 A;  1AP6 A;  1LUV A;  1AR5 A;  4BR6 A;  1ZTE A;  1B06 A;  1IDS A;  3C3S A;  1VEW A;  1N0J A;  1EN6 A;  3K9S A;  4FFK A;  4GUN A;  3C3T A;  4JYY A;  4E4E A;  1XRE A;  2ADQ B;  1XIL A;  4X9Q A;  1BSM A;  1AVM A;  3EVK A;  3AK1 A;  1EM1 A;  4C7U A;  1BT8 A;  1ZSP A;  1AP5 A;  3KDR A;  1MNG A;  5AG2 A;  3DC6 A;  4F6E A;  3RN4 A;  2CE4 A;  3MDS A;  4JZG A;  2QKC A;  1Y67 A;  1IX9 A;  4YIP A;  2AW9 A;  3OT7 A;  2GDS A;  1KKC A;  4YIO A;  1D5N A;  3AK2 A;  3TJT A;  3DC5 A;  1GN4 A;  1AR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...