4BR6A

Crystal structure of chaetomium thermophilum mnsod
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Crystal Structure and Biochemical Characterization of a Manganese Superoxide Dismutase from Chaetomium Thermophilum.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 72
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4br6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4br6A02
1XDCA 3CEIA 1IXBA 3AK2A 1VEWA 4F6EA 1IX9A 1LUVA 1B06A 1LUWA 2ADPA 1AP5A 1I08A 2AW9A 3OT7A 3DC5A 3EVKA 1AP6A 1XREA 2GDSA 4FFKA 1I0HA 1WB7A 1EN4A 3MDSA 2QKCA 1ZUQA 1GN2A 1QNMA 3LSUA 1AVMA 3KKYA 1PL4A 1EN6A 1N0NA 1XILA 1N0JA 1PM9A 1GN6A 1GN4A 4X9QA 1ZSPA 1AR4A 1Y67A 4YIOA 4JYYA 2QKAA 4JZGA 4E4EA 5A9GA 1JR9A 3RN4A 1XUQA 3IC9A 1BT8A 3K9SA 2ADQB 1BSMA 1D5NA 2CE4A 2CDYA 1WB8A 3AK3A 4YIPA 3C3TA 1ZLZA 1MA1A 1P7GA 1MMMA 1ZTEA 1AR5A 1JA8A 3AK1A 1GN3A 3BFRA 1VARA 4JZ2A 3TJTA 4GUNA 5AG2A 1IDSA 2P4KA 3C3SA 1KKCA 2RCVA 1MNGA 1MSDA 1EM1A 1BS3A 4C7UA 1EN5A 4BR6A 3DC6A 3QVNA 1SZXA
chains in the Genus database with same CATH superfamily
1WNSA 4Z1MG 4JI6B 4IL6Z 3ML0A 1N34B 4PA9A 4JI2B 4J7KA 3HR0A 2GSMB 3IJ4A 2HVKC 1P84F 3N2KB 1V9PA 3LDDA 2PF4E 1K97A 4RUFA 2OIGA 1J5EB 3T4ZA 5IYZB 3ABKC 2EULA 2P6JA 1B3QA 3K3WA 1BL8A 1KBHA 4FFKA 3K58A 2D2CB 2Y0PA 5LXTA 2P7TC 4Q20A 2F43G 3G67A 1GKFA 2K1EA 1KYOF 1JVMA 1MZEA 1IXMA 3LUTB 3L70H 1PM9A 1IURA 4A5UB 5LXTB 2PI5A 1Y67A 1M57C 1QVFU 3ZRWB 4O2AA 2IJHA 2LW1A 4DR7O 3IC9A 3OGCC 3OTFA 3ZRSA 4KHPB 3AG3C 3W7TA 4IT5A 3K0GA 5KLVH 1CEZA 3JD2A 1VQ8V 4PJ0Z 2GUZB 4NTYA 4JTCB 1YJNV 4EKWA 2IH1C 1NH2B 2WWWA 3OE7G 4DO2A 2UU9O 5HFLA 4I4TA 5DEDA 4X1YA 2P4KA 2BSKA 4X1IB 1MSDA 4UCVA 1YZBA 4HYOA 2B5UA 1Q6UA 3W7WA 3E86A 1NZ6A 1H2SB 2UXDB 1QBZA 3JD1A 1I5YA 3HPLC 4FLTA 4NR1A 2Y48A 2OT5A 3FD9A 5CBFA 4LFBO 2UXNA 2MW2B 3FB8C 2YICA 2YDEA 1S3JA 1R3IC 4JI7B 3HKCA 4UVAA 5LP6A 5IJ9A 1JMKC 3HKEA 2KG7A 3DGEA 4W4LA 5LP6C 1JCHA 1NH2D 3HKCB 2IU0A 2W6IG 1NTZH 1Q6HA 4O4LB 1XHZA 5BR8B 2KG7B 4TWKA 4D7SA 3APOA 1XL6A 4X1KB 2Q73A 3D3QA 1K4CC 1K3EA 1N0NA 4DW1A 4FIPC 5IWAB 1G8MA 4B3SO 2KQXA 4YHHO 3OFNG 4E4EA 4IYIA 1SQQH 3P3NA 4FZ0A 2GBOA 4MTGA 1D5NA 4QPKA 2WA4A 4UUJC 3E8FA 1KECA 1TAEA 1GK9A 2UUCO 4ICGA 2YIAA 3U0ZA 4WFFA 4DR2B 4LWSB 4R50A 5EBLC 5IYCO 5LMNO 5B1AB 1ENVA 3ZMTA 2BTQB 3J80N 1Y66A 2V4DA 4K3AA 3CPWU 3JCZA 3ASOB 1NJIW 3HB3B 4JI0B 1EM1A 2F4VB 2FKXA 3CX5F 4YJ2B 5JH7B 2ARHA 2QGNA 1W2BU 3SYPA 2N05A 2EILC 1FXKA 1R3LC 4QPJA 5L3BA 5FPOA 4CBCA 5JQGB 3SYAA 2CH7A 1H38A 3RYIB 3AG4C 1TVKA 1OHHG 3ZS8C 1BHBA 3T1HO 4MS2A 1FXKB 4TSFG 5EYPA 3RGBA 4B3RO 2CH7B 3K08A 1TVKB 2W0FC 4NVPA 2EZOA 2Z3YA 4O4JB 2ZIMA 2IJIA 5EYPB 3MAQA 1OCCC 2FTKA 5LGTA 4RQFA 1ROPA 3ABTA 4DRXB 1TUEB 2OCCC 4RWUA 1M9NA 4LC1A 1GMGA 3MD0A 4K8XA 2EINB 3LSUA 3HKBB 4BIOA 4K0KO 2JGDB 1SC5B 1IBKO 2EIJC 2V1DA 4NXMB 5JCOA 2IU3A 1A32A 1JQ0A 4B3MO 1HNWB 4DUZO 2E3CA 1GM9A 1NR7A 1R1BA 4DV7B 1JFFB 4KL1A 1Q7YW 4XBFA 1KUQA 2ZR2A 2N74A 2M7WA 4DR5B 3AK3A 5LBQA 1RPOA 2BE3A 3CYOA 5KAFZ 4X88A 5IYDO 2QEXV 3ABMC 4GX1A 4GKKO 1URFA 2DQ3A 5JVDA 4DV5B 4DR1O 4LF5B 3TJTA 2QWNB 1SKVA 5KHJA 1YTFB 2ILMA 4FLWA 4MVZA 3SR2C 3UT5B 1X59A 4J9YB 4U3JA 5K1PA 4X64O 3KCXA 3Q4HA 4FJCC 2HG5C 3AG2B 4J41A 1WA8A 2AXTZ 1PNMA 5CA0A 4B7EA 3CC2V 1BQZA 1XDCA 2IW5A 1W0JG 2YS8A 4ZHQA 1FFXA 4PD4F 1ZL8A 1VEWA 4WBNB 4I0XA 4KP4A 3VQVA 2CTRA 1B06A 1AP5A 2LJ2A 5LGUA 1SZTA 3OT7A 5CB4A 3VQYA 1SQFA 3D3IA 3QO8A 5B3SB 3RBZA 3BY6A 4FMTA 1YTFD 2ZE5A 4X65B 1L0LH 3MDSA 1GN2A 3G6EV 2B1GA 5FL7G 1PL4A 1K73W 2VQFB 4X20A 2QE7G 1XMOO 1GAXA 4QE7A 2X6AA 1YCIA 4O4IA 4JZGA 2G38A 5A9GA 1V55C 1F4NA 1G6UA 1RP3B 4EB6A 3ZMZA 4LNUA 3D36C 2DJVA 4O4IB 1NU1H 4KUMA 3ZX6A 2CDYA 3BPZA 4LF9O 3F5TA 3SPIA 2UUBO 5KX5A 4G28B 1P7GA 4JI4B 1ZTEA 3X2QB 4DV6O 2A9HA 3OMAB 3FB7C 1VIBA 4WF9V 4GUNA 5CA1B 4DR6B 2OYQA 4PDLA 1V54B 3RFRA 3RYCA 1N36B 2JS5A 4LR3A 2JEXA 1SS3A 5BXZA 3JAMN 3WG7B 2WLIA 3ETEA 5JJEB 2YIBA 4TV9A 3ZJZA 4MTFA 2FMLA 4H37A 4MW8A 4HNAB 3ZN0A 1Y76A 3ZCCA 4OXSA 3OUFA 5KHKA 3ICXA 1S72V 1M1KW 4BWAA 4YY3O 3EXAA 4AI8A 1ZX3A 1NVPB 4DV4B 4UCTA 3ZRXA 3JSNA 1QR9A 1L8DA 4MT8A 1JX9A 1KKDA 5J9PC 3K59A 2QM4A 2Y69B 3F7YC 1YVWA 4FLZA 4JI3B 3UQ8A 2L6LA 5FPRA 4GKJO 2HFEC 5EC1C 3JAKA 5IE9A 1FD9A 1MSWD 1XNRB 1YJ9V 5L3DA 4FLXA 1R73A 2A0LA 2CUGA 4FM2A 1SESA 4LH6A 1Q86W 4JV5O 4X89A 1JR9A 2LFRA 4CS3A 4DV3O 1S5JA 1BGYH 4N23A 4DV0O 1H2GA 2UXBO 2ZKOA 1RPRA 3GWOA 2BOCC 2Z0AA 3CD6V 4GCZA 3LDEA 1XQ8A 3QG5A 2YIBD 1T5EA 1WB8A 3CS5A 2ZIOA 5EZYA 1NBMG 1FAFA 1GN3A 3BFRA 5GONB 1FS0G 1FOUA 2UUAB 4G27B 5EZYB 2ZDIC 2LFSA 1IBLB 2ZM6O 1Q43A 4JI5O 2QWRB 1QU7A 3L75H 4MTOA 2WLJA 3ETQA 3JSLA 1DGSA 4X62B 3RT3C 2OTJV 3N2GB 4IGGA 4U7NA 3ABLB 4DUYB 1PL0A 3W7XA 2WLMA 3IFXA 2XAFA 4JI1B 1MABG 1UPGA 1SQBH 3JARA 4PDMA 3CC4V 1CXZB 2ITDC 1GM8A 3E89A 4YJ3A 4GX2A 5CN0A 3O65A 5IY5B 1Q8IA 1AJNA 1KMIZ 2RMKB 2ITCC 3EVKA 3ZMUA 1AP6A 1GTOA 1K92A 2VQEO 5FLXN 1L0NH 2A06H 2HJFC 1HNXB 5L3FA 1OCOC 1GM7A 3H01A 1VQ6V 1WPBA 3CCQV 2PGGA 3KKYA 2JJ1G 4DK0A 4K35A 4XDJA 4DV1O 3GWKC 3SYCA 4Z2WA 3JD0A 2A3QA 4FLVA 2V7QG 3UCSC 1DTOA 3ABKB 5F2VO 5BY1A 3FAVA 1G1XB 5J2UA 4MVRA 1IZ3A 2AHZA 1MOFA 1BHAA 4TOIA 3L72H 5B1NA 3NXSA 1JNBA 2GV9A 4JAUA 1ZLZA 1NS1A 4OX9O 1F23A 1MMMA 1HR0B 3VQXA 4I50A 3I56V 2WLHA 2ZNIA 1OZ0A 1OV9A 2ZQMA 1M56B 3GVMA 1O9GA 3H1JH 2EIKC 2IM9A 1RM1C 4I50B 3AG3B 4O2AB 4JYAB 2QWQB 1NQTA 3IC7A 1K5SA 2YC0A 1Y6XA 3K5MA 2QR4A 4BR6A 4JI8B 2QTOA 1F7YA 3T2MA 2DOSA 1W0KG 2DYRC 3K79A 1I7FA 3OUSA 2BTOA 4FK5C 1XOUA 3IGAC 2RQ6A 3SPGA 4AQYO 1VQLV 3FYIB 1FPOA 3JD4A 2HJDA 2E5LB 3L9DA 4AHCA 3D8CA 5A2QN 3F7VC 2ADPA 4I4TB 4X1YB 2E76B 1VQKV 3DC5A 2JRIA 4JYBA 1HP8A 4LFCB 3ZHRA 2BSKB 2OWOA 4CH6A 1R6NA 1Q5OA 4LF8B 4LP8A 3OTOO 1N32B 3SYQA 4QIWF 5H9CA 3QO7A 1AI5A 2QKSA 3K0DA 4OPHA 5KA6A 1IVSA 1GN4A 1K4DC 4UV8A 4J7JA 2H3OA 2E74B 4TQFA 3LNMB 2QKAA 4EEQA 1E79G 2GTSA 4KFMA 2DMXA 1IBMO 1XBLA 5LP6B 2NNUA 5IJ9B 1Z5VA 3HKEB 4PA3A 1KD1W 4G2KA 3I55V 1FJGO 2CE4A 5CMUA 4WFBV 3B2EE 2HHHO 3H1LH 1MA1A 3I5DA 1KB9F 3OR6C 4DK1A 4FPPA 4CC6A 4JZ2A 3T1YO 4LF7O 3CSXA 5AG2A 2AGAA 1CPYA 2A7WA 3LSSA 1XNQO 2MK3A 2EJRA 4N21A 4ZOLA 3W7UA 4DR4O 1I94B 2ZR3A 2JS3A 1Z5WA 2XAJA 4R6ZA 3BRCA 1VMGA 1XMQO 1HWYA 1PP9H 2R9AA 1WP7A 3BA8A 5JJJB 3CCLV 3QO5A 4JI5B 4D6TH 4E2LA 1VF6A 2R9RB 1M93A 3G80A 3H9VA 1VF6C 1NT2B 4QJFB 4NXNB 5B1OA 4X66B 3ZEDA 3ASOC 2W6JG 5D5PA 3ZHUA 3B8MA 1QLEC 4LFAB 3L71H 2VS0A 5LMUO 4UFZA 2ZNJA 1S76D 1ZWIC 4B3TO 3AG4B 1THZA 1D2DA 1QLNA 3F5WC 3H1HH 4P30A 4UV9A 2B1IA 2EJ7A 3NR7A 3VBBA 2E75B 4MW3A 1PNKA 2JGUA 2ZE7A 5E1AC 1Q90D 3U11A 1OCCB 2M6YA 4J10A 5TISZ 1R6KA 3RW0A 1ORQC 2OCCB 1YEWA 4YIPA 2XAGA 3ZHTA 1YSCA 3CB2A 3PN1A 3JALA 4X8AA 4DV2O 1F4MA 2EIJB 1GH6A 4FM0A 1HNZO 2FB5A 1OCRB 2CGOA 2EINC 2KKWA 4B08A 5LYJA 3G4SV 2QJ1A 2F66C 2HVJC 2Q0AA 3OAAG 3A0RA 5EBMC 2Q69A 3UO3A 2KB1A 3STZC 4FLYA 2Y4UA 2CTQA 5LYJB 3CCRV 1EN5A 1JPXA 4PA7A 2CGNA 4DR7B 3ABMB 3CEIA 1YF2A 1H8EG 2VWJA 2EIMC 2VRZA 1N33O 4GZRB 1VQOV 4I55A 5JVDB 3N27A 2W0XA 2XAHA 1K9MW 4DW0A 1BMFG 2WLNA 1XHXA 5LHHA 4QE9A 3QTCA 2UU9B 4U3JB 5J2TA 2OIEA 4W4KA 3Q4HB 5GTIZ 3WB1A 4XDLA 4DR3O 1YIJV 5IJ0A 1WA8B 5LHGA 5EIBC 5CA0B 4LF4O 2DN9A 3CMAV 3OEEG 1GN6A 4ZHQB 1FFXB 1ZL8B 1AR4A 3FX7A 4I0XB 1S5LZ 3TXQA 4HBNA 3CCEV 2B9ZA 3CCMV 4L8JA 4LFBB 1WPXA 1BT8A 4PA6A 4JI2O 2X7RB 1FYJA 2WLLA 2ZE6A 5CB4B 3DXRA 3RYHA 1XL4A 3K9AA 1KP2A 3R65A 2XASA 1IJGA 3CMEV 5B3SC 5CBHA 1Q6IA 2L35A 2ZT9B 1J5EO 1AR5A 1D5AA 1JA8A 1Q82W 5CBGA 3RYHB 1AILA 3D36A 4X20B 2JJ2G 5FNVA 4O2BA 3L74H 1O9HA 4LH7A 4EB6B 4UCOA 3ETGA 5KHGA 1BS3A 4B3SB 4FM1A 4YHHB 3A2FA 5BZBA 4LNUB 1LNQA 2IJKA 4LF7B 2H94A 3ZN1A 4KXRA 3LNNA 1IXBA 2Z5UA 3AK2A 2BOBC 2ZE8A 3CHXA 2JEUA 2P4VA 4JF3A 5KHIA 5KX5B 4KHPO 3HKDA 2UUCB 5GTHZ 2X6BA 1LUWA 4ZBMA 3E35A 4ZI7A 2YEVA 2AZ2A 1P49A 2AW9A 4CC5A 2PZSA 5LMNB 1YITV 2XAQA 3RYCB 3H1KH 4NTXA 1V54C 2GDSA 4ZI7B 1I0HA 4OGQB 3E83A 3E22A 3QF7A 4O4HA 4WFAV 5HFMA 1VP7A 2QKCA 4EFBA 1NTMH 1FXVA 1LR1A 4LF6O 3WB2A 2WLIB 4TV9B 4YXWG 3B09A 2QSAA 4UCRA 4O4HB 1Y76B 3M8AA 3U10A 3FB6C 4D7TA 5EBWC 3CRCA 3FYEB 5LHIA 2UXDO 3RN4A 1HW7A 1XUQA 3AG1C 5KMGA 2LP7A 3T1CA 4WFHA 2DYSC 2ZD9A 3ASNB 3SJAC 1BSMA 3T1HB 1RSOA 1K7DA 3ZRVA 3M7MX 3STLC 2R70A 4B3RB 3CWBH 4JI7O 3ZIAG 2WSSG 3C3TA 1VF7A 3A8TA 5L3EA 1NKDA 5KUMA 2DW4A 3UM7A 5B66Z 3JYCA 3J81N 3AK1A 5K1XA 2DWEC 5ITZA 4PI0A 4TUYA 2RJZA 3JAKB 4H13B 2HR3A 1IDSA 5LL6Y 5BR8O 1VF5B 1FFTB 4JAVA 4K0KB 3ZHQA 3B40A 1AR1B 1IBKB 2Y4TA 4JPRA 1S0VA 4J7ZA 4B3MB 1JJOA 4DUZB 1BE3H 4CZZA 5IWAO 2Y0IA 1KP3A 2ZDIA 1OCZB 1KC8W 2F1MA 3K06A 3RYFA 2XOKG 3OR7C 4CH3A 2R9IA 5KUKA 3GB7C 3P32A 3K03A 2Q6AA 4GKKB 1GO3F 2WAMA 2ZXWB 4ABMA 4DR1B 1XI1A 1YHQV 5BMVA 1SRYA 5GW7A 1XREA 1QR8A 4RAIA 3FFQA 3OMIB 2F93B 3TGUH 3JASA 2D3OW 5B1BB 4X64B 5LGNA 1EN6A 1MZFA 1PV0A 4JI0O 4FFBA 3RVZA 2F4VO 1E1RG 2P90A 3JASB 3ABLC 2PYLA 2K9PA 2HLDG 3UKMA 1EZVH 3JARB 1QHTA 4UB6Z 1H5WA 4IIJA 2PY5A 3CCUV 4YJ3B 4FFBB 2QM7A 4MSWC 1TUBA 2ADQB 5IT9N 1SA0A 4AILC 4Z1VA 2NR5A 1UJWB 3B8NA 1SERA 1US6A 1PNLA 1G4YB 3N2KA 4PDRA 4UCUA 2PUSA 3A0HZ 5L3CA 3DSQA 1RFYA 5IYZA 4WFGA 2WLKA 1WLEA 4MVQA 1XMOB 3ZBHA 2WPDG 1OJHA 3CXHF 3FAVB 5J2UB 4IHJA 1SZXA 4U3FH 4JYCA 4NXMO 4GX5A 1NTKH 1H2LA 2YI8A 1HNWO 1EBOA 1GRJA 2IH3C 2P5OA 1M57B 4DV7O 2JIZG 4IHJB 3ZRWA 2F95B 4LF9B 2QTSA 4ZIBA 2UUBB 3FB5C 3JAWA 4JAAA 4DR5O 3SYOA 3SPCA 2EIKB 1RM1B 4DV6B 3SPHA 2UXCO 2BCCH 3K5LA 4R7CA 2R72A 1M56C 3TXSA 2OCHA 4F6RA 4CH5A 4DV5O 1HDJA 3JAWB 2GUZA 2CTPA 4BW5A 4LF5O 2CAZC 4I9QA 2DYRB 3SGIA 3E8HA 1QNMA 2YSUB 4JGSA 2YXLA 4F6RB 1AI6A 3CRRA 1XILA 2VWKA 2ETNA 3CC7V 1S77D 4XDKA 2ZINA 1TGOA 4X1IA 4OPAA 4NYKA 4LF6B 1AJPA 1FKAO 1AJQA 4CS2A 3VQWA 3OD4A 4YY3B 4MVMA 5KA5A 4PV1B 2Q8VA 1E1QG 3JD3A 2X6CA 3EFFK 4ZKIA 2RNBA 3CCSV 3SJCC 1MG1A 4X65O 4MVSA 4P9OA 4J11A 4GKJB 3EHBB 1R6TA 4P2ZA 4BW9A 1DF5A 4UB8Z 3CCVV 4O4LA 2VQFO 2YXYA 4C7UA 4X1KA 1VQNV 3KDRA 3ZHSA 4JV5B 2HKOA 4RO2A 4DV3B 3T4DA 4DV0B 1KQSU 2UXBB 3S3XA 4PDVA 4DXWA 2P67A 1B04A 1R3JC 3UO2A 3W7SA 1I08A 1K8AW 2LW7A 4CS4A 1SQXH 1R3KC 4ASUG 3BVOA 1W59A 1YXBA 1NI8A 4JI4O 4ZOLB 2Q5ZA 2QDOA 3R66A 1VQ5V 4PA4A 2AHYA 1WB7A 3M99B 4LWSA 1EN4A 4UVBA 5EC2C 2ZM6B 1YI2V 4GYCB 1ZUQA 4DR6O 1F51A 4L87A 1N36O 2RN9A 1N0JA 2BTQA 5LA6A 4JTAB 5B1AC 1Y4MA 4JYYA 3IAYA 3B4SA 5JH7A 4YJ2A 2DQ0A 2Q7EA 3TK1A 3CRQA 5LA6B 4CH4A 3OMNB 4RUEA 2EILB 5B5EZ 1AI4A 3BHPA 1WAZA 2P06A 1QLEB 1ZAUA 2LQTA 1BCCH 1M5IA 3OM3B 5JQGA 1COWG 3RYIA 4Q6GA 3ETDA 4RQEA 3P3PA 2Q9LA 2VQEB 2QA4V 5DM6V 3ZHVA 4DV4O 1SF9A 3JATA 3TETA 4GLXA 1FXKC 4WFEA 3BA9A 4O4JA 2A79B 5KHHA 4JI3O 3JATB 1N8RW 4DV1B 1P7BA 4DRXA 4LBEC 3BABA 2AZ0A 1VQ7V 1DF4A 1XNRO 3HKBA 2YXHA 4FLUA 2JGDA 2QWOB 1UFIA 1SETA 3S3WA 4HZ3A 5KAIZ 4F6EA 3KG2A 2Q0OC 1YDXA 3JALB 4IYHA 3TCUA 1IX9A 1TA8A 1H2NA 4OX9B 1JFFA 2JK5C 1J95A 3K5OA 1PD3A 1OCRC 3BCCH 1L1FA 3ABUA 5JCOC 4TT3G 5JWPA 2JVDA 4MVOA 4BIZA 2UUAO 1DLBA 3CJHA 2YIDA 1YJWV 3MHHC 1IBLO 1AVMA 3CCJV 5D5QA 2X0LA 4WCEV 2PI4A 2LGWA 2EIMB 1I5XA 2KSDA 2UXCB 2QM8A 4NKGB 3CE2A 3K57A 3UT5A 1Q3EA 4TQDA 3KCYA 5L3GA 4YIOA 3CJHB 3K5NA 2PTMA 1S5HC 2GTAA 4X62O 1H2MA 5H6QA 4AQYB 2N04A 4I55B 3RWRD 4DUYO 3H1IH 3AG2C 2HEPA 4TV8A 1X4TA 4JI1O 2XHBA 2GHYA 2P22C 2OTLV 4PHZA 5DECA 4WBNA 5J2TB 1AI7A 3AG7A 2ZCEA 3L73H 5IJ0B 1P4RA 4TV8B 4HAMA 1M90W 4MTXA 1VARA 4JI6O 2LGQA 3QNEA 1N34O 1BQ0A 3WB0A 3B77A 3OTOB 4H44B 5E79Z 1HNXO 5DN6G 1AROP 2RDCA 5C8YA 2DWDC 2RCVA 1SQVH 2Q7HA 3SJBC 2PYJA 1NR1A 1EFRG 3LSQA 1U96A 2Q4PA 2WLLB 4J42A 4J80A 5C8YB 1IBMB 4QNHB 3DXRB 4P9PA 1VQ4V 1FJGB 4FVMA 1V55B 3A0BZ 5IDJA 1VQPV 1VQ9V 2HHHB 5EIBD 4H33A 2Q68A 3BAAA 1SQPH 3P30A 5FNVB 3T1YB 1HR0O 1QCEA 4O2BB 3APQA 1K34A 4EFEA 1XNQB 2CK3G 3G71V 2F23A 4DR4B 4U7OA 2IBZH 3PJSK 3X2QC 1XMQB 2NN4A 4I7ZB 1FXHA 1ZSPA 2DE0X 3OGIB 4X9QA 3RVYA 5CA1A 4JYAO 3OEHG 1XEQA 4PELA 3JCUZ 4JI8O 2EX3A 3HKDB 1Q81W 4DYLA 2EBOA 1Y74A 2FL4A 1CP9A 2YEVB 3KZIZ 4J9ZB 3THOA 2IJJA 2E5LO 4LCUC 3J7AU 4HNAA 3WG7C 1Y74B 3E8BA 5CA3A 1DK1A 4MVUA 3E22B 3SDLA 3G6BA 1JJ2U 4LFCO 1B6QA 3C90A 2O57A 5LMUB 2UXXA 3AG1B 4LF8O 5JJNB 3WU2Z 4B3TB 2DYSB 1N32O 3WFVA 3E2EA 4NTWA 1N4CA 4UCSA 5KMGB 5C93A 1KU9A 3DC6A 3CP1A 1PPJH 1H8HG 4FZ1A 1RSOB 2NLJC 3ASNC 5H5NA 2Y69C 2Q67A 4R8CA 1WN7A 4K8ZA 1H2KA 3OW2U 3VOUA 2XUMA 3E8GA 3AEIA 4I5SA 1QVGU 1LUVA 3SPJA 2YUAA 5ITZB 4TUYB 3O9OA 2Q7GA 2H8PC 4DV2B 2QWPB 1WJZA 5H2FZ 4B7KA 1HNZB 3BEHA 1Z2GA 1QQCA 2LO1A 1AB3A 2ODMA 5H6RA 2EZPA 3K04A 4UXNA 2WA3A 4UVCA 5EK0A 1JOYA 4GX0A 5GONA 5LOVA 3CXCU 4GT1A 1I94O 1OCZC 1NVPD 3RYFB 4DR2O 4BIUA 2ATKC 1BZKA 3ZMVA 1U97A 2CTWA 1K33A 3ZMSA 5LOVB 1PKXA 4I9WA 4QGPA 3K9SA 4F4LA 2HP8A 4JASA 1N33B 1M4UA 1VQMV 3N2GA 2XTAA 5BMVB 4PI2A 2ZXWC 1SQGA 4NB5A 2JDIG 1K5QA 1WP8A 3MHSC 4JTDB 4NXNO 3CRMA 4H0LB 2XT9A 3FKSG 5B1BC 3CRAA 4X66O 4DR3B 3LDCA 2XNDG 2C2AA 3C3SA 3SJQC 1KKCA 4LFAO 4LF4B 5IY5C 1MNGA 4BAYA 2YI9A 1OCOB 4IIJB 1EZJA 3DTUB 5IYBO 1TUBB 3QVNA 2FYUH 1SA0B
chains in the Genus database with same CATH topology
1XDCA 3CEIA 1IXBA 3AK2A 1VEWA 4F6EA 1IX9A 1LUVA 1B06A 1LUWA 2ADPA 1AP5A 1I08A 2AW9A 3OT7A 3DC5A 3EVKA 1AP6A 1XREA 2GDSA 4FFKA 1I0HA 1WB7A 1EN4A 3MDSA 2QKCA 1ZUQA 1GN2A 1QNMA 3LSUA 1AVMA 3KKYA 1PL4A 1EN6A 1N0NA 1XILA 1N0JA 1PM9A 1GN6A 1GN4A 4X9QA 1ZSPA 1AR4A 1Y67A 4YIOA 4JYYA 2QKAA 4JZGA 4E4EA 5A9GA 1JR9A 3RN4A 1XUQA 3IC9A 1BT8A 3K9SA 2ADQB 1BSMA 1D5NA 2CE4A 2CDYA 1WB8A 3AK3A 4YIPA 3C3TA 1ZLZA 1MA1A 1P7GA 1MMMA 1ZTEA 1AR5A 1JA8A 3AK1A 1GN3A 3BFRA 1VARA 4JZ2A 3TJTA 4GUNA 5AG2A 1IDSA 2P4KA 3C3SA 1KKCA 2RCVA 1MNGA 1MSDA 1EM1A 1BS3A 4C7UA 1EN5A 4BR6A 3DC6A 3QVNA 1SZXA 3KDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XDC A;  3CEI A;  1IXB A;  3AK2 A;  1VEW A;  4F6E A;  1IX9 A;  1LUV A;  1B06 A;  1LUW A;  2ADP A;  1AP5 A;  1I08 A;  2AW9 A;  3OT7 A;  3DC5 A;  3EVK A;  1AP6 A;  1XRE A;  2GDS A;  4FFK A;  1I0H A;  1WB7 A;  1EN4 A;  3MDS A;  2QKC A;  1ZUQ A;  1GN2 A;  1QNM A;  3LSU A;  1AVM A;  3KKY A;  1PL4 A;  1EN6 A;  1N0N A;  1XIL A;  1N0J A;  1PM9 A;  1GN6 A;  1GN4 A;  4X9Q A;  1ZSP A;  1AR4 A;  1Y67 A;  4YIO A;  4JYY A;  2QKA A;  4JZG A;  4E4E A;  5A9G A;  1JR9 A;  3RN4 A;  1XUQ A;  3IC9 A;  1BT8 A;  3K9S A;  2ADQ B;  1BSM A;  1D5N A;  2CE4 A;  2CDY A;  1WB8 A;  3AK3 A;  4YIP A;  3C3T A;  1ZLZ A;  1MA1 A;  1P7G A;  1MMM A;  1ZTE A;  1AR5 A;  1JA8 A;  3AK1 A;  1GN3 A;  3BFR A;  1VAR A;  4JZ2 A;  3TJT A;  4GUN A;  5AG2 A;  1IDS A;  2P4K A;  3C3S A;  1KKC A;  2RCV A;  1MNG A;  1MSD A;  1EM1 A;  1BS3 A;  4C7U A;  1EN5 A;  4BR6 A;  3DC6 A;  3QVN A;  1SZX A; 
#chains in the Genus database with same CATH topology
 1WNS A;  4Z1M G;  4JI6 B;  4IL6 Z;  3ML0 A;  1N34 B;  4PA9 A;  4JI2 B;  4J7K A;  3HR0 A;  2GSM B;  3IJ4 A;  2HVK C;  1P84 F;  3N2K B;  1V9P A;  3LDD A;  2PF4 E;  1K97 A;  4RUF A;  2OIG A;  1J5E B;  3T4Z A;  5IYZ B;  3ABK C;  2EUL A;  2P6J A;  1B3Q A;  3K3W A;  1BL8 A;  1KBH A;  4FFK A;  3K58 A;  2D2C B;  2Y0P A;  5LXT A;  2P7T C;  4Q20 A;  2F43 G;  3G67 A;  1GKF A;  2K1E A;  1KYO F;  1JVM A;  1MZE A;  1IXM A;  3LUT B;  3L70 H;  1PM9 A;  1IUR A;  4A5U B;  5LXT B;  2PI5 A;  1Y67 A;  1M57 C;  1QVF U;  3ZRW B;  4O2A A;  2IJH A;  2LW1 A;  4DR7 O;  3IC9 A;  3OGC C;  3OTF A;  3ZRS A;  4KHP B;  3AG3 C;  3W7T A;  4IT5 A;  3K0G A;  5KLV H;  1CEZ A;  3JD2 A;  1VQ8 V;  4PJ0 Z;  2GUZ B;  4NTY A;  4JTC B;  1YJN V;  4EKW A;  2IH1 C;  1NH2 B;  2WWW A;  3OE7 G;  4DO2 A;  2UU9 O;  5HFL A;  4I4T A;  5DED A;  4X1Y A;  2P4K A;  2BSK A;  4X1I B;  1MSD A;  4UCV A;  1YZB A;  4HYO A;  2B5U A;  1Q6U A;  3W7W A;  3E86 A;  1NZ6 A;  1H2S B;  2UXD B;  1QBZ A;  3JD1 A;  1I5Y A;  3HPL C;  4FLT A;  4NR1 A;  2Y48 A;  2OT5 A;  3FD9 A;  5CBF A;  4LFB O;  2UXN A;  2MW2 B;  3FB8 C;  2YIC A;  2YDE A;  1S3J A;  1R3I C;  4JI7 B;  3HKC A;  4UVA A;  5LP6 A;  5IJ9 A;  1JMK C;  3HKE A;  2KG7 A;  3DGE A;  4W4L A;  5LP6 C;  1JCH A;  1NH2 D;  3HKC B;  2IU0 A;  2W6I G;  1NTZ H;  1Q6H A;  4O4L B;  1XHZ A;  5BR8 B;  2KG7 B;  4TWK A;  4D7S A;  3APO A;  1XL6 A;  4X1K B;  2Q73 A;  3D3Q A;  1K4C C;  1K3E A;  1N0N A;  4DW1 A;  4FIP C;  5IWA B;  1G8M A;  4B3S O;  2KQX A;  4YHH O;  3OFN G;  4E4E A;  4IYI A;  1SQQ H;  3P3N A;  4FZ0 A;  2GBO A;  4MTG A;  1D5N A;  4QPK A;  2WA4 A;  4UUJ C;  3E8F A;  1KEC A;  1TAE A;  1GK9 A;  2UUC O;  4ICG A;  2YIA A;  3U0Z A;  4WFF A;  4DR2 B;  4LWS B;  4R50 A;  5EBL C;  5IYC O;  5LMN O;  5B1A B;  1ENV A;  3ZMT A;  2BTQ B;  3J80 N;  1Y66 A;  2V4D A;  4K3A A;  3CPW U;  3JCZ A;  3ASO B;  1NJI W;  3HB3 B;  4JI0 B;  1EM1 A;  2F4V B;  2FKX A;  3CX5 F;  4YJ2 B;  5JH7 B;  2ARH A;  2QGN A;  1W2B U;  3SYP A;  2N05 A;  2EIL C;  1FXK A;  1R3L C;  4QPJ A;  5L3B A;  5FPO A;  4CBC A;  5JQG B;  3SYA A;  2CH7 A;  1H38 A;  3RYI B;  3AG4 C;  1TVK A;  1OHH G;  3ZS8 C;  1BHB A;  3T1H O;  4MS2 A;  1FXK B;  4TSF G;  5EYP A;  3RGB A;  4B3R O;  2CH7 B;  3K08 A;  1TVK B;  2W0F C;  4NVP A;  2EZO A;  2Z3Y A;  4O4J B;  2ZIM A;  2IJI A;  5EYP B;  3MAQ A;  1OCC C;  2FTK A;  5LGT A;  4RQF A;  1ROP A;  3ABT A;  4DRX B;  1TUE B;  2OCC C;  4RWU A;  1M9N A;  4LC1 A;  1GMG A;  3MD0 A;  4K8X A;  2EIN B;  3LSU A;  3HKB B;  4BIO A;  4K0K O;  2JGD B;  1SC5 B;  1IBK O;  2EIJ C;  2V1D A;  4NXM B;  5JCO A;  2IU3 A;  1A32 A;  1JQ0 A;  4B3M O;  1HNW B;  4DUZ O;  2E3C A;  1GM9 A;  1NR7 A;  1R1B A;  4DV7 B;  1JFF B;  4KL1 A;  1Q7Y W;  4XBF A;  1KUQ A;  2ZR2 A;  2N74 A;  2M7W A;  4DR5 B;  3AK3 A;  5LBQ A;  1RPO A;  2BE3 A;  3CYO A;  5KAF Z;  4X88 A;  5IYD O;  2QEX V;  3ABM C;  4GX1 A;  4GKK O;  1URF A;  2DQ3 A;  5JVD A;  4DV5 B;  4DR1 O;  4LF5 B;  3TJT A;  2QWN B;  1SKV A;  5KHJ A;  1YTF B;  2ILM A;  4FLW A;  4MVZ A;  3SR2 C;  3UT5 B;  1X59 A;  4J9Y B;  4U3J A;  5K1P A;  4X64 O;  3KCX A;  3Q4H A;  4FJC C;  2HG5 C;  3AG2 B;  4J41 A;  1WA8 A;  2AXT Z;  1PNM A;  5CA0 A;  4B7E A;  3CC2 V;  1BQZ A;  1XDC A;  2IW5 A;  1W0J G;  2YS8 A;  4ZHQ A;  1FFX A;  4PD4 F;  1ZL8 A;  1VEW A;  4WBN B;  4I0X A;  4KP4 A;  3VQV A;  2CTR A;  1B06 A;  1AP5 A;  2LJ2 A;  5LGU A;  1SZT A;  3OT7 A;  5CB4 A;  3VQY A;  1SQF A;  3D3I A;  3QO8 A;  5B3S B;  3RBZ A;  3BY6 A;  4FMT A;  1YTF D;  2ZE5 A;  4X65 B;  1L0L H;  3MDS A;  1GN2 A;  3G6E V;  2B1G A;  5FL7 G;  1PL4 A;  1K73 W;  2VQF B;  4X20 A;  2QE7 G;  1XMO O;  1GAX A;  4QE7 A;  2X6A A;  1YCI A;  4O4I A;  4JZG A;  2G38 A;  5A9G A;  1V55 C;  1F4N A;  1G6U A;  1RP3 B;  4EB6 A;  3ZMZ A;  4LNU A;  3D36 C;  2DJV A;  4O4I B;  1NU1 H;  4KUM A;  3ZX6 A;  2CDY A;  3BPZ A;  4LF9 O;  3F5T A;  3SPI A;  2UUB O;  5KX5 A;  4G28 B;  1P7G A;  4JI4 B;  1ZTE A;  3X2Q B;  4DV6 O;  2A9H A;  3OMA B;  3FB7 C;  1VIB A;  4WF9 V;  4GUN A;  5CA1 B;  4DR6 B;  2OYQ A;  4PDL A;  1V54 B;  3RFR A;  3RYC A;  1N36 B;  2JS5 A;  4LR3 A;  2JEX A;  1SS3 A;  5BXZ A;  3JAM N;  3WG7 B;  2WLI A;  3ETE A;  5JJE B;  2YIB A;  4TV9 A;  3ZJZ A;  4MTF A;  2FML A;  4H37 A;  4MW8 A;  4HNA B;  3ZN0 A;  1Y76 A;  3ZCC A;  4OXS A;  3OUF A;  5KHK A;  3ICX A;  1S72 V;  1M1K W;  4BWA A;  4YY3 O;  3EXA A;  4AI8 A;  1ZX3 A;  1NVP B;  4DV4 B;  4UCT A;  3ZRX A;  3JSN A;  1QR9 A;  1L8D A;  4MT8 A;  1JX9 A;  1KKD A;  5J9P C;  3K59 A;  2QM4 A;  2Y69 B;  3F7Y C;  1YVW A;  4FLZ A;  4JI3 B;  3UQ8 A;  2L6L A;  5FPR A;  4GKJ O;  2HFE C;  5EC1 C;  3JAK A;  5IE9 A;  1FD9 A;  1MSW D;  1XNR B;  1YJ9 V;  5L3D A;  4FLX A;  1R73 A;  2A0L A;  2CUG A;  4FM2 A;  1SES A;  4LH6 A;  1Q86 W;  4JV5 O;  4X89 A;  1JR9 A;  2LFR A;  4CS3 A;  4DV3 O;  1S5J A;  1BGY H;  4N23 A;  4DV0 O;  1H2G A;  2UXB O;  2ZKO A;  1RPR A;  3GWO A;  2BOC C;  2Z0A A;  3CD6 V;  4GCZ A;  3LDE A;  1XQ8 A;  3QG5 A;  2YIB D;  1T5E A;  1WB8 A;  3CS5 A;  2ZIO A;  5EZY A;  1NBM G;  1FAF A;  1GN3 A;  3BFR A;  5GON B;  1FS0 G;  1FOU A;  2UUA B;  4G27 B;  5EZY B;  2ZDI C;  2LFS A;  1IBL B;  2ZM6 O;  1Q43 A;  4JI5 O;  2QWR B;  1QU7 A;  3L75 H;  4MTO A;  2WLJ A;  3ETQ A;  3JSL A;  1DGS A;  4X62 B;  3RT3 C;  2OTJ V;  3N2G B;  4IGG A;  4U7N A;  3ABL B;  4DUY B;  1PL0 A;  3W7X A;  2WLM A;  3IFX A;  2XAF A;  4JI1 B;  1MAB G;  1UPG A;  1SQB H;  3JAR A;  4PDM A;  3CC4 V;  1CXZ B;  2ITD C;  1GM8 A;  3E89 A;  4YJ3 A;  4GX2 A;  5CN0 A;  3O65 A;  5IY5 B;  1Q8I A;  1AJN A;  1KMI Z;  2RMK B;  2ITC C;  3EVK A;  3ZMU A;  1AP6 A;  1GTO A;  1K92 A;  2VQE O;  5FLX N;  1L0N H;  2A06 H;  2HJF C;  1HNX B;  5L3F A;  1OCO C;  1GM7 A;  3H01 A;  1VQ6 V;  1WPB A;  3CCQ V;  2PGG A;  3KKY A;  2JJ1 G;  4DK0 A;  4K35 A;  4XDJ A;  4DV1 O;  3GWK C;  3SYC A;  4Z2W A;  3JD0 A;  2A3Q A;  4FLV A;  2V7Q G;  3UCS C;  1DTO A;  3ABK B;  5F2V O;  5BY1 A;  3FAV A;  1G1X B;  5J2U A;  4MVR A;  1IZ3 A;  2AHZ A;  1MOF A;  1BHA A;  4TOI A;  3L72 H;  5B1N A;  3NXS A;  1JNB A;  2GV9 A;  4JAU A;  1ZLZ A;  1NS1 A;  4OX9 O;  1F23 A;  1MMM A;  1HR0 B;  3VQX A;  4I50 A;  3I56 V;  2WLH A;  2ZNI A;  1OZ0 A;  1OV9 A;  2ZQM A;  1M56 B;  3GVM A;  1O9G A;  3H1J H;  2EIK C;  2IM9 A;  1RM1 C;  4I50 B;  3AG3 B;  4O2A B;  4JYA B;  2QWQ B;  1NQT A;  3IC7 A;  1K5S A;  2YC0 A;  1Y6X A;  3K5M A;  2QR4 A;  4BR6 A;  4JI8 B;  2QTO A;  1F7Y A;  3T2M A;  2DOS A;  1W0K G;  2DYR C;  3K79 A;  1I7F A;  3OUS A;  2BTO A;  4FK5 C;  1XOU A;  3IGA C;  2RQ6 A;  3SPG A;  4AQY O;  1VQL V;  3FYI B;  1FPO A;  3JD4 A;  2HJD A;  2E5L B;  3L9D A;  4AHC A;  3D8C A;  5A2Q N;  3F7V C;  2ADP A;  4I4T B;  4X1Y B;  2E76 B;  1VQK V;  3DC5 A;  2JRI A;  4JYB A;  1HP8 A;  4LFC B;  3ZHR A;  2BSK B;  2OWO A;  4CH6 A;  1R6N A;  1Q5O A;  4LF8 B;  4LP8 A;  3OTO O;  1N32 B;  3SYQ A;  4QIW F;  5H9C A;  3QO7 A;  1AI5 A;  2QKS A;  3K0D A;  4OPH A;  5KA6 A;  1IVS A;  1GN4 A;  1K4D C;  4UV8 A;  4J7J A;  2H3O A;  2E74 B;  4TQF A;  3LNM B;  2QKA A;  4EEQ A;  1E79 G;  2GTS A;  4KFM A;  2DMX A;  1IBM O;  1XBL A;  5LP6 B;  2NNU A;  5IJ9 B;  1Z5V A;  3HKE B;  4PA3 A;  1KD1 W;  4G2K A;  3I55 V;  1FJG O;  2CE4 A;  5CMU A;  4WFB V;  3B2E E;  2HHH O;  3H1L H;  1MA1 A;  3I5D A;  1KB9 F;  3OR6 C;  4DK1 A;  4FPP A;  4CC6 A;  4JZ2 A;  3T1Y O;  4LF7 O;  3CSX A;  5AG2 A;  2AGA A;  1CPY A;  2A7W A;  3LSS A;  1XNQ O;  2MK3 A;  2EJR A;  4N21 A;  4ZOL A;  3W7U A;  4DR4 O;  1I94 B;  2ZR3 A;  2JS3 A;  1Z5W A;  2XAJ A;  4R6Z A;  3BRC A;  1VMG A;  1XMQ O;  1HWY A;  1PP9 H;  2R9A A;  1WP7 A;  3BA8 A;  5JJJ B;  3CCL V;  3QO5 A;  4JI5 B;  4D6T H;  4E2L A;  1VF6 A;  2R9R B;  1M93 A;  3G80 A;  3H9V A;  1VF6 C;  1NT2 B;  4QJF B;  4NXN B;  5B1O A;  4X66 B;  3ZED A;  3ASO C;  2W6J G;  5D5P A;  3ZHU A;  3B8M A;  1QLE C;  4LFA B;  3L71 H;  2VS0 A;  5LMU O;  4UFZ A;  2ZNJ A;  1S76 D;  1ZWI C;  4B3T O;  3AG4 B;  1THZ A;  1D2D A;  1QLN A;  3F5W C;  3H1H H;  4P30 A;  4UV9 A;  2B1I A;  2EJ7 A;  3NR7 A;  3VBB A;  2E75 B;  4MW3 A;  1PNK A;  2JGU A;  2ZE7 A;  5E1A C;  1Q90 D;  3U11 A;  1OCC B;  2M6Y A;  4J10 A;  5TIS Z;  1R6K A;  3RW0 A;  1ORQ C;  2OCC B;  1YEW A;  4YIP A;  2XAG A;  3ZHT A;  1YSC A;  3CB2 A;  3PN1 A;  3JAL A;  4X8A A;  4DV2 O;  1F4M A;  2EIJ B;  1GH6 A;  4FM0 A;  1HNZ O;  2FB5 A;  1OCR B;  2CGO A;  2EIN C;  2KKW A;  4B08 A;  5LYJ A;  3G4S V;  2QJ1 A;  2F66 C;  2HVJ C;  2Q0A A;  3OAA G;  3A0R A;  5EBM C;  2Q69 A;  3UO3 A;  2KB1 A;  3STZ C;  4FLY A;  2Y4U A;  2CTQ A;  5LYJ B;  3CCR V;  1EN5 A;  1JPX A;  4PA7 A;  2CGN A;  4DR7 B;  3ABM B;  3CEI A;  1YF2 A;  1H8E G;  2VWJ A;  2EIM C;  2VRZ A;  1N33 O;  4GZR B;  1VQO V;  4I55 A;  5JVD B;  3N27 A;  2W0X A;  2XAH A;  1K9M W;  4DW0 A;  1BMF G;  2WLN A;  1XHX A;  5LHH A;  4QE9 A;  3QTC A;  2UU9 B;  4U3J B;  5J2T A;  2OIE A;  4W4K A;  3Q4H B;  5GTI Z;  3WB1 A;  4XDL A;  4DR3 O;  1YIJ V;  5IJ0 A;  1WA8 B;  5LHG A;  5EIB C;  5CA0 B;  4LF4 O;  2DN9 A;  3CMA V;  3OEE G;  1GN6 A;  4ZHQ B;  1FFX B;  1ZL8 B;  1AR4 A;  3FX7 A;  4I0X B;  1S5L Z;  3TXQ A;  4HBN A;  3CCE V;  2B9Z A;  3CCM V;  4L8J A;  4LFB B;  1WPX A;  1BT8 A;  4PA6 A;  4JI2 O;  2X7R B;  1FYJ A;  2WLL A;  2ZE6 A;  5CB4 B;  3DXR A;  3RYH A;  1XL4 A;  3K9A A;  1KP2 A;  3R65 A;  2XAS A;  1IJG A;  3CME V;  5B3S C;  5CBH A;  1Q6I A;  2L35 A;  2ZT9 B;  1J5E O;  1AR5 A;  1D5A A;  1JA8 A;  1Q82 W;  5CBG A;  3RYH B;  1AIL A;  3D36 A;  4X20 B;  2JJ2 G;  5FNV A;  4O2B A;  3L74 H;  1O9H A;  4LH7 A;  4EB6 B;  4UCO A;  3ETG A;  5KHG A;  1BS3 A;  4B3S B;  4FM1 A;  4YHH B;  3A2F A;  5BZB A;  4LNU B;  1LNQ A;  2IJK A;  4LF7 B;  2H94 A;  3ZN1 A;  4KXR A;  3LNN A;  1IXB A;  2Z5U A;  3AK2 A;  2BOB C;  2ZE8 A;  3CHX A;  2JEU A;  2P4V A;  4JF3 A;  5KHI A;  5KX5 B;  4KHP O;  3HKD A;  2UUC B;  5GTH Z;  2X6B A;  1LUW A;  4ZBM A;  3E35 A;  4ZI7 A;  2YEV A;  2AZ2 A;  1P49 A;  2AW9 A;  4CC5 A;  2PZS A;  5LMN B;  1YIT V;  2XAQ A;  3RYC B;  3H1K H;  4NTX A;  1V54 C;  2GDS A;  4ZI7 B;  1I0H A;  4OGQ B;  3E83 A;  3E22 A;  3QF7 A;  4O4H A;  4WFA V;  5HFM A;  1VP7 A;  2QKC A;  4EFB A;  1NTM H;  1FXV A;  1LR1 A;  4LF6 O;  3WB2 A;  2WLI B;  4TV9 B;  4YXW G;  3B09 A;  2QSA A;  4UCR A;  4O4H B;  1Y76 B;  3M8A A;  3U10 A;  3FB6 C;  4D7T A;  5EBW C;  3CRC A;  3FYE B;  5LHI A;  2UXD O;  3RN4 A;  1HW7 A;  1XUQ A;  3AG1 C;  5KMG A;  2LP7 A;  3T1C A;  4WFH A;  2DYS C;  2ZD9 A;  3ASN B;  3SJA C;  1BSM A;  3T1H B;  1RSO A;  1K7D A;  3ZRV A;  3M7M X;  3STL C;  2R70 A;  4B3R B;  3CWB H;  4JI7 O;  3ZIA G;  2WSS G;  3C3T A;  1VF7 A;  3A8T A;  5L3E A;  1NKD A;  5KUM A;  2DW4 A;  3UM7 A;  5B66 Z;  3JYC A;  3J81 N;  3AK1 A;  5K1X A;  2DWE C;  5ITZ A;  4PI0 A;  4TUY A;  2RJZ A;  3JAK B;  4H13 B;  2HR3 A;  1IDS A;  5LL6 Y;  5BR8 O;  1VF5 B;  1FFT B;  4JAV A;  4K0K B;  3ZHQ A;  3B40 A;  1AR1 B;  1IBK B;  2Y4T A;  4JPR A;  1S0V A;  4J7Z A;  4B3M B;  1JJO A;  4DUZ B;  1BE3 H;  4CZZ A;  5IWA O;  2Y0I A;  1KP3 A;  2ZDI A;  1OCZ B;  1KC8 W;  2F1M A;  3K06 A;  3RYF A;  2XOK G;  3OR7 C;  4CH3 A;  2R9I A;  5KUK A;  3GB7 C;  3P32 A;  3K03 A;  2Q6A A;  4GKK B;  1GO3 F;  2WAM A;  2ZXW B;  4ABM A;  4DR1 B;  1XI1 A;  1YHQ V;  5BMV A;  1SRY A;  5GW7 A;  1XRE A;  1QR8 A;  4RAI A;  3FFQ A;  3OMI B;  2F93 B;  3TGU H;  3JAS A;  2D3O W;  5B1B B;  4X64 B;  5LGN A;  1EN6 A;  1MZF A;  1PV0 A;  4JI0 O;  4FFB A;  3RVZ A;  2F4V O;  1E1R G;  2P90 A;  3JAS B;  3ABL C;  2PYL A;  2K9P A;  2HLD G;  3UKM A;  1EZV H;  3JAR B;  1QHT A;  4UB6 Z;  1H5W A;  4IIJ A;  2PY5 A;  3CCU V;  4YJ3 B;  4FFB B;  2QM7 A;  4MSW C;  1TUB A;  2ADQ B;  5IT9 N;  1SA0 A;  4AIL C;  4Z1V A;  2NR5 A;  1UJW B;  3B8N A;  1SER A;  1US6 A;  1PNL A;  1G4Y B;  3N2K A;  4PDR A;  4UCU A;  2PUS A;  3A0H Z;  5L3C A;  3DSQ A;  1RFY A;  5IYZ A;  4WFG A;  2WLK A;  1WLE A;  4MVQ A;  1XMO B;  3ZBH A;  2WPD G;  1OJH A;  3CXH F;  3FAV B;  5J2U B;  4IHJ A;  1SZX A;  4U3F H;  4JYC A;  4NXM O;  4GX5 A;  1NTK H;  1H2L A;  2YI8 A;  1HNW O;  1EBO A;  1GRJ A;  2IH3 C;  2P5O A;  1M57 B;  4DV7 O;  2JIZ G;  4IHJ B;  3ZRW A;  2F95 B;  4LF9 B;  2QTS A;  4ZIB A;  2UUB B;  3FB5 C;  3JAW A;  4JAA A;  4DR5 O;  3SYO A;  3SPC A;  2EIK B;  1RM1 B;  4DV6 B;  3SPH A;  2UXC O;  2BCC H;  3K5L A;  4R7C A;  2R72 A;  1M56 C;  3TXS A;  2OCH A;  4F6R A;  4CH5 A;  4DV5 O;  1HDJ A;  3JAW B;  2GUZ A;  2CTP A;  4BW5 A;  4LF5 O;  2CAZ C;  4I9Q A;  2DYR B;  3SGI A;  3E8H A;  1QNM A;  2YSU B;  4JGS A;  2YXL A;  4F6R B;  1AI6 A;  3CRR A;  1XIL A;  2VWK A;  2ETN A;  3CC7 V;  1S77 D;  4XDK A;  2ZIN A;  1TGO A;  4X1I A;  4OPA A;  4NYK A;  4LF6 B;  1AJP A;  1FKA O;  1AJQ A;  4CS2 A;  3VQW A;  3OD4 A;  4YY3 B;  4MVM A;  5KA5 A;  4PV1 B;  2Q8V A;  1E1Q G;  3JD3 A;  2X6C A;  3EFF K;  4ZKI A;  2RNB A;  3CCS V;  3SJC C;  1MG1 A;  4X65 O;  4MVS A;  4P9O A;  4J11 A;  4GKJ B;  3EHB B;  1R6T A;  4P2Z A;  4BW9 A;  1DF5 A;  4UB8 Z;  3CCV V;  4O4L A;  2VQF O;  2YXY A;  4C7U A;  4X1K A;  1VQN V;  3KDR A;  3ZHS A;  4JV5 B;  2HKO A;  4RO2 A;  4DV3 B;  3T4D A;  4DV0 B;  1KQS U;  2UXB B;  3S3X A;  4PDV A;  4DXW A;  2P67 A;  1B04 A;  1R3J C;  3UO2 A;  3W7S A;  1I08 A;  1K8A W;  2LW7 A;  4CS4 A;  1SQX H;  1R3K C;  4ASU G;  3BVO A;  1W59 A;  1YXB A;  1NI8 A;  4JI4 O;  4ZOL B;  2Q5Z A;  2QDO A;  3R66 A;  1VQ5 V;  4PA4 A;  2AHY A;  1WB7 A;  3M99 B;  4LWS A;  1EN4 A;  4UVB A;  5EC2 C;  2ZM6 B;  1YI2 V;  4GYC B;  1ZUQ A;  4DR6 O;  1F51 A;  4L87 A;  1N36 O;  2RN9 A;  1N0J A;  2BTQ A;  5LA6 A;  4JTA B;  5B1A C;  1Y4M A;  4JYY A;  3IAY A;  3B4S A;  5JH7 A;  4YJ2 A;  2DQ0 A;  2Q7E A;  3TK1 A;  3CRQ A;  5LA6 B;  4CH4 A;  3OMN B;  4RUE A;  2EIL B;  5B5E Z;  1AI4 A;  3BHP A;  1WAZ A;  2P06 A;  1QLE B;  1ZAU A;  2LQT A;  1BCC H;  1M5I A;  3OM3 B;  5JQG A;  1COW G;  3RYI A;  4Q6G A;  3ETD A;  4RQE A;  3P3P A;  2Q9L A;  2VQE B;  2QA4 V;  5DM6 V;  3ZHV A;  4DV4 O;  1SF9 A;  3JAT A;  3TET A;  4GLX A;  1FXK C;  4WFE A;  3BA9 A;  4O4J A;  2A79 B;  5KHH A;  4JI3 O;  3JAT B;  1N8R W;  4DV1 B;  1P7B A;  4DRX A;  4LBE C;  3BAB A;  2AZ0 A;  1VQ7 V;  1DF4 A;  1XNR O;  3HKB A;  2YXH A;  4FLU A;  2JGD A;  2QWO B;  1UFI A;  1SET A;  3S3W A;  4HZ3 A;  5KAI Z;  4F6E A;  3KG2 A;  2Q0O C;  1YDX A;  3JAL B;  4IYH A;  3TCU A;  1IX9 A;  1TA8 A;  1H2N A;  4OX9 B;  1JFF A;  2JK5 C;  1J95 A;  3K5O A;  1PD3 A;  1OCR C;  3BCC H;  1L1F A;  3ABU A;  5JCO C;  4TT3 G;  5JWP A;  2JVD A;  4MVO A;  4BIZ A;  2UUA O;  1DLB A;  3CJH A;  2YID A;  1YJW V;  3MHH C;  1IBL O;  1AVM A;  3CCJ V;  5D5Q A;  2X0L A;  4WCE V;  2PI4 A;  2LGW A;  2EIM B;  1I5X A;  2KSD A;  2UXC B;  2QM8 A;  4NKG B;  3CE2 A;  3K57 A;  3UT5 A;  1Q3E A;  4TQD A;  3KCY A;  5L3G A;  4YIO A;  3CJH B;  3K5N A;  2PTM A;  1S5H C;  2GTA A;  4X62 O;  1H2M A;  5H6Q A;  4AQY B;  2N04 A;  4I55 B;  3RWR D;  4DUY O;  3H1I H;  3AG2 C;  2HEP A;  4TV8 A;  1X4T A;  4JI1 O;  2XHB A;  2GHY A;  2P22 C;  2OTL V;  4PHZ A;  5DEC A;  4WBN A;  5J2T B;  1AI7 A;  3AG7 A;  2ZCE A;  3L73 H;  5IJ0 B;  1P4R A;  4TV8 B;  4HAM A;  1M90 W;  4MTX A;  1VAR A;  4JI6 O;  2LGQ A;  3QNE A;  1N34 O;  1BQ0 A;  3WB0 A;  3B77 A;  3OTO B;  4H44 B;  5E79 Z;  1HNX O;  5DN6 G;  1ARO P;  2RDC A;  5C8Y A;  2DWD C;  2RCV A;  1SQV H;  2Q7H A;  3SJB C;  2PYJ A;  1NR1 A;  1EFR G;  3LSQ A;  1U96 A;  2Q4P A;  2WLL B;  4J42 A;  4J80 A;  5C8Y B;  1IBM B;  4QNH B;  3DXR B;  4P9P A;  1VQ4 V;  1FJG B;  4FVM A;  1V55 B;  3A0B Z;  5IDJ A;  1VQP V;  1VQ9 V;  2HHH B;  5EIB D;  4H33 A;  2Q68 A;  3BAA A;  1SQP H;  3P30 A;  5FNV B;  3T1Y B;  1HR0 O;  1QCE A;  4O2B B;  3APQ A;  1K34 A;  4EFE A;  1XNQ B;  2CK3 G;  3G71 V;  2F23 A;  4DR4 B;  4U7O A;  2IBZ H;  3PJS K;  3X2Q C;  1XMQ B;  2NN4 A;  4I7Z B;  1FXH A;  1ZSP A;  2DE0 X;  3OGI B;  4X9Q A;  3RVY A;  5CA1 A;  4JYA O;  3OEH G;  1XEQ A;  4PEL A;  3JCU Z;  4JI8 O;  2EX3 A;  3HKD B;  1Q81 W;  4DYL A;  2EBO A;  1Y74 A;  2FL4 A;  1CP9 A;  2YEV B;  3KZI Z;  4J9Z B;  3THO A;  2IJJ A;  2E5L O;  4LCU C;  3J7A U;  4HNA A;  3WG7 C;  1Y74 B;  3E8B A;  5CA3 A;  1DK1 A;  4MVU A;  3E22 B;  3SDL A;  3G6B A;  1JJ2 U;  4LFC O;  1B6Q A;  3C90 A;  2O57 A;  5LMU B;  2UXX A;  3AG1 B;  4LF8 O;  5JJN B;  3WU2 Z;  4B3T B;  2DYS B;  1N32 O;  3WFV A;  3E2E A;  4NTW A;  1N4C A;  4UCS A;  5KMG B;  5C93 A;  1KU9 A;  3DC6 A;  3CP1 A;  1PPJ H;  1H8H G;  4FZ1 A;  1RSO B;  2NLJ C;  3ASN C;  5H5N A;  2Y69 C;  2Q67 A;  4R8C A;  1WN7 A;  4K8Z A;  1H2K A;  3OW2 U;  3VOU A;  2XUM A;  3E8G A;  3AEI A;  4I5S A;  1QVG U;  1LUV A;  3SPJ A;  2YUA A;  5ITZ B;  4TUY B;  3O9O A;  2Q7G A;  2H8P C;  4DV2 B;  2QWP B;  1WJZ A;  5H2F Z;  4B7K A;  1HNZ B;  3BEH A;  1Z2G A;  1QQC A;  2LO1 A;  1AB3 A;  2ODM A;  5H6R A;  2EZP A;  3K04 A;  4UXN A;  2WA3 A;  4UVC A;  5EK0 A;  1JOY A;  4GX0 A;  5GON A;  5LOV A;  3CXC U;  4GT1 A;  1I94 O;  1OCZ C;  1NVP D;  3RYF B;  4DR2 O;  4BIU A;  2ATK C;  1BZK A;  3ZMV A;  1U97 A;  2CTW A;  1K33 A;  3ZMS A;  5LOV B;  1PKX A;  4I9W A;  4QGP A;  3K9S A;  4F4L A;  2HP8 A;  4JAS A;  1N33 B;  1M4U A;  1VQM V;  3N2G A;  2XTA A;  5BMV B;  4PI2 A;  2ZXW C;  1SQG A;  4NB5 A;  2JDI G;  1K5Q A;  1WP8 A;  3MHS C;  4JTD B;  4NXN O;  3CRM A;  4H0L B;  2XT9 A;  3FKS G;  5B1B C;  3CRA A;  4X66 O;  4DR3 B;  3LDC A;  2XND G;  2C2A A;  3C3S A;  3SJQ C;  1KKC A;  4LFA O;  4LF4 B;  5IY5 C;  1MNG A;  4BAY A;  2YI9 A;  1OCO B;  4IIJ B;  1EZJ A;  3DTU B;  5IYB O;  1TUB B;  3QVN A;  2FYU H;  1SA0 B; 
#chains in the Genus database with same CATH homology
 1XDC A;  3CEI A;  1IXB A;  3AK2 A;  1VEW A;  4F6E A;  1IX9 A;  1LUV A;  1B06 A;  1LUW A;  2ADP A;  1AP5 A;  1I08 A;  2AW9 A;  3OT7 A;  3DC5 A;  3EVK A;  1AP6 A;  1XRE A;  2GDS A;  4FFK A;  1I0H A;  1WB7 A;  1EN4 A;  3MDS A;  2QKC A;  1ZUQ A;  1GN2 A;  1QNM A;  3LSU A;  1AVM A;  3KKY A;  1PL4 A;  1EN6 A;  1N0N A;  1XIL A;  1N0J A;  1PM9 A;  1GN6 A;  1GN4 A;  4X9Q A;  1ZSP A;  1AR4 A;  1Y67 A;  4YIO A;  4JYY A;  2QKA A;  4JZG A;  4E4E A;  5A9G A;  1JR9 A;  3RN4 A;  1XUQ A;  3IC9 A;  1BT8 A;  3K9S A;  2ADQ B;  1BSM A;  1D5N A;  2CE4 A;  2CDY A;  1WB8 A;  3AK3 A;  4YIP A;  3C3T A;  1ZLZ A;  1MA1 A;  1P7G A;  1MMM A;  1ZTE A;  1AR5 A;  1JA8 A;  3AK1 A;  1GN3 A;  3BFR A;  1VAR A;  4JZ2 A;  3TJT A;  4GUN A;  5AG2 A;  1IDS A;  2P4K A;  3C3S A;  1KKC A;  2RCV A;  1MNG A;  1MSD A;  1EM1 A;  1BS3 A;  4C7U A;  1EN5 A;  4BR6 A;  3DC6 A;  3QVN A;  1SZX A;  3KDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...