4BR6A

Crystal structure of chaetomium thermophilum mnsod
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Biochemical Characterization of a Manganese Superoxide Dismutase from Chaetomium Thermophilum.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
total genus 72
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4br6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4br6A02
1EN5A 3MDSA 1JA8A 1MMMA 3IC9A 3AK1A 4C7UA 1VARA 1XUQA 1MNGA 4BR6A 1GN2A 1ZUQA 4GUNA 1EN4A 2CDYA 1GN3A 1EN6A 5AG2A 1N0NA 1EM1A 3C3SA 1KKCA 1SZXA 3DC6A 4FFKA 1AP5A 3C3TA 1VEWA 1N0JA 1B06A 1P7GA 1AP6A 1ZLZA 2GDSA 3DC5A 1IDSA 1I0HA 2CE4A 4JYYA 1IX9A 1XILA 1XDCA 1PL4A 1AR4A 1XREA 4E4EA 1PM9A 3TJTA 4JZ2A 1BSMA 4F6EA 4JZGA 1QNMA 1D5NA 3LSUA 1BT8A 3AK2A 1LUVA 2P4KA 1LUWA 4YIPA 3OT7A 1I08A 1GN4A 1AVMA 2QKAA 3AK3A 4YIOA 1Y67A 1MA1A 1JR9A 1WB7A 2ADPA 1IXBA 3RN4A 3K9SA 1ZTEA 2RCVA 3CEIA 2AW9A 1ZSPA 3EVKA 3BFRA 1WB8A 3KKYA 2QKCA 1BS3A 5A9GA 3QVNA 1AR5A 1GN6A 1MSDA 2ADQB 4X9QA
chains in the Genus database with same CATH superfamily
4FZ0A 2UUBO 1QCEA 1FJGB 2FB5A 4QGPA 4I0XA 2FMLA 2PY5A 3G71V 1WPXA 4DUYB 2F93B 5KHGA 4FLWA 1K97A 4O2AB 5GW7A 4JI5O 4RO2A 3ABTA 3AG3C 5JQGB 3JASB 2JIZG 5JJJB 3L74H 1W2BU 4UCTA 1J95A 4KXRA 4LCUC 3CC4V 3M8AA 1HW7A 4UVCA 2KG7A 1Z5WA 3WB1A 2PGGA 4X1IA 4MW8A 4J10A 1SA0A 2JJ1G 1XQ8A 1XNQO 1HNXO 4GT1A 5LOVA 3K0DA 4QPKA 4CC5A 3L72H 1JNBA 4QNHB 4ABMA 2QWRB 1U96A 1N32O 3P32A 2L6LA 4GX1A 3MHHC 3SPHA 4DUYO 1SRYA 4H0LB 3T1HB 4I50A 4EEQA 1FJGO 3JAKA 2UXCB 2QTSA 1K33A 4JI2O 2O57A 3HKBA 1P4RA 1SQXH 4U3FH 3HKDA 2YUAA 3K59A 2D2CB 2QWNB 5GTHZ 2ZQMA 3CC2V 3S3WA 3SYPA 4FFBB 4LF6O 3G6EV 2GTSA 4TT3G 1GM8A 3I5DA 3N2GB 4UB8Z 1QBZA 4YHHB 2P6JA 5BXZA 3TGUH 3HB3B 1GK9A 5B1AC 2DYSB 1XUQA 3THOA 1F7YA 4JI3B 4UVAA 3ABKC 2CDYA 4DV1B 4I50B 3W7WA 2OTLV 1JX9A 4PA3A 4DV4B 2X6BA 2UXNA 2UXCO 4FFKA 2LFSA 4FVMA 1VEWA 2BTQB 1M4UA 3CHXA 1UJWB 4F6RA 4K8ZA 2OIGA 1TUEB 3BHPA 4FIPC 3TJTA 1YZBA 3BEHA 1NI8A 3WFVA 3NR7A 1XHZA 5EBMC 1S5JA 2N05A 4YJ2B 3CWBH 3U0ZA 4BAYA 2MK3A 4DV0B 2G38A 1HNXB 4BIZA 4QPJA 4KUMA 2WLKA 2HJFC 3A2FA 3B2EE 4HBNA 3AG1B 2ZNIA 4I5SA 2GUZA 2ETNA 1R1BA 4X62O 4ZI7A 2KKWA 3B77A 3E22B 3JAKB 2JEXA 4JYAB 2AXTZ 1OV9A 2UXDO 3EVKA 4CH3A 1FS0G 2ZXWC 5D5QA 3BPZA 2ZKOA 1BS3A 2P90A 5EIBD 1R6TA 3QO5A 4OX9O 3ABLC 3H1HH 4JYBA 3LNMB 4DW1A 3VQYA 2CAZC 3L71H 5JJNB 3CB2A 3JATA 2EIKB 1RSOA 1H8HG 1MABG 1UPGA 3K9AA 2X0LA 3RYFA 3CCEV 2AHYA 3CCVV 2IH3C 1S5HC 4QIWF 5GONA 4IIJB 5B66Z 4R50A 1G8MA 2EIJC 2CH7A 5B3SB 4LF6B 3E8BA 3VOUA 2QM7A 4LNUA 1VP7A 1M57C 5CA0A 1KP3A 4JPRA 5IJ0B 3ZMSA 3DC5A 3X2QC 5EC2C 1S5LZ 2WSSG 5B1AB 5IYCO 3SJAC 4X20B 1R73A 1V54B 1D2DA 1O9GA 5CA1B 1Y4MA 4ZHQA 3LDEA 2EINB 2P06A 1VQLV 1H2GA 3CCUV 4ZOLA 1KECA 1Q6HA 4JI4B 2Z0AA 2Z5UA 3K3WA 1E79G 1QLEB 1KP2A 1N32B 3ZJZA 3MAQA 4DR5O 3SPIA 4RAIA 2ZIOA 3G80A 4IIJA 3T1CA 4JYAO 3SR2C 2YI9A 1K5SA 1FOUA 1JR9A 4HYOA 3E22A 3FB6C 5GTIZ 4RQEA 5IJ0A 5LXTA 1M5IA 3K9SA 4DV3B 2Y69B 1N34O 2KQXA 2NNUA 1ZSPA 2N04A 4LFCB 1WB8A 2KB1A 5L3CA 5J9PC 2NR5A 1K8AW 2KG7B 5LP6C 1MSDA 4LF8B 1BHAA 5LHHA 4DXWA 5LP6B 2EX3A 4FLUA 3IJ4A 2EIJB 3JD3A 1M56C 2R9AA 2GHYA 1HNWO 4R6ZA 4TWKA 5L3DA 1M93A 5LOVB 3JD0A 3JATB 4TOIA 1FFXA 5H6QA 2BE3A 3ZIAG 2HVJC 5C8YB 1YVWA 4DR6O 5B5EZ 4EFEA 5TISZ 1SQQH 1V9PA 3D36A 5L3BA 2UUBB 4O4IB 1EM1A 4DV4O 1KKCA 1BL8A 3UCSC 3OR7C 4DYLA 1R6NA 3D8CA 1IDSA 4DUZO 1Y76B 3RWRD 2ARHA 1IX9A 2E3CA 4YXWG 4O4JB 3RYCA 1SKVA 1Q82W 5KLVH 4YHHO 1SETA 3U11A 3K5NA 4I4TB 4JI6O 5KMGA 4DR1B 4Q20A 4LF4B 2BOCC 2KSDA 1CXZB 1D5NA 3JD1A 3K5OA 2EILB 3KG2A 5KX5A 4TV9B 3OTOB 2F95B 3X2QB 1SS3A 1OCRC 4DV5O 3W7TA 5LYJB 3AG7A 1AVMA 2Q69A 3U10A 4J41A 3AG4C 3J80N 4JI2B 5KHHA 1VQ7V 1Q81W 4GX5A 4O4IA 3N2KA 3RFRA 3E8HA 5DEDA 4X64O 3K58A 3TETA 4OPAA 1PNLA 1NR7A 1KQSU 1OCOB 4DR6B 2ATKC 5E1AC 2RCVA 1KUQA 4CH5A 3ZRWB 5L3EA 2QKSA 2QKCA 2LQTA 3ZHSA 2QWQB 1DLBA 2Q67A 3GWOA 2ILMA 1B3QA 3C90A 2Y48A 2A06H 1AB3A 4UXNA 3QNEA 3K08A 3H1KH 4UVBA 4K3AA 3ZN0A 5CA3A 4U7OA 2ODMA 2JS3A 1IBMO 1N33O 1Y6XA 1VQ4V 3STZC 3FYIB 2YXHA 1X59A 5J2UA 4FJCC 4AILC 2K9PA 2EJRA 2UXBB 4YJ3B 5KHIA 1WLEA 1B06A 4EFBA 4B3TO 4DV2B 2C2AA 3ZX6A 1OCCB 2YEVA 1G6UA 1XMQO 4GKJB 2X6CA 2LO1A 3WG7C 3BY6A 1PM9A 2UUCB 4JI4O 1SERA 1P7BA 2GBOA 5IYZB 1US6A 4JI1B 2LJ2A 3K5MA 2Q0AA 4PDVA 3ZBHA 2WLNA 2AGAA 3OMAB 1YI2V 4WFFA 3EFFK 2H8PC 4HAMA 4J7ZA 2QJ1A 4DRXB 2A79B 2YC0A 1SESA 5LL6Y 1XNRB 4D6TH 2IBZH 4FM1A 4K0KB 3T1YB 2E74B 4X65B 4B3SO 1F23A 1YF2A 1H2KA 2WLIB 4WBNA 3BA8A 5KHKA 5EIBC 2F1MA 3A0BZ 3T1YO 3RN4A 5EZYB 5LMNO 3VBBA 1K7DA 1V55C 4P9OA 2FKXA 4OPHA 3SYOA 5KUMA 5A9GA 4W4KA 1GN6A 3B8NA 2QR4A 1JA8A 5CBFA 4PDMA 1DGSA 2H94A 4Z1MG 3CC7V 4DV2O 5KAIZ 2R72A 5IE9A 2EJ7A 4ZIBA 4TUYB 1SQGA 3SPGA 4UCVA 4H37A 4G28B 3CSXA 3OUFA 3HKCB 5LMUB 5CB4A 2B5UA 2YICA 1R3IC 1X4TA 4F6RB 4LF7O 3OE7G 1OCZC 2OYQA 2XASA 1D5AA 1TGOA 3W7XA 1M57B 4MTFA 2HKOA 2CTQA 2DW4A 3OW2U 4TSFG 5JCOC 4MVUA 1NT2B 1HP8A 4JZGA 1EFRG 5F2VO 1JOYA 3WG7B 4AI8A 2OTJV 3P3PA 2P67A 2E75B 3SJCC 2ZR2A 2OCHA 2V4DA 1XOUA 1FPOA 1JMKC 5KHJA 5JQGA 4GX0A 2QTOA 2ZM6B 2B9ZA 4E2LA 3ETEA 2PYJA 2R70A 1K73W 2BOBC 4NTWA 1J5EO 4DV6O 1ZX3A 1VMGA 1I7FA 1Y67A 2PF4E 4JI3O 2UXXA 1ZTEA 4PELA 3SJQC 1VIBA 2PZSA 1FXVA 4ZI7B 3BA9A 2FYUH 4H13B 3FX7A 1JFFB 4LR3A 3QVNA 2Q4PA 4B3MO 2K1EA 4AQYB 1AR5A 3KCXA 4X1KA 3CJHB 1Q7YW 1HR0B 1KB9F 2UUAO 3STLC 1QLEC 2ZE7A 5H2FZ 3CPWU 2VQFB 1BQZA 2QWPB 1RSOB 4H33A 5BR8O 5AG2A 3I56V 1S0VA 5H9CA 1N0NA 4F4LA 2YI8A 1SZXA 3C3TA 2R9RB 1YJWV 1JCHA 2PI4A 2GDSA 1AILA 1MOFA 1L1FA 2OT5A 4L87A 4J7JA 4O4HB 4LP8A 2EBOA 1XDCA 3CRAA 3JALB 3JD2A 1CEZA 4WCEV 1BGYH 4DV7O 4MVMA 3GWKC 1M1KW 1P49A 3BRCA 2ITDC 1KMIZ 4MS2A 1S77D 1VQOV 5KA6A 4TQFA 2W0FC 1M56B 5CA1A 2WLMA 3D36C 2AHZA 4YIPA 4IGGA 3TCUA 4DV3O 1N34B 1KKDA 3J81N 3R66A 4LF7B 4U7NA 5A2QN 3OUSA 1KC8W 4MVRA 3FFQA 4FPPA 3A8TA 1N36B 1GKFA 3CCRV 1TA8A 1WNSA 4N21A 4EKWA 5EYPB 4DR5B 3APQA 1IXBA 2DOSA 2F66C 5ITZB 3MD0A 3OD4A 5EC1C 3P30A 2HHHB 4LC1A 4MVOA 1UFIA 3ETGA 5JVDB 3VQXA 4IYIA 1F4NA 3L75H 4A5UB 4LH6A 1ZL8A 4X89A 4YJ2A 2BCCH 4NXNB 1NJIW 1WJZA 1Q86W 1FFXB 1QR9A 2RMKB 4I0XB 4JAUA 4X1KB 5LMNB 1MMMA 1L0NH 5IYDO 3T4ZA 5LP6A 5KAFZ 1L8DA 1B04A 1MSWD 4BR6A 1ZUQA 3FB5C 4GUNA 1G4YB 3CRRA 2Y4UA 4MTXA 5IY5B 3JD4A 1FXHA 1EN6A 4DR7O 2ZCEA 2XUMA 4LF5B 2Q5ZA 2QM4A 1AJQA 2IU3A 4RWUA 1XL6A 3N27A 3RYIB 1AP6A 5JVDA 3ABMB 1H2NA 2YIBD 5JJEB 4B3RB 3QF7A 2HVKC 3ETQA 3FKSG 2CGOA 1XREA 4GX2A 3JALA 1WP7A 4FZ1A 1IBLO 4DR2O 1Q5OA 2ZIMA 1N8RW 2V7QG 2WPDG 2EIKC 4O4JA 4HZ3A 4CS3A 3RBZA 1AROP 2Y4TA 3AG2B 2YXYA 1S76D 1JQ0A 4PDRA 1GN4A 3OR6C 4IYHA 1N33B 2ZE6A 1IBMB 1FXKB 4PA4A 1TVKB 3AK3A 3VQWA 4YIOA 1OCRB 5DN6G 4LF9O 2CGNA 1IJGA 1WAZA 3CEIA 3ASNC 1ORQC 1RPRA 1Q6UA 1Y66A 3LSSA 5CBHA 4GZRB 3TXQA 1S3JA 4NKGB 5IJ9B 4GKKO 1W0KG 2ZD9A 3UM7A 4DK0A 1SF9A 4JV5O 3ABKB 4MW3A 4KFMA 2A3QA 4C7UA 4X64B 4FM2A 1DK1A 3UO3A 3E83A 4B08A 4BIOA 3AG3B 1FXKA 3D3QA 4MSWC 1M9NA 4DV1O 5HFMA 2A0LA 1I5YA 2UUAB 4DV5B 1COWG 1NH2D 3J7AU 2HP8A 2VQEB 1LR1A 5J2UB 3CD6V 3FAVA 3H1IH 4LF4O 1EZVH 4MTOA 4DR1O 5DM6V 5FLXN 2DMXA 1Z2GA 3KZIZ 2P5OA 3K0GA 4P9PA 4XBFA 3KDRA 2W6JG 1QHTA 3TXSA 5KA5A 4O4LA 1GM9A 2X6AA 1YJ9V 5C8YA 4QJFB 2CTPA 4N23A 3ZMVA 4FLZA 4IT5A 3OMNB 1V54C 3S3XA 3QG5A 4I9WA 2WLIA 5D5PA 4WBNB 3ABUA 4G2KA 3CRCA 4W4LA 5BZBA 1TUBA 4GYCB 3VQVA 4DR3O 2XOKG 3OGIB 4CS4A 2B1IA 4LFAB 2IJKA 5LHGA 3ETDA 2JGDA 4L8JA 1YITV 1WA8A 3F7YC 4WFHA 3RYCB 1EBOA 2BTQA 4XDKA 3OFNG 3ZEDA 2WLLA 2ZINA 5CBGA 1R3KC 1NZ6A 3RYHB 1SA0B 2QWOB 2ZDIC 1KD1W 1QQCA 3CS5A 4IHJB 1WP8A 2WLHA 2LFRA 4BW9A 4UCUA 4NXMO 2ADQB 5IJ9A 1XNQB 2A7WA 4KP4A 2HG5C 2LP7A 4LFCO 2F4VB 3M7MX 1A32A 5FNVA 1RM1C 3LDCA 1K92A 1ZAUA 3OMIB 2RNBA 4NXMB 3RT3C 1XMOO 5B3SC 3DXRB 4ZBMA 3ZMZA 1YEWA 3CYOA 2DJVA 2H3OA 3ABLB 4TUYA 4LNUB 2IU0A 2JGUA 2JK5C 5IDJA 3HKCA 1FD9A 2YIBA 2WLLB 4LFAO 1MG1A 3QTCA 3OTFA 1BMFG 1XILA 2ZDIA 3ICXA 1EZJA 4IHJA 1BSMA 2DWDC 2XTAA 4F6EA 3ML0A 3A0RA 3SPJA 3PN1A 4KHPB 4GLXA 2F23A 1BHBA 1P84F 4ZOLB 4O4LB 2IH1C 4X66O 1R6KA 1MZFA 4LF5O 4JI8O 5IYBO 4P2ZA 1K4DC 1SQBH 4QE9A 2QE7G 1Q8IA 1PD3A 1LUWA 2QA4V 3E35A 1FAFA 3OT7A 1I08A 3CRMA 1AI7A 4YJ3A 1TUBB 4CBCA 2HJDA 4OXSA 3F5WC 2DE0X 1H8EG 3LUTB 3NXSA 2P4VA 5K1XA 5GONB 1Z5VA 4X66B 1XNRO 1YIJV 1VQMV 2VQEO 1Y74A 2EZOA 4WF9V 4NXNO 3B4SA 2RJZA 4G27B 3SYQA 5IYZA 5JH7B 1DTOA 3SYAA 2JRIA 3K03A 3BFRA 3PJSK 1BZKA 4X8AA 2VS0A 2YSUB 4ZKIA 5EK0A 3RYIA 2UUCO 1AJPA 3H01A 3UT5B 2HR3A 4JV5B 3WU2Z 1B6QA 1JFFA 3F7VC 2XAQA 4HNAA 3JSLA 1F4MA 2OIEA 1VQ5V 3AK1A 4GKKB 4UV8A 1MNGA 1EN4A 1YCIA 1H2MA 2B1GA 1VQPV 2P22C 1PPJH 3DXRA 3RW0A 1PNMA 1GN3A 1ROPA 2F4VO 4WFAV 3HKEA 1DF5A 3G4SV 4DO2A 3OAAG 4B7EA 4R8CA 4I55A 1YJNV 1BE3H 4XDJA 1IBKO 5LXTB 3ZHTA 2CUGA 1I94B 2QGNA 4JTCB 1N4CA 3JAWB 4FMTA 1AR4A 3HPLC 4YY3O 1I5XA 1NH2B 2MW2B 1AI6A 1XI1A 4DK1A 3TK1A 3CMEV 3FYEB 4JF3A 1XBLA 4EB6A 3L70H 1NQTA 4AHCA 4UCOA 3D3IA 2Q0OC 4LWSB 2BSKB 3E2EA 3CCSV 1QVGU 2EIMB 5LYJA 1YSCA 5IWAO 5LBQA 3UQ8A 4J9YB 2OCCB 5ITZA 3ZMUA 1HR0O 4I9QA 5LA6A 1VF5B 3BABA 2DYRC 2L35A 1MA1A 3ZHRA 3BAAA 3CE2A 4AQYO 4Z2WA 4B3MB 1AR1B 1V55B 3G67A 4I7ZB 2W6IG 2YDEA 4LH7A 1BCCH 2CTWA 3P3NA 3KKYA 5B1BC 2F43G 4NTXA 2LW7A 5EBLC 5J2TA 4D7SA 4PI0A 3UT5A 1PP9H 2X7RB 4X9QA 1EN5A 4H44B 1H38A 1FFTB 1U97A 3ZRXA 1ZL8B 5LGTA 3RGBA 4NVPA 3IC9A 1J5EB 5JCOA 1S72V 4LWSA 5B1OA 3ZMTA 3LSQA 2BSKA 3MHSC 3K79A 4D7TA 4MVSA 1NTKH 1FYJA 1SZTA 1H2SB 1VF7A 2HHHO 3T2MA 4LFBB 3JCZA 1K5QA 3CX5F 1N36O 4LF8O 4JI7B 5LGNA 3RVYA 1XMOB 2P7TC 3DSQA 3K04A 2OCCC 4O2BA 1IVSA 4Q6GA 1XL4A 1JPXA 4DW0A 1Q6IA 1GMGA 1M90W 3HKDB 1RP3B 1VQNV 5DECA 3RYHA 2WA3A 2HFEC 1THZA 4DRXA 4EB6B 1FKAO 5CN0A 2CK3G 3JARA 2GTAA 1NVPB 2WWWA 4JI7O 1K3EA 1PV0A 1VQKV 3O9OA 4JI5B 2WLJA 4CH4A 2QKAA 4LFBO 3B09A 2NLJC 4PA9A 1YHQV 3ASOB 3CRQA 3AG2C 1WB7A 2DYSC 3IAYA 4DR2B 1IBLB 5CMUA 1TVKA 5BR8B 4PJ0Z 3F5TA 3R65A 2VQFO 4NTYA 3CCLV 4JTDB 1GRJA 5LGUA 4U3JA 2LGQA 3MDSA 2GSMB 4O2AA 3ZHUA 2XAHA 3W7UA 2LW1A 2ZR3A 2UU9O 3JASA 2OWOA 3OGCC 3K57A 3A0HZ 2Q7GA 2YIDA 3CCJV 4FM0A 4JI0O 5FPRA 2XT9A 1OJHA 3C3SA 4J11A 2JVDA 1W0JG 3JYCA 3OM3B 1YDXA 4TV8B 2Q7HA 1GH6A 3HR0A 3O65A 5IWAB 2E5LB 1VQ8V 5EZYA 4RUFA 1YTFD 1I0HA 2CE4A 2ZT9B 1SQFA 1Q43A 3LDDA 1RPOA 4GKJO 1NVPD 2Y0IA 4JZ2A 4FLYA 1E1QG 2UXDB 2PI5A 5H5NA 1Q3EA 4U3JB 3APOA 3I55V 4YY3B 3E86A 3LSUA 3CCMV 4X62B 1I94O 4DR4O 5L3FA 2R9IA 4UCRA 2PUSA 4QE7A 1IBKB 2Y69C 4CS2A 1WA8B 4FLXA 5KUKA 1KBHA 2AZ0A 4KL1A 4GCZA 5CB4B 4JAVA 5B1BB 1GTOA 2ZE5A 5B1NA 4J42A 2XAGA 4CZZA 4DV7B 3ASOC 4X1YB 3HKEB 5LMUO 1AJNA 4FK5C 1WPBA 2ITCC 4I55B 4CC6A 3E89A 5IT9N 1RM1B 1IZ3A 3ZRWA 5FPOA 3CXHF 5FNVB 3L9DA 3HKBB 4WFBV 3AG4B 2ZE8A 4MTGA 1QR8A 3E8GA 2IJHA 3BVOA 2YS8A 1HNZO 4ICGA 3ZHVA 5JWPA 5HFLA 2E76B 1F51A 3ASNB 4PA6A 2EILC 1VARA 2XHBA 4WFEA 4B3RO 4PV1B 3WB0A 2W0XA 2QDOA 2D3OW 2DN9A 2VWKA 1OZ0A 1QVFU 1VQ9V 1OCZB 2WAMA 4K8XA 3JAMN 5EBWC 1AP5A 3FD9A 4R7CA 2Q9LA 1SQPH 2ZXWB 1N0JA 1P7GA 1ZLZA 3AEIA 3Q4HB 3CP1A 2XNDG 4X65O 4B3SB 1YXBA 4J7KA 4DUZB 3ZN1A 1BQ0A 4BW5A 2DQ3A 3SDLA 3OEEG 1R3LC 1H2LA 3AG1C 4WFGA 3KCYA 1BT8A 3AK2A 3CJHA 4NB5A 1HDJA 2GUZB 4NYKA 4JI1O 1NKDA 3UKMA 3T1HO 4LBEC 2FTKA 2JDIG 3DTUB 2M6YA 1JJOA 4BIUA 4UFZA 4B3TB 1PL0A 3OEHG 4XDLA 5EYPA 4JGSA 1R3JC 4MVZA 2UXBO 2ADPA 4K35A 1NR1A 3JCUZ 4PDLA 3K06A 3Q4HA 1OCOC 4FLVA 2DYRB 2CTRA 4BWAA 4X1YA 2XAJA 1FXKC 2VWJA 4X88A 3SJBC 1SC5B 3ZCCA 1NTMH 1SQVH 1Y74B 2HLDG 3K5LA 1RFYA 2IM9A 1IURA 2LGWA 4P30A 3IFXA 1JJ2U 1H5WA 1KYOF 1MZEA 1Y76A 3QO7A 4NR1A 1G1XB 4OGQB 3H1JH 1IXMA 3GB7C 2GV9A 3E8FA 5IY5C 2JJ2G 3EHBB 3H9VA 2PYLA 1JVMA 4JTAB 1GN2A 3M99B 4HNAB 3ZS8C 1YTFB 1DF4A 3SPCA 4FLTA 3DGEA 3RYFB 3DC6A 4DR3B 1WN7A 4PI2A 2IW5A 4X20A 5BMVA 1K34A 2N74A 1Q90D 2VRZA 3CCQV 2QEXV 2CH7B 2IJJA 4UB6Z 1K4CC 1E1RG 3N2GA 4TQDA 1HWYA 3JSNA 2Q68A 3OTOO 4JASA 1PNKA 1VF6A 1L0LH 2Q73A 4JAAA 1ENVA 3ZHQA 3H1LH 1QNMA 2FL4A 5BY1A 1LUVA 2P4KA 4IL6Z 4Z1VA 2QM8A 3ABMC 1GAXA 1ZWIC 5L3GA 4MT8A 1CP9A 3IGAC 2PTMA 4JYCA 4UUJC 4CH6A 4J80A 3GVMA 2YIAA 4UV9A 2RDCA 4B7KA 2DWEC 5BMVB 1KU9A 4DV6B 3BCCH 5LA6B 1HNZB 3L73H 2EULA 4OX9B 5J2TB 4O4HA 1XMQB 2EZPA 2RQ6A 4TV8A 2ZM6O 1TAEA 4PD4F 1CPYA 3EXAA 3IC7A 5LHIA 2YEVB 2Y0PA 1HNWB 1VQ6V 5H6RA 1XEQA 2IJIA 3ZRSA 4PHZA 2Q6AA 4UCSA 2HEPA 1GO3F 4LF9B 1URFA 1K9MW 4DV0O 3CXCU 5C93A 3UO2A 2DQ0A 4J9ZB 5JH7A 2EIMC 4DR4B 1VF6C 1NTZH 3G6BA 1LNQA 3FAVB 4X1IB 4I4TA 4ASUG 2M7WA 1NU1H 4JYYA 1PL4A 2ZNJA 1PKXA 2JEUA 4E4EA 4RQFA 2QSAA 1NBMG 2RN9A 3CMAV 3T4DA 3SGIA 5KX5B 3LNNA 5FL7G 2WA4A 3ZRVA 4O2BB 4PA7A 2E5LO 1NS1A 3FB8C 5KMGB 3SYCA 4MVQA 3RVZA 1QU7A 1O9HA 5E79Z 2XAFA 4JI0B 5CA0B 1OCCC 3JARB 2EINC 4RUEA 4TV9A 4DR7B 4JI6B 2UU9B 2JGDB 3JAWA 2YXLA 2Z3YA 2JS5A 2Q7EA 2V1DA 3B8MA 5K1PA 1XHXA 1OHHG 1T5EA 3N2KB 3QO8A 3WB2A 4ZHQB 1GM7A 2AW9A 1W59A 1QLNA 2NN4A 2Q8VA 1AI4A 4K0KO 2AZ2A 4JI8B 3B40A 3W7SA 2BTOA 2A9HA 3FB7C 4KHPO 1AI5A 4FFBA
chains in the Genus database with same CATH topology
1EN5A 3MDSA 1JA8A 1MMMA 3IC9A 3AK1A 4C7UA 1VARA 1XUQA 1MNGA 4BR6A 1GN2A 1ZUQA 4GUNA 1EN4A 2CDYA 1GN3A 1EN6A 5AG2A 1N0NA 1EM1A 3C3SA 1KKCA 1SZXA 3DC6A 4FFKA 1AP5A 3C3TA 1VEWA 1N0JA 1B06A 1P7GA 1AP6A 1ZLZA 2GDSA 3DC5A 1IDSA 1I0HA 2CE4A 4JYYA 1IX9A 1XILA 1XDCA 1PL4A 1AR4A 1XREA 4E4EA 1PM9A 3TJTA 4JZ2A 1BSMA 4F6EA 3KDRA 4JZGA 1QNMA 1D5NA 3LSUA 1BT8A 3AK2A 1LUVA 2P4KA 1LUWA 4YIPA 3OT7A 1I08A 1GN4A 1AVMA 2QKAA 3AK3A 4YIOA 1Y67A 1MA1A 1JR9A 1WB7A 2ADPA 1IXBA 3RN4A 3K9SA 1ZTEA 2RCVA 3CEIA 2AW9A 1ZSPA 3EVKA 3BFRA 1WB8A 3KKYA 2QKCA 1BS3A 5A9GA 3QVNA 1AR5A 1GN6A 1MSDA 2ADQB 4X9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EN5 A;  3MDS A;  1JA8 A;  1MMM A;  3IC9 A;  3AK1 A;  4C7U A;  1VAR A;  1XUQ A;  1MNG A;  4BR6 A;  1GN2 A;  1ZUQ A;  4GUN A;  1EN4 A;  2CDY A;  1GN3 A;  1EN6 A;  5AG2 A;  1N0N A;  1EM1 A;  3C3S A;  1KKC A;  1SZX A;  3DC6 A;  4FFK A;  1AP5 A;  3C3T A;  1VEW A;  1N0J A;  1B06 A;  1P7G A;  1AP6 A;  1ZLZ A;  2GDS A;  3DC5 A;  1IDS A;  1I0H A;  2CE4 A;  4JYY A;  1IX9 A;  1XIL A;  1XDC A;  1PL4 A;  1AR4 A;  1XRE A;  4E4E A;  1PM9 A;  3TJT A;  4JZ2 A;  1BSM A;  4F6E A;  4JZG A;  1QNM A;  1D5N A;  3LSU A;  1BT8 A;  3AK2 A;  1LUV A;  2P4K A;  1LUW A;  4YIP A;  3OT7 A;  1I08 A;  1GN4 A;  1AVM A;  2QKA A;  3AK3 A;  4YIO A;  1Y67 A;  1MA1 A;  1JR9 A;  1WB7 A;  2ADP A;  1IXB A;  3RN4 A;  3K9S A;  1ZTE A;  2RCV A;  3CEI A;  2AW9 A;  1ZSP A;  3EVK A;  3BFR A;  1WB8 A;  3KKY A;  2QKC A;  1BS3 A;  5A9G A;  3QVN A;  1AR5 A;  1GN6 A;  1MSD A;  2ADQ B;  4X9Q A; 
#chains in the Genus database with same CATH topology
 4FZ0 A;  2UUB O;  1QCE A;  1FJG B;  2FB5 A;  4QGP A;  4I0X A;  2FML A;  2PY5 A;  3G71 V;  1WPX A;  4DUY B;  2F93 B;  5KHG A;  4FLW A;  1K97 A;  4O2A B;  5GW7 A;  4JI5 O;  4RO2 A;  3ABT A;  3AG3 C;  5JQG B;  3JAS B;  2JIZ G;  5JJJ B;  3L74 H;  1W2B U;  4UCT A;  1J95 A;  4KXR A;  4LCU C;  3CC4 V;  3M8A A;  1HW7 A;  4UVC A;  2KG7 A;  1Z5W A;  3WB1 A;  2PGG A;  4X1I A;  4MW8 A;  4J10 A;  1SA0 A;  2JJ1 G;  1XQ8 A;  1XNQ O;  1HNX O;  4GT1 A;  5LOV A;  3K0D A;  4QPK A;  4CC5 A;  3L72 H;  1JNB A;  4QNH B;  4ABM A;  2QWR B;  1U96 A;  1N32 O;  3P32 A;  2L6L A;  4GX1 A;  3MHH C;  3SPH A;  4DUY O;  1SRY A;  4H0L B;  3T1H B;  4I50 A;  4EEQ A;  1FJG O;  3JAK A;  2UXC B;  2QTS A;  1K33 A;  4JI2 O;  2O57 A;  3HKB A;  1P4R A;  1SQX H;  4U3F H;  3HKD A;  2YUA A;  3K59 A;  2D2C B;  2QWN B;  5GTH Z;  2ZQM A;  3CC2 V;  3S3W A;  3SYP A;  4FFB B;  4LF6 O;  3G6E V;  2GTS A;  4TT3 G;  1GM8 A;  3I5D A;  3N2G B;  4UB8 Z;  1QBZ A;  4YHH B;  2P6J A;  5BXZ A;  3TGU H;  3HB3 B;  1GK9 A;  5B1A C;  2DYS B;  1XUQ A;  3THO A;  1F7Y A;  4JI3 B;  4UVA A;  3ABK C;  2CDY A;  4DV1 B;  4I50 B;  3W7W A;  2OTL V;  1JX9 A;  4PA3 A;  4DV4 B;  2X6B A;  2UXN A;  2UXC O;  4FFK A;  2LFS A;  4FVM A;  1VEW A;  2BTQ B;  1M4U A;  3CHX A;  1UJW B;  4F6R A;  4K8Z A;  2OIG A;  1TUE B;  3BHP A;  4FIP C;  3TJT A;  1YZB A;  3BEH A;  1NI8 A;  3WFV A;  3NR7 A;  1XHZ A;  5EBM C;  1S5J A;  2N05 A;  4YJ2 B;  3CWB H;  3U0Z A;  4BAY A;  2MK3 A;  4DV0 B;  2G38 A;  1HNX B;  4BIZ A;  4QPJ A;  4KUM A;  2WLK A;  2HJF C;  3A2F A;  3B2E E;  4HBN A;  3AG1 B;  2ZNI A;  4I5S A;  2GUZ A;  2ETN A;  1R1B A;  4X62 O;  4ZI7 A;  2KKW A;  3B77 A;  3E22 B;  3JAK B;  2JEX A;  4JYA B;  2AXT Z;  1OV9 A;  2UXD O;  3EVK A;  4CH3 A;  1FS0 G;  2ZXW C;  5D5Q A;  3BPZ A;  2ZKO A;  1BS3 A;  2P90 A;  5EIB D;  1R6T A;  3QO5 A;  4OX9 O;  3ABL C;  3H1H H;  4JYB A;  3LNM B;  4DW1 A;  3VQY A;  2CAZ C;  3L71 H;  5JJN B;  3CB2 A;  3JAT A;  2EIK B;  1RSO A;  1H8H G;  1MAB G;  1UPG A;  3K9A A;  2X0L A;  3RYF A;  3CCE V;  2AHY A;  3CCV V;  2IH3 C;  1S5H C;  4QIW F;  5GON A;  4IIJ B;  5B66 Z;  4R50 A;  1G8M A;  2EIJ C;  2CH7 A;  5B3S B;  4LF6 B;  3E8B A;  3VOU A;  2QM7 A;  4LNU A;  1VP7 A;  1M57 C;  5CA0 A;  1KP3 A;  4JPR A;  5IJ0 B;  3ZMS A;  3DC5 A;  3X2Q C;  5EC2 C;  1S5L Z;  2WSS G;  5B1A B;  5IYC O;  3SJA C;  4X20 B;  1R73 A;  1V54 B;  1D2D A;  1O9G A;  5CA1 B;  1Y4M A;  4ZHQ A;  3LDE A;  2EIN B;  2P06 A;  1VQL V;  1H2G A;  3CCU V;  4ZOL A;  1KEC A;  1Q6H A;  4JI4 B;  2Z0A A;  2Z5U A;  3K3W A;  1E79 G;  1QLE B;  1KP2 A;  1N32 B;  3ZJZ A;  3MAQ A;  4DR5 O;  3SPI A;  4RAI A;  2ZIO A;  3G80 A;  4IIJ A;  3T1C A;  4JYA O;  3SR2 C;  2YI9 A;  1K5S A;  1FOU A;  1JR9 A;  4HYO A;  3E22 A;  3FB6 C;  5GTI Z;  4RQE A;  5IJ0 A;  5LXT A;  1M5I A;  3K9S A;  4DV3 B;  2Y69 B;  1N34 O;  2KQX A;  2NNU A;  1ZSP A;  2N04 A;  4LFC B;  1WB8 A;  2KB1 A;  5L3C A;  5J9P C;  2NR5 A;  1K8A W;  2KG7 B;  5LP6 C;  1MSD A;  4LF8 B;  1BHA A;  5LHH A;  4DXW A;  5LP6 B;  2EX3 A;  4FLU A;  3IJ4 A;  2EIJ B;  3JD3 A;  1M56 C;  2R9A A;  2GHY A;  1HNW O;  4R6Z A;  4TWK A;  5L3D A;  1M93 A;  5LOV B;  3JD0 A;  3JAT B;  4TOI A;  1FFX A;  5H6Q A;  2BE3 A;  3ZIA G;  2HVJ C;  5C8Y B;  1YVW A;  4DR6 O;  5B5E Z;  4EFE A;  5TIS Z;  1SQQ H;  1V9P A;  3D36 A;  5L3B A;  2UUB B;  4O4I B;  1EM1 A;  4DV4 O;  1KKC A;  1BL8 A;  3UCS C;  3OR7 C;  4DYL A;  1R6N A;  3D8C A;  1IDS A;  4DUZ O;  1Y76 B;  3RWR D;  2ARH A;  1IX9 A;  2E3C A;  4YXW G;  4O4J B;  3RYC A;  1SKV A;  1Q82 W;  5KLV H;  4YHH O;  1SET A;  3U11 A;  3K5N A;  4I4T B;  4JI6 O;  5KMG A;  4DR1 B;  4Q20 A;  4LF4 B;  2BOC C;  2KSD A;  1CXZ B;  1D5N A;  3JD1 A;  3K5O A;  2EIL B;  3KG2 A;  5KX5 A;  4TV9 B;  3OTO B;  2F95 B;  3X2Q B;  1SS3 A;  1OCR C;  4DV5 O;  3W7T A;  5LYJ B;  3AG7 A;  1AVM A;  2Q69 A;  3U10 A;  4J41 A;  3AG4 C;  3J80 N;  4JI2 B;  5KHH A;  1VQ7 V;  1Q81 W;  4GX5 A;  4O4I A;  3N2K A;  3RFR A;  3E8H A;  5DED A;  4X64 O;  3K58 A;  3TET A;  4OPA A;  1PNL A;  1NR7 A;  1KQS U;  1OCO B;  4DR6 B;  2ATK C;  5E1A C;  2RCV A;  1KUQ A;  4CH5 A;  3ZRW B;  5L3E A;  2QKS A;  2QKC A;  2LQT A;  3ZHS A;  2QWQ B;  1DLB A;  2Q67 A;  3GWO A;  2ILM A;  1B3Q A;  3C90 A;  2Y48 A;  2A06 H;  1AB3 A;  4UXN A;  3QNE A;  3K08 A;  3H1K H;  4UVB A;  4K3A A;  3ZN0 A;  5CA3 A;  4U7O A;  2ODM A;  2JS3 A;  1IBM O;  1N33 O;  1Y6X A;  1VQ4 V;  3STZ C;  3FYI B;  2YXH A;  1X59 A;  5J2U A;  4FJC C;  4AIL C;  2K9P A;  2EJR A;  2UXB B;  4YJ3 B;  5KHI A;  1WLE A;  1B06 A;  4EFB A;  4B3T O;  4DV2 B;  2C2A A;  3ZX6 A;  1OCC B;  2YEV A;  1G6U A;  1XMQ O;  4GKJ B;  2X6C A;  2LO1 A;  3WG7 C;  3BY6 A;  1PM9 A;  2UUC B;  4JI4 O;  1SER A;  1P7B A;  2GBO A;  5IYZ B;  1US6 A;  4JI1 B;  2LJ2 A;  3K5M A;  2Q0A A;  4PDV A;  3ZBH A;  2WLN A;  2AGA A;  3OMA B;  1YI2 V;  4WFF A;  3EFF K;  2H8P C;  4HAM A;  4J7Z A;  2QJ1 A;  4DRX B;  2A79 B;  2YC0 A;  1SES A;  5LL6 Y;  1XNR B;  4D6T H;  2IBZ H;  4FM1 A;  4K0K B;  3T1Y B;  2E74 B;  4X65 B;  4B3S O;  1F23 A;  1YF2 A;  1H2K A;  2WLI B;  4WBN A;  3BA8 A;  5KHK A;  5EIB C;  2F1M A;  3A0B Z;  3T1Y O;  3RN4 A;  5EZY B;  5LMN O;  3VBB A;  1K7D A;  1V55 C;  4P9O A;  2FKX A;  4OPH A;  3SYO A;  5KUM A;  5A9G A;  4W4K A;  1GN6 A;  3B8N A;  2QR4 A;  1JA8 A;  5CBF A;  4PDM A;  1DGS A;  2H94 A;  4Z1M G;  3CC7 V;  4DV2 O;  5KAI Z;  2R72 A;  5IE9 A;  2EJ7 A;  4ZIB A;  4TUY B;  1SQG A;  3SPG A;  4UCV A;  4H37 A;  4G28 B;  3CSX A;  3OUF A;  3HKC B;  5LMU B;  5CB4 A;  2B5U A;  2YIC A;  1R3I C;  1X4T A;  4F6R B;  4LF7 O;  3OE7 G;  1OCZ C;  2OYQ A;  2XAS A;  1D5A A;  1TGO A;  3W7X A;  1M57 B;  4MTF A;  2HKO A;  2CTQ A;  2DW4 A;  3OW2 U;  4TSF G;  5JCO C;  4MVU A;  1NT2 B;  1HP8 A;  4JZG A;  1EFR G;  5F2V O;  1JOY A;  3WG7 B;  4AI8 A;  2OTJ V;  3P3P A;  2P67 A;  2E75 B;  3SJC C;  2ZR2 A;  2OCH A;  2V4D A;  1XOU A;  1FPO A;  1JMK C;  5KHJ A;  5JQG A;  4GX0 A;  2QTO A;  2ZM6 B;  2B9Z A;  4E2L A;  3ETE A;  2PYJ A;  2R70 A;  1K73 W;  2BOB C;  4NTW A;  1J5E O;  4DV6 O;  1ZX3 A;  1VMG A;  1I7F A;  1Y67 A;  2PF4 E;  4JI3 O;  2UXX A;  1ZTE A;  4PEL A;  3SJQ C;  1VIB A;  2PZS A;  1FXV A;  4ZI7 B;  3BA9 A;  2FYU H;  4H13 B;  3FX7 A;  1JFF B;  4LR3 A;  3QVN A;  2Q4P A;  4B3M O;  2K1E A;  4AQY B;  1AR5 A;  3KCX A;  4X1K A;  3CJH B;  1Q7Y W;  1HR0 B;  1KB9 F;  2UUA O;  3STL C;  1QLE C;  2ZE7 A;  5H2F Z;  3CPW U;  2VQF B;  1BQZ A;  2QWP B;  1RSO B;  4H33 A;  5BR8 O;  5AG2 A;  3I56 V;  1S0V A;  5H9C A;  1N0N A;  4F4L A;  2YI8 A;  1SZX A;  3C3T A;  2R9R B;  1YJW V;  1JCH A;  2PI4 A;  2GDS A;  1AIL A;  1MOF A;  1L1F A;  2OT5 A;  4L87 A;  4J7J A;  4O4H B;  4LP8 A;  2EBO A;  1XDC A;  3CRA A;  3JAL B;  3JD2 A;  1CEZ A;  4WCE V;  1BGY H;  4DV7 O;  4MVM A;  3GWK C;  1M1K W;  1P49 A;  3BRC A;  2ITD C;  1KMI Z;  4MS2 A;  1S77 D;  1VQO V;  5KA6 A;  4TQF A;  2W0F C;  1M56 B;  5CA1 A;  2WLM A;  3D36 C;  2AHZ A;  4YIP A;  4IGG A;  3TCU A;  4DV3 O;  1N34 B;  1KKD A;  3J81 N;  3R66 A;  4LF7 B;  4U7N A;  5A2Q N;  3OUS A;  1KC8 W;  4MVR A;  3FFQ A;  4FPP A;  3A8T A;  1N36 B;  1GKF A;  3CCR V;  1TA8 A;  1WNS A;  4N21 A;  4EKW A;  5EYP B;  4DR5 B;  3APQ A;  1IXB A;  2DOS A;  2F66 C;  5ITZ B;  3MD0 A;  3OD4 A;  5EC1 C;  3P30 A;  2HHH B;  4LC1 A;  4MVO A;  1UFI A;  3ETG A;  5JVD B;  3VQX A;  4IYI A;  1F4N A;  3L75 H;  4A5U B;  4LH6 A;  1ZL8 A;  4X89 A;  4YJ2 A;  2BCC H;  4NXN B;  1NJI W;  1WJZ A;  1Q86 W;  1FFX B;  1QR9 A;  2RMK B;  4I0X B;  4JAU A;  4X1K B;  5LMN B;  1MMM A;  1L0N H;  5IYD O;  3T4Z A;  5LP6 A;  5KAF Z;  1L8D A;  1B04 A;  1MSW D;  4BR6 A;  1ZUQ A;  3FB5 C;  4GUN A;  1G4Y B;  3CRR A;  2Y4U A;  4MTX A;  5IY5 B;  3JD4 A;  1FXH A;  1EN6 A;  4DR7 O;  2ZCE A;  2XUM A;  4LF5 B;  2Q5Z A;  2QM4 A;  1AJQ A;  2IU3 A;  4RWU A;  1XL6 A;  3N27 A;  3RYI B;  1AP6 A;  5JVD A;  3ABM B;  1H2N A;  2YIB D;  5JJE B;  4B3R B;  3QF7 A;  2HVK C;  3ETQ A;  3FKS G;  2CGO A;  1XRE A;  4GX2 A;  3JAL A;  1WP7 A;  4FZ1 A;  1IBL O;  4DR2 O;  1Q5O A;  2ZIM A;  1N8R W;  2V7Q G;  2WPD G;  2EIK C;  4O4J A;  4HZ3 A;  4CS3 A;  3RBZ A;  1ARO P;  2Y4T A;  3AG2 B;  2YXY A;  1S76 D;  1JQ0 A;  4PDR A;  1GN4 A;  3OR6 C;  4IYH A;  1N33 B;  2ZE6 A;  1IBM B;  1FXK B;  4PA4 A;  1TVK B;  3AK3 A;  3VQW A;  4YIO A;  1OCR B;  5DN6 G;  4LF9 O;  2CGN A;  1IJG A;  1WAZ A;  3CEI A;  3ASN C;  1ORQ C;  1RPR A;  1Q6U A;  1Y66 A;  3LSS A;  5CBH A;  4GZR B;  3TXQ A;  1S3J A;  4NKG B;  5IJ9 B;  4GKK O;  1W0K G;  2ZD9 A;  3UM7 A;  4DK0 A;  1SF9 A;  4JV5 O;  3ABK B;  4MW3 A;  4KFM A;  2A3Q A;  4C7U A;  4X64 B;  4FM2 A;  1DK1 A;  3UO3 A;  3E83 A;  4B08 A;  4BIO A;  3AG3 B;  1FXK A;  3D3Q A;  4MSW C;  1M9N A;  4DV1 O;  5HFM A;  2A0L A;  1I5Y A;  2UUA B;  4DV5 B;  1COW G;  1NH2 D;  3J7A U;  2HP8 A;  2VQE B;  1LR1 A;  5J2U B;  3CD6 V;  3FAV A;  3H1I H;  4LF4 O;  1EZV H;  4MTO A;  4DR1 O;  5DM6 V;  5FLX N;  2DMX A;  1Z2G A;  3KZI Z;  2P5O A;  3K0G A;  4P9P A;  4XBF A;  3KDR A;  2W6J G;  1QHT A;  3TXS A;  5KA5 A;  4O4L A;  1GM9 A;  2X6A A;  1YJ9 V;  5C8Y A;  4QJF B;  2CTP A;  4N23 A;  3ZMV A;  4FLZ A;  4IT5 A;  3OMN B;  1V54 C;  3S3X A;  3QG5 A;  4I9W A;  2WLI A;  5D5P A;  4WBN B;  3ABU A;  4G2K A;  3CRC A;  4W4L A;  5BZB A;  1TUB A;  4GYC B;  3VQV A;  4DR3 O;  2XOK G;  3OGI B;  4CS4 A;  2B1I A;  4LFA B;  2IJK A;  5LHG A;  3ETD A;  2JGD A;  4L8J A;  1YIT V;  1WA8 A;  3F7Y C;  4WFH A;  3RYC B;  1EBO A;  2BTQ A;  4XDK A;  3OFN G;  3ZED A;  2WLL A;  2ZIN A;  5CBG A;  1R3K C;  1NZ6 A;  3RYH B;  1SA0 B;  2QWO B;  2ZDI C;  1KD1 W;  1QQC A;  3CS5 A;  4IHJ B;  1WP8 A;  2WLH A;  2LFR A;  4BW9 A;  4UCU A;  4NXM O;  2ADQ B;  5IJ9 A;  1XNQ B;  2A7W A;  4KP4 A;  2HG5 C;  2LP7 A;  4LFC O;  2F4V B;  3M7M X;  1A32 A;  5FNV A;  1RM1 C;  3LDC A;  1K92 A;  1ZAU A;  3OMI B;  2RNB A;  4NXM B;  3RT3 C;  1XMO O;  5B3S C;  3DXR B;  4ZBM A;  3ZMZ A;  1YEW A;  3CYO A;  2DJV A;  2H3O A;  3ABL B;  4TUY A;  4LNU B;  2IU0 A;  2JGU A;  2JK5 C;  5IDJ A;  3HKC A;  1FD9 A;  2YIB A;  2WLL B;  4LFA O;  1MG1 A;  3QTC A;  3OTF A;  1BMF G;  1XIL A;  2ZDI A;  3ICX A;  1EZJ A;  4IHJ A;  1BSM A;  2DWD C;  2XTA A;  4F6E A;  3ML0 A;  3A0R A;  3SPJ A;  3PN1 A;  4KHP B;  4GLX A;  2F23 A;  1BHB A;  1P84 F;  4ZOL B;  4O4L B;  2IH1 C;  4X66 O;  1R6K A;  1MZF A;  4LF5 O;  4JI8 O;  5IYB O;  4P2Z A;  1K4D C;  1SQB H;  4QE9 A;  2QE7 G;  1Q8I A;  1PD3 A;  1LUW A;  2QA4 V;  3E35 A;  1FAF A;  3OT7 A;  1I08 A;  3CRM A;  1AI7 A;  4YJ3 A;  1TUB B;  4CBC A;  2HJD A;  4OXS A;  3F5W C;  2DE0 X;  1H8E G;  3LUT B;  3NXS A;  2P4V A;  5K1X A;  5GON B;  1Z5V A;  4X66 B;  1XNR O;  1YIJ V;  1VQM V;  2VQE O;  1Y74 A;  2EZO A;  4WF9 V;  4NXN O;  3B4S A;  2RJZ A;  4G27 B;  3SYQ A;  5IYZ A;  5JH7 B;  1DTO A;  3SYA A;  2JRI A;  3K03 A;  3BFR A;  3PJS K;  1BZK A;  4X8A A;  2VS0 A;  2YSU B;  4ZKI A;  5EK0 A;  3RYI A;  2UUC O;  1AJP A;  3H01 A;  3UT5 B;  2HR3 A;  4JV5 B;  3WU2 Z;  1B6Q A;  1JFF A;  3F7V C;  2XAQ A;  4HNA A;  3JSL A;  1F4M A;  2OIE A;  1VQ5 V;  3AK1 A;  4GKK B;  4UV8 A;  1MNG A;  1EN4 A;  1YCI A;  1H2M A;  2B1G A;  1VQP V;  2P22 C;  1PPJ H;  3DXR A;  3RW0 A;  1PNM A;  1GN3 A;  1ROP A;  2F4V O;  4WFA V;  3HKE A;  1DF5 A;  3G4S V;  4DO2 A;  3OAA G;  4B7E A;  4R8C A;  4I55 A;  1YJN V;  1BE3 H;  4XDJ A;  1IBK O;  5LXT B;  3ZHT A;  2CUG A;  1I94 B;  2QGN A;  4JTC B;  1N4C A;  3JAW B;  4FMT A;  1AR4 A;  3HPL C;  4YY3 O;  1I5X A;  1NH2 B;  2MW2 B;  1AI6 A;  1XI1 A;  4DK1 A;  3TK1 A;  3CME V;  3FYE B;  4JF3 A;  1XBL A;  4EB6 A;  3L70 H;  1NQT A;  4AHC A;  4UCO A;  3D3I A;  2Q0O C;  4LWS B;  2BSK B;  3E2E A;  3CCS V;  1QVG U;  2EIM B;  5LYJ A;  1YSC A;  5IWA O;  5LBQ A;  3UQ8 A;  4J9Y B;  2OCC B;  5ITZ A;  3ZMU A;  1HR0 O;  4I9Q A;  5LA6 A;  1VF5 B;  3BAB A;  2DYR C;  2L35 A;  1MA1 A;  3ZHR A;  3BAA A;  3CE2 A;  4AQY O;  4Z2W A;  4B3M B;  1AR1 B;  1V55 B;  3G67 A;  4I7Z B;  2W6I G;  2YDE A;  4LH7 A;  1BCC H;  2CTW A;  3P3N A;  3KKY A;  5B1B C;  2F43 G;  4NTX A;  2LW7 A;  5EBL C;  5J2T A;  4D7S A;  4PI0 A;  3UT5 A;  1PP9 H;  2X7R B;  4X9Q A;  1EN5 A;  4H44 B;  1H38 A;  1FFT B;  1U97 A;  3ZRX A;  1ZL8 B;  5LGT A;  3RGB A;  4NVP A;  3IC9 A;  1J5E B;  5JCO A;  1S72 V;  4LWS A;  5B1O A;  3ZMT A;  3LSQ A;  2BSK A;  3MHS C;  3K79 A;  4D7T A;  4MVS A;  1NTK H;  1FYJ A;  1SZT A;  1H2S B;  1VF7 A;  2HHH O;  3T2M A;  4LFB B;  3JCZ A;  1K5Q A;  3CX5 F;  1N36 O;  4LF8 O;  4JI7 B;  5LGN A;  3RVY A;  1XMO B;  2P7T C;  3DSQ A;  3K04 A;  2OCC C;  4O2B A;  1IVS A;  4Q6G A;  1XL4 A;  1JPX A;  4DW0 A;  1Q6I A;  1GMG A;  1M90 W;  3HKD B;  1RP3 B;  1VQN V;  5DEC A;  3RYH A;  2WA3 A;  2HFE C;  1THZ A;  4DRX A;  4EB6 B;  1FKA O;  5CN0 A;  2CK3 G;  3JAR A;  2GTA A;  1NVP B;  2WWW A;  4JI7 O;  1K3E A;  1PV0 A;  1VQK V;  3O9O A;  4JI5 B;  2WLJ A;  4CH4 A;  2QKA A;  4LFB O;  3B09 A;  2NLJ C;  4PA9 A;  1YHQ V;  3ASO B;  3CRQ A;  3AG2 C;  1WB7 A;  2DYS C;  3IAY A;  4DR2 B;  1IBL B;  5CMU A;  1TVK A;  5BR8 B;  4PJ0 Z;  3F5T A;  3R65 A;  2VQF O;  4NTY A;  3CCL V;  4JTD B;  1GRJ A;  5LGU A;  4U3J A;  2LGQ A;  3MDS A;  2GSM B;  4O2A A;  3ZHU A;  2XAH A;  3W7U A;  2LW1 A;  2ZR3 A;  2UU9 O;  3JAS A;  2OWO A;  3OGC C;  3K57 A;  3A0H Z;  2Q7G A;  2YID A;  3CCJ V;  4FM0 A;  4JI0 O;  5FPR A;  2XT9 A;  1OJH A;  3C3S A;  4J11 A;  2JVD A;  1W0J G;  3JYC A;  3OM3 B;  1YDX A;  4TV8 B;  2Q7H A;  1GH6 A;  3HR0 A;  3O65 A;  5IWA B;  2E5L B;  1VQ8 V;  5EZY A;  4RUF A;  1YTF D;  1I0H A;  2CE4 A;  2ZT9 B;  1SQF A;  1Q43 A;  3LDD A;  1RPO A;  4GKJ O;  1NVP D;  2Y0I A;  4JZ2 A;  4FLY A;  1E1Q G;  2UXD B;  2PI5 A;  5H5N A;  1Q3E A;  4U3J B;  3APO A;  3I55 V;  4YY3 B;  3E86 A;  3LSU A;  3CCM V;  4X62 B;  1I94 O;  4DR4 O;  5L3F A;  2R9I A;  4UCR A;  2PUS A;  4QE7 A;  1IBK B;  2Y69 C;  4CS2 A;  1WA8 B;  4FLX A;  5KUK A;  1KBH A;  2AZ0 A;  4KL1 A;  4GCZ A;  5CB4 B;  4JAV A;  5B1B B;  1GTO A;  2ZE5 A;  5B1N A;  4J42 A;  2XAG A;  4CZZ A;  4DV7 B;  3ASO C;  4X1Y B;  3HKE B;  5LMU O;  1AJN A;  4FK5 C;  1WPB A;  2ITC C;  4I55 B;  4CC6 A;  3E89 A;  5IT9 N;  1RM1 B;  1IZ3 A;  3ZRW A;  5FPO A;  3CXH F;  5FNV B;  3L9D A;  3HKB B;  4WFB V;  3AG4 B;  2ZE8 A;  4MTG A;  1QR8 A;  3E8G A;  2IJH A;  3BVO A;  2YS8 A;  1HNZ O;  4ICG A;  3ZHV A;  5JWP A;  5HFL A;  2E76 B;  1F51 A;  3ASN B;  4PA6 A;  2EIL C;  1VAR A;  2XHB A;  4WFE A;  4B3R O;  4PV1 B;  3WB0 A;  2W0X A;  2QDO A;  2D3O W;  2DN9 A;  2VWK A;  1OZ0 A;  1QVF U;  1VQ9 V;  1OCZ B;  2WAM A;  4K8X A;  3JAM N;  5EBW C;  1AP5 A;  3FD9 A;  4R7C A;  2Q9L A;  1SQP H;  2ZXW B;  1N0J A;  1P7G A;  1ZLZ A;  3AEI A;  3Q4H B;  3CP1 A;  2XND G;  4X65 O;  4B3S B;  1YXB A;  4J7K A;  4DUZ B;  3ZN1 A;  1BQ0 A;  4BW5 A;  2DQ3 A;  3SDL A;  3OEE G;  1R3L C;  1H2L A;  3AG1 C;  4WFG A;  3KCY A;  1BT8 A;  3AK2 A;  3CJH A;  4NB5 A;  1HDJ A;  2GUZ B;  4NYK A;  4JI1 O;  1NKD A;  3UKM A;  3T1H O;  4LBE C;  2FTK A;  2JDI G;  3DTU B;  2M6Y A;  1JJO A;  4BIU A;  4UFZ A;  4B3T B;  1PL0 A;  3OEH G;  4XDL A;  5EYP A;  4JGS A;  1R3J C;  4MVZ A;  2UXB O;  2ADP A;  4K35 A;  1NR1 A;  3JCU Z;  4PDL A;  3K06 A;  3Q4H A;  1OCO C;  4FLV A;  2DYR B;  2CTR A;  4BWA A;  4X1Y A;  2XAJ A;  1FXK C;  2VWJ A;  4X88 A;  3SJB C;  1SC5 B;  3ZCC A;  1NTM H;  1SQV H;  1Y74 B;  2HLD G;  3K5L A;  1RFY A;  2IM9 A;  1IUR A;  2LGW A;  4P30 A;  3IFX A;  1JJ2 U;  1H5W A;  1KYO F;  1MZE A;  1Y76 A;  3QO7 A;  4NR1 A;  1G1X B;  4OGQ B;  3H1J H;  1IXM A;  3GB7 C;  2GV9 A;  3E8F A;  5IY5 C;  2JJ2 G;  3EHB B;  3H9V A;  2PYL A;  1JVM A;  4JTA B;  1GN2 A;  3M99 B;  4HNA B;  3ZS8 C;  1YTF B;  1DF4 A;  3SPC A;  4FLT A;  3DGE A;  3RYF B;  3DC6 A;  4DR3 B;  1WN7 A;  4PI2 A;  2IW5 A;  4X20 A;  5BMV A;  1K34 A;  2N74 A;  1Q90 D;  2VRZ A;  3CCQ V;  2QEX V;  2CH7 B;  2IJJ A;  4UB6 Z;  1K4C C;  1E1R G;  3N2G A;  4TQD A;  1HWY A;  3JSN A;  2Q68 A;  3OTO O;  4JAS A;  1PNK A;  1VF6 A;  1L0L H;  2Q73 A;  4JAA A;  1ENV A;  3ZHQ A;  3H1L H;  1QNM A;  2FL4 A;  5BY1 A;  1LUV A;  2P4K A;  4IL6 Z;  4Z1V A;  2QM8 A;  3ABM C;  1GAX A;  1ZWI C;  5L3G A;  4MT8 A;  1CP9 A;  3IGA C;  2PTM A;  4JYC A;  4UUJ C;  4CH6 A;  4J80 A;  3GVM A;  2YIA A;  4UV9 A;  2RDC A;  4B7K A;  2DWE C;  5BMV B;  1KU9 A;  4DV6 B;  3BCC H;  5LA6 B;  1HNZ B;  3L73 H;  2EUL A;  4OX9 B;  5J2T B;  4O4H A;  1XMQ B;  2EZP A;  2RQ6 A;  4TV8 A;  2ZM6 O;  1TAE A;  4PD4 F;  1CPY A;  3EXA A;  3IC7 A;  5LHI A;  2YEV B;  2Y0P A;  1HNW B;  1VQ6 V;  5H6R A;  1XEQ A;  2IJI A;  3ZRS A;  4PHZ A;  2Q6A A;  4UCS A;  2HEP A;  1GO3 F;  4LF9 B;  1URF A;  1K9M W;  4DV0 O;  3CXC U;  5C93 A;  3UO2 A;  2DQ0 A;  4J9Z B;  5JH7 A;  2EIM C;  4DR4 B;  1VF6 C;  1NTZ H;  3G6B A;  1LNQ A;  3FAV B;  4X1I B;  4I4T A;  4ASU G;  2M7W A;  1NU1 H;  4JYY A;  1PL4 A;  2ZNJ A;  1PKX A;  2JEU A;  4E4E A;  4RQF A;  2QSA A;  1NBM G;  2RN9 A;  3CMA V;  3T4D A;  3SGI A;  5KX5 B;  3LNN A;  5FL7 G;  2WA4 A;  3ZRV A;  4O2B B;  4PA7 A;  2E5L O;  1NS1 A;  3FB8 C;  5KMG B;  3SYC A;  4MVQ A;  3RVZ A;  1QU7 A;  1O9H A;  5E79 Z;  2XAF A;  4JI0 B;  5CA0 B;  1OCC C;  3JAR B;  2EIN C;  4RUE A;  4TV9 A;  4DR7 B;  4JI6 B;  2UU9 B;  2JGD B;  3JAW A;  2YXL A;  2Z3Y A;  2JS5 A;  2Q7E A;  2V1D A;  3B8M A;  5K1P A;  1XHX A;  1OHH G;  1T5E A;  3N2K B;  3QO8 A;  3WB2 A;  4ZHQ B;  1GM7 A;  2AW9 A;  1W59 A;  1QLN A;  2NN4 A;  2Q8V A;  1AI4 A;  4K0K O;  2AZ2 A;  4JI8 B;  3B40 A;  3W7S A;  2BTO A;  2A9H A;  3FB7 C;  4KHP O;  1AI5 A;  4FFB A; 
#chains in the Genus database with same CATH homology
 1EN5 A;  3MDS A;  1JA8 A;  1MMM A;  3IC9 A;  3AK1 A;  4C7U A;  1VAR A;  1XUQ A;  1MNG A;  4BR6 A;  1GN2 A;  1ZUQ A;  4GUN A;  1EN4 A;  2CDY A;  1GN3 A;  1EN6 A;  5AG2 A;  1N0N A;  1EM1 A;  3C3S A;  1KKC A;  1SZX A;  3DC6 A;  4FFK A;  1AP5 A;  3C3T A;  1VEW A;  1N0J A;  1B06 A;  1P7G A;  1AP6 A;  1ZLZ A;  2GDS A;  3DC5 A;  1IDS A;  1I0H A;  2CE4 A;  4JYY A;  1IX9 A;  1XIL A;  1XDC A;  1PL4 A;  1AR4 A;  1XRE A;  4E4E A;  1PM9 A;  3TJT A;  4JZ2 A;  1BSM A;  4F6E A;  3KDR A;  4JZG A;  1QNM A;  1D5N A;  3LSU A;  1BT8 A;  3AK2 A;  1LUV A;  2P4K A;  1LUW A;  4YIP A;  3OT7 A;  1I08 A;  1GN4 A;  1AVM A;  2QKA A;  3AK3 A;  4YIO A;  1Y67 A;  1MA1 A;  1JR9 A;  1WB7 A;  2ADP A;  1IXB A;  3RN4 A;  3K9S A;  1ZTE A;  2RCV A;  3CEI A;  2AW9 A;  1ZSP A;  3EVK A;  3BFR A;  1WB8 A;  3KKY A;  2QKC A;  1BS3 A;  5A9G A;  3QVN A;  1AR5 A;  1GN6 A;  1MSD A;  2ADQ B;  4X9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...