4BR6A

Crystal structure of chaetomium thermophilum mnsod
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Crystal Structure and Biochemical Characterization of a Manganese Superoxide Dismutase from Chaetomium Thermophilum.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 72
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4br6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4br6A02
1JR9A 2CDYA 2ADPA 1WB8A 1GN3A 3C3SA 3LSUA 1D5NA 1N0NA 3AK1A 1ZUQA 1PL4A 1IX9A 2QKCA 1XILA 1ZLZA 1EN4A 1AP5A 1WB7A 1BSMA 1KKCA 3KKYA 4F6EA 2AW9A 4GUNA 1GN6A 1QNMA 1EN5A 1XDCA 2P4KA 1I08A 3TJTA 1LUVA 1EN6A 2RCVA 1MNGA 2GDSA 3MDSA 2CE4A 4YIPA 4FFKA 1GN2A 1N0JA 1IXBA 1LUWA 3RN4A 1ZSPA 1MA1A 1PM9A 1GN4A 3CEIA 1XREA 1I0HA 1VARA 5A9GA 3DC5A 2ADQB 4JZ2A 3AK2A 1XUQA 1SZXA 4JYYA 1ZTEA 1BT8A 4E4EA 3DC6A 1JA8A 4BR6A 1AP6A 1MSDA 3C3TA 4JZGA 1B06A 3K9SA 1AR4A 2QKAA 3AK3A 1IDSA 1EM1A 4YIOA 1AVMA 1MMMA 1Y67A 4C7UA 1BS3A 1VEWA 1AR5A 3EVKA 1P7GA 3IC9A 3BFRA 3QVNA 4X9QA 5AG2A 3OT7A
chains in the Genus database with same CATH superfamily
1G6UA 3HKCA 3VQYA 2Y0IA 2CGOA 2PTMA 1JPXA 2WLLB 5FNVA 1H2LA 1VQ9V 2OTLV 2EJRA 2JEXA 1FXKB 2ARHA 4PDLA 1SQPH 3CRMA 1EN4A 2CTWA 4EEQA 1MSWD 1SQQH 2F23A 2RN9A 2QWRB 4JYCA 1BSMA 4LF8O 3FX7A 4XDKA 2CUGA 1WJZA 2UXDB 1VQPV 1SQXH 4GUNA 4WF9V 4DR1O 2Q7HA 3K5MA 1AILA 1GN6A 3SDLA 4LC1A 4X1IB 2GV9A 2BTOA 4MVRA 1P49A 2L6LA 2EIJB 1NVPB 1WPBA 4OPAA 4GT1A 5KUMA 4TT3G 1XL4A 2GTSA 4X64B 1IBKO 3T1YB 4OXSA 3JD1A 1H2SB 4H37A 1NT2B 3DXRA 1IBMB 4JYBA 1BZKA 2XOKG 4QNHB 2ADQB 4FLTA 4TOIA 1ZTEA 1VQ6V 1S76D 2YUAA 1GM7A 1XQ8A 4UCOA 3OMNB 5FPOA 1FD9A 3LNMB 4JI1B 3CXCU 2ILMA 4FZ1A 2QE7G 3AG1C 5H5NA 3IGAC 2WAMA 2YS8A 2AZ0A 2XASA 1HNZB 4FM1A 4MW8A 5LYJB 2HG5C 2HFEC 5D5QA 4CS4A 2F4VB 3CRQA 4ZHQA 4JAAA 4W4LA 2NN4A 2YIDA 3R65A 4B3TB 4FK5C 4NXMB 1WB8A 2JIZG 2KKWA 2X6CA 1RM1B 3C3SA 5LMUO 2M6YA 4O2AB 4YJ2B 3U0ZA 2GUZA 3NR7A 5J2UA 4RUFA 1QU7A 3RYIB 3QF7A 4ZKIA 4JI5B 3X2QB 4DR5O 1HR0O 1MOFA 3UO2A 1AR1B 3D8CA 1X4TA 2JJ2G 3JAKA 3ZRXA 4RQFA 5JWPA 2B1GA 3M8AA 2P7TC 2ZE5A 1T5EA 4TUYB 2G38A 4GZRB 4AILC 2HR3A 1VQ5V 3TCUA 4NTYA 3OD4A 5ITZB 3CCUV 1AI6A 3B09A 1LUVA 1FFTB 4FMTA 3CCRV 1NS1A 1BHAA 4HAMA 4O4JB 2A9HA 5IY5B 2UUBO 3UM7A 1U96A 2EULA 1R6NA 4BIOA 4K8ZA 2F1MA 1NU1H 1CPYA 5BXZA 4PA9A 3M7MX 5CA1A 3RYCA 1XI1A 3K04A 2YEVA 3A0RA 5DEDA 4U3JA 1XNQB 2E3CA 3ML0A 4BIUA 3E2EA 2PY5A 4R50A 5IYZB 1ZX3A 4I55A 5L3BA 2ZNIA 2PUSA 3K58A 1PKXA 2XNDG 2IJHA 3OGCC 4ZI7B 4TQDA 1IZ3A 5EC1C 3KZIZ 4LWSA 3BAAA 4GLXA 2QWNB 5C8YA 1AI7A 3JD0A 3LUTB 5BZBA 4I4TA 1KP2A 3K59A 4R8CA 4EB6A 4H44B 2VWKA 2UXDO 1D5NA 2XAQA 2PI5A 2A0LA 1TVKB 1KQSU 2FYUH 1AROP 2K1EA 2NLJC 3B40A 1XILA 4O4IA 5JJNB 2HVJC 3DSQA 1KYOF 5CA0A 3CRCA 2AGAA 2WLHA 4DV2O 4B3SO 1QBZA 4BIZA 4WCEV 4ZOLA 3UT5A 3SPIA 5IWAB 2E5LB 3CPWU 1K34A 3SPCA 3T1YO 4LFCB 5LXTA 1QLNA 1I08A 3TJTA 4QE9A 2ZXWC 1IBMO 1DTOA 1MNGA 3M99B 4NTXA 2A06H 2X6BA 1ZAUA 3S3XA 1IVSA 1HNWB 5KHIA 3OEEG 2EILC 5BMVB 4B7EA 1GN4A 4JI1O 4B3MB 1HW7A 1VARA 4X1IA 1K8AW 2FTKA 4PI2A 1GK9A 5DECA 2IU0A 1GRJA 3I55V 3PJSK 1HNZO 1GM8A 4QPKA 3IAYA 4EFEA 4BR6A 2F4VO 1Y74A 1MSDA 2LGWA 4MVQA 4TV8B 4HYOA 3OTOB 4UCSA 4J42A 2N05A 3JATA 4B3TO 1M90W 4RUEA 3BHPA 2P5OA 2E75B 2HHHO 1Q6UA 4JI5O 3K5NA 1VQLV 3CC7V 2WPDG 1GN3A 2JK5C 1Y76B 2QWPB 3LSUA 1AJPA 1ZUQA 3RVYA 5GTHZ 3UQ8A 2YXHA 1O9HA 2MW2B 1V54C 4UV8A 4HBNA 1SA0B 2RDCA 3OMIB 5B1OA 3CJHA 4F6EA 2Q9LA 4N23A 2HJFC 3BABA 1Q90D 4LF9B 2BE3A 4YJ2A 1YZBA 1EN5A 1SC5B 2RCVA 5L3CA 1CEZA 1F4MA 4G27B 5EYPA 4FFKA 2Q69A 1N0JA 1SQFA 2VWJA 4UUJC 5KUKA 3JARB 2LFSA 1MA1A 5IJ0B 4KHPO 2ZQMA 4P30A 2GHYA 2DWDC 2OIGA 4LR3A 5K1XA 3CEIA 1K7DA 1R1BA 1XNQO 3ETQA 3AG7A 2Z5UA 5A9GA 3UCSC 5H9CA 2EJ7A 4JI8B 1AB3A 3OAAG 4IL6Z 4LH7A 3G6EV 3SPJA 1NR7A 1TUBA 5KX5A 2GSMB 4GCZA 1AR4A 2EX3A 1COWG 2QKSA 2JGUA 3AK3A 5LGUA 1R3IC 4DUYB 3N2GA 3JALA 1BS3A 1GO3F 3LSSA 1VMGA 4BWAA 1N33O 2GTAA 3EVKA 2VQFB 3OFNG 3W7XA 3CCVV 4JAUA 3ZRWA 2CDYA 4DUZO 3W7TA 4NXNB 4ZIBA 2WLIA 1RP3B 4O4LA 3HKDA 2LJ2A 3AEIA 1PNMA 3KCYA 1RPRA 4LFCO 2ZKOA 4CBCA 2Y69C 5L3DA 4FLUA 3R66A 1SZTA 2AW9A 3K06A 2QSAA 2OCCB 1L1FA 1N36B 5B3SB 2XAFA 4J7JA 4FLWA 3LNNA 3ZBHA 2R9AA 3CMEV 4B3MO 4MVZA 2HVKC 1LUWA 4GKJB 2YIBD 4X20B 1B3QA 2X6AA 4P9PA 3ZX6A 5EBLC 3EHBB 4TV9B 2EIKC 3ASOC 4FM0A 4LCUC 2UUCB 4JI0B 3ABKC 4MTGA 1Y4MA 1QCEA 3FYIB 5KMGB 3RW0A 3H1KH 3OTOO 3ZHVA 1FFXB 4O4HA 2CH7A 5HFMA 3T1CA 4B3RB 1WP8A 3DC6A 1QHTA 4GKKB 1Z5WA 1JA8A 3E22B 1SS3A 4GX1A 4X65O 1YJ9V 1FPOA 3CX5F 2JGDB 1XMQB 2C2AA 1U97A 4JI3B 3OM3B 5IDJA 4YJ3A 4A5UB 5GONB 5CBHA 4IHJB 4JI2B 4FFBB 4C7UA 1EBOA 2LP7A 5JCOA 4J10A 1H2GA 3JD4A 3ABUA 1J5EB 1KKDA 4H13B 3ZHUA 4N21A 5K1PA 1OCCB 4LBEC 2BTQA 3TETA 4H0LB 5JQGA 5KHGA 3FAVB 4DXWA 5B1NA 5JCOC 3CCSV 2KG7B 4FIPC 4LF9O 1XNRB 2XT9A 3SYAA 4CZZA 1UFIA 5B1BC 4FM2A 3H01A 4JPRA 4YHHO 1I7FA 1JJOA 3THOA 1H8EG 1KBHA 1GTOA 1SQBH 2Q0AA 4RO2A 4UVBA 1J95A 4NYKA 1Y76A 4X89A 2VQEB 3H9VA 1V55C 3FD9A 2W0XA 1E1RG 4KP4A 2R70A 2L35A 5KAIZ 4CH4A 2ZXWB 3OR6C 5EIBD 4YY3O 1SA0A 3JYCA 3ABLB 2W6IG 2H3OA 1SERA 3JASA 4LFAB 4JI8O 1N32B 2PYLA 5LGTA 3CCEV 2YIAA 2VRZA 3G71V 5IYDO 3CP1A 3BA9A 3K79A 2ZE6A 4PDRA 5L3GA 2WLMA 5JVDB 1BT8A 1RSOB 4OGQB 4X62O 3EFFK 2A7WA 2Q7GA 4I7ZB 2CTRA 4LF4B 2DN9A 2Q0OC 4DRXB 4ICGA 3ZRSA 4J7ZA 1IXMA 1EFRG 2UUAB 5BR8B 2CK3G 4FLYA 4YIOA 3BCCH 1RPOA 5EIBC 5BY1A 2KQXA 2WA4A 2PI4A 1AJNA 2LW1A 1AR5A 1ORQC 3SYPA 1BCCH 3K08A 1QLEB 5EK0A 1JOYA 1K92A 5LA6B 2V7QG 1QVGU 3H1HH 5LOVB 3E35A 2UU9B 2ETNA 2YICA 3K0DA 3WB1A 2QKCA 3JAWB 2ZR3A 1W59A 1N36O 4UB6Z 2X7RB 1VF7A 4FLVA 2HEPA 3L9DA 1US6A 3BRCA 4GKJO 1BQZA 2R72A 5LP6A 1YF2A 1YXBA 1G1XB 2XUMA 4OX9B 2LO1A 4KL1A 2Q6AA 5EBMC 1KECA 2UUCO 5IT9N 4JI0O 4PI0A 1AI4A 3SR2C 3CE2A 2BCCH 1IXBA 5A2QN 2RQ6A 1S77D 3HKEB 2LFRA 1R3JC 4IYHA 4IGGA 1W0JG 3BPZA 5E1AC 4GKKO 2IJKA 4RAIA 2ZDIA 3LDCA 3STLC 2JJ1G 3RYFA 2ZM6B 3STZC 2Y4TA 1N4CA 1XMQO 1YJNV 4NKGB 1VQ8V 4L8JA 4UFZA 4JI2O 2P67A 3IJ4A 2LW7A 3VOUA 5C93A 4I0XB 2N04A 2IBZH 4PV1B 1YTFD 3CYOA 3L74H 4D6TH 1DK1A 2Z0AA 4TV9A 4JASA 1I94B 2ZDIC 4F6RB 3LSQA 1JNBA 4P2ZA 4PELA 1KP3A 1Y67A 2DOSA 5KMGA 4JV5B 5JH7A 3J80N 5B1AB 3ZMSA 1JJ2U 1KC8W 1R6KA 3BVOA 2LQTA 5IJ9B 3OT7A 5J2TB 1F7YA 3E22A 1XNRO 3CB2A 4PDVA 1SRYA 4WFAV 1QR8A 2IW5A 3L75H 2JS3A 3HR0A 3B2EE 4Z2WA 3H1JH 3WB2A 1IX9A 5KAFZ 1OCZC 3LDDA 4MTXA 2V4DA 1EZJA 2OWOA 3ASNB 3S3WA 2VQEO 2BSKB 3JCZA 1F51A 4X1KB 2WLKA 1NTZH 5EZYA 4HNAA 4JAVA 4X88A 4LNUA 3CS5A 2EBOA 3CCMV 4MVSA 3A2FA 4LFAO 2YXLA 2ZD9A 2OIEA 5GW7A 1HNXB 4J9ZB 3SJCC 2CE4A 5CB4B 2FMLA 3Q4HB 1PM9A 1NBMG 4IIJA 1YJWV 4Z1MG 2Q7EA 1JFFA 1A32A 4DR3B 5CMUA 2WLLA 4X64O 2QM7A 3JSNA 5EC2C 3GWKC 3AK2A 3T1HB 1FXKA 2UUAO 2KB1A 3HKBB 5BR8O 3MHSC 1DF4A 1H2KA 4E4EA 1S0VA 3AG2C 2PZSA 1OCRC 1FJGB 1H2NA 3VQXA 4I50B 4U3FH 2FKXA 2QWQB 1ENVA 3JD2A 2ITCC 3L70H 2VS0A 1FXKC 1IBLB 1L0NH 3ETGA 2UU9O 4AQYB 3ZEDA 4MVMA 3SYQA 5CBGA 2H8PC 3TK1A 3ZIAG 3QTCA 3JSLA 3I56V 5AG2A 1GAXA 4L87A 3GWOA 3OUFA 3K3WA 4WBNB 3EXAA 4MSWC 3CRRA 4MTOA 1YI2V 4MT8A 2D3OW 4DV0B 5F2VO 4NXMO 2EIJC 5IE9A 1ZLZA 2Z3YA 4OX9O 2YXYA 1H2MA 1X59A 4FLZA 4O2BB 3ZJZA 4DV6B 1P4RA 2F95B 3A0BZ 5KHJA 2JVDA 5KHKA 1PNLA 1WA8B 4X8AA 1BMFG 1V55B 2B9ZA 4WFBV 4DV7B 1P7BA 1K97A 1EN6A 1G4YB 1EZVH 4QIWF 5LYJA 2OYQA 3MDSA 1BL8A 3SPHA 1M5IA 3WB0A 5FL7G 1URFA 3OEHG 3HKCB 1GM9A 1OV9A 1PNKA 5FNVB 3J81N 3E8GA 4O2AA 2Q5ZA 3TXQA 4X1YB 2Y48A 1I94O 3OGIB 4JZ2A 1JX9A 4MS2A 3RYIA 1XEQA 1Z2GA 4D7SA 3BEHA 4JV5O 3MHHC 1MZFA 2CGNA 3OUSA 1TAEA 2DJVA 1OJHA 4JTCB 4K0KB 1FXHA 1NH2D 1B6QA 1PP9H 1TGOA 1Y6XA 4JZGA 4TUYA 1RM1C 1PD3A 2QKAA 3UO3A 3K57A 1GMGA 1IDSA 5ITZA 5LHGA 3X2QC 1M56C 2BOBC 2GBOA 5FLXN 2WA3A 1LNQA 2Q73A 2W0FC 2EIMC 4QE7A 5J9PC 4O4JA 1NZ6A 3AG1B 5HFLA 2JDIG 3B8NA 1FAFA 1VF6A 3MAQA 2PYJA 5IYBO 3WU2Z 4NR1A 4JYAB 4IYIA 4UCUA 1W0KG 4DR1B 4EKWA 2QR4A 3KKYA 1I5YA 1NTMH 4CS3A 2QDOA 3P32A 5DM6V 3P30A 3ZN1A 3P3NA 5IYZA 4PD4F 3T2MA 1RFYA 1QNMA 4DR3O 3D3QA 2QM4A 2QTSA 2EINC 3K03A 1ZWIC 5IWAO 2E5LO 2BSKA 4ZI7A 4GX5A 3F7YC 1GN2A 3SJBC 1TA8A 3CRAA 4LP8A 4ZHQB 3T1HO 1GKFA 1YDXA 4JI6B 4MVUA 3W7WA 4NB5A 4J9YB 1NI8A 1DF5A 1HNWO 2GUZB 1FJGO 5J2UB 1TVKA 4K35A 1K33A 2AZ2A 1L8DA 4TSFG 3JAKB 3FB7C 1IBLO 3O65A 5LHHA 4AQYO 1YITV 1WAZA 3C3TA 3K9SA 4J80A 4CH3A 3F5WC 4BW9A 3F5TA 2HJDA 1EM1A 3O9OA 1AJQA 4I9WA 3CD6V 1VEWA 3FKSG 1HP8A 2DYSC 3SJQC 1AI5A 2IH3C 4HZ3A 4DV0O 4DW1A 4PA3A 3ZCCA 1PPJH 2QJ1A 4UCRA 5BMVA 2Y0PA 2QEXV 5LHIA 4PA7A 3ZMUA 4CS2A 2DW4A 1Y66A 4DV6O 1OCZB 5LMNB 5CA1B 3RYCB 2DQ3A 2QA4V 2YEVB 4PA6A 4DV7O 1YTFB 4U3JB 3N2KB 2EZOA 4GX2A 1NQTA 4I55B 4TV8A 3VQWA 3B8MA 4P9OA 2P4KA 4KXRA 4KFMA 3H1IH 2JS5A 4DV1B 4Q6GA 2P22C 3NXSA 5EBWC 2GDSA 4LWSB 4AI8A 5C8YB 2UUBB 4UCVA 1K73W 1N8RW 4I4TB 1VQ4V 1N34B 3G67A 1Q7YW 4LF7B 1Q6IA 1SQVH 3A0HZ 5TISZ 4JI7B 1PV0A 4LFBB 1NR1A 4K0KO 3KDRA 2WWWA 4XDLA 2IU3A 3QO5A 4DR2B 3WG7C 3D3IA 1S5JA 2IH1C 2CTQA 3OR7C 4O4IB 4DW0A 3P3PA 5GTIZ 5CA0B 4D7TA 2HLDG 4DR7B 1R3LC 1I5XA 4DYLA 4JF3A 3W7UA 2WSSG 1OCRB 4ZOLB 3UT5B 4DV4B 4CH5A 2EILB 4Z1VA 2ODMA 3U11A 1SETA 5LXTB 1F23A 5H2FZ 2OCHA 4H33A 4X1YA 1IJGA 3ZMZA 5FPRA 2P6JA 1JQ0A 3L71H 4ABMA 4DUYO 2LGQA 4I5SA 1XL6A 3JARA 4BAYA 4FJCC 5CN0A 1UJWB 5IJ0A 4B08A 4JYAO 3E8FA 2UXNA 1S72V 4E2LA 2VQFO 1YIJV 4UVAA 5B66Z 1N0NA 1PL4A 1F4NA 2DE0X 5LGNA 3G6BA 4DV2B 3K5OA 4B3SB 4NXNO 1UPGA 2DQ0A 1M9NA 1Q3EA 3HB3B 3ZHQA 2QTOA 2P90A 1Y74B 2K9PA 1H5WA 3CXHF 3ZMTA 3JATB 4JI6O 4JGSA 1OCOC 4Q20A 3B77A 3CCLV 3ETEA 2YSUB 4WFHA 3W7SA 1V9PA 1M57C 4W4KA 4JTAB 4DR6B 1V54B 2RJZA 3RN4A 5B5EZ 2WLJA 1XOUA 1WPXA 2QM8A 3UKMA 1I0HA 4U7OA 2ZCEA 1MG1A 1Q8IA 1HWYA 4JYYA 3D36A 2N74A 3T4DA 3CJHB 3BY6A 3LDEA 3ZHSA 1AP6A 1MABG 3AG4C 1KB9F 5LP6C 2QWOB 3H1LH 4B3RO 4DK1A 1QR9A 4AHCA 3A8TA 3FB6C 3ZN0A 2HHHB 5KA5A 1M56B 2Y4UA 4LF5B 3D36C 5EYPB 4JI3O 5CBFA 5KLVH 5LMNO 4DO2A 2P06A 3IC9A 1H8HG 4X20A 2EIMB 4DR4B 2B5UA 2OCCC 3OMAB 1JR9A 2AHZA 2HKOA 1J5EO 2OTJV 3ABMC 3AG3C 4TWKA 3GB7C 5B3SC 4DV3B 1BQ0A 2RMKB 1M1KW 3K5LA 1FFXA 3N27A 1VIBA 3QNEA 1KKCA 1WN7A 4DV1O 2YC0A 1R6TA 2AXTZ 1TUBB 5KX5B 1NH2B 5JJJB 2KSDA 2JGDA 3N2GB 1N34O 4OPHA 3JALB 4LF7O 5GONA 4IHJA 3CC4V 1XDCA 2XAHA 1M93A 2M7WA 2EINB 4FFBA 3ZHTA 3HPLC 5E79Z 3SYOA 4KHPB 4JI7O 2MK3A 2HP8A 4LFBO 1YEWA 3GVMA 3VQVA 4CH6A 4JI4B 3F7VC 1DLBA 4DR2O 1ZSPA 2Y69B 3DGEA 3N2KA 3ZRWB 3RGBA 4DR7O 1Q5OA 4RWUA 4PJ0Z 1BGYH 3VBBA 5IYCO 1K5SA 3FAVA 2WLIB 4J11A 1XREA 2ATKC 4O4LB 4PA4A 1Q82W 2ITDC 1N32O 4DV5B 1BE3H 2UXCB 3HKDB 4DV4O 2P4VA 4MW3A 2KG7A 2ZNJA 4LF6B 2ZE7A 2Q8VA 4K8XA 4XBFA 3L73H 1OCCC 1S3JA 1FKAO 1E1QG 2DWEC 2Q4PA 4J41A 5H6QA 1CP9A 2DYRC 2EIKB 3RBZA 3ASOB 2R9RB 3FFQA 1N33B 1AVMA 2UXXA 4LF4O 3ABKB 1XBLA 1K5QA 5JJEB 4WFEA 1NVPD 2RNBA 2DYSB 3JD3A 4DUZB 2ZIOA 1FYJA 1JCHA 4PDMA 1B04A 3APQA 1ZL8B 2O57A 1MZEA 3U10A 3PN1A 3FB5C 5CA3A 4R6ZA 2ZR2A 3QO7A 3RT3C 1D2DA 4XDJA 3OE7G 4O4HB 1WLEA 3ABLC 1JVMA 2CH7B 4TQFA 2QGNA 3IC7A 1AP5A 5JVDA 2F93B 1E79G 4WFFA 1RSOA 1WB7A 1IURA 1K4CC 4DR6O 2ZINA 1VF5B 4LH6A 1L0LH 4DRXA 2W6JG 4YJ3B 1VQ7V 2H94A 2AHYA 1NTKH 3CC2V 1SKVA 2IJJA 4FLXA 4G28B 2BTQB 3ETDA 2CAZC 1SESA 5B1BB 4CC5A 1XHXA 2OT5A 1VQKV 3RYHB 5JQGB 3QG5A 5LA6A 5LOVA 5LL6Y 3OTFA 1O9GA 3JAWA 3RFRA 3T4ZA 3WG7B 1K3EA 2BOCC 4X65B 1WNSA 3K9AA 4QGPA 2ZM6O 2JEUA 3KCXA 4WFGA 2IJIA 1THZA 4LF5O 1S5LZ 1QLEC 3ZS8C 3J7AU 1KUQA 4IT5A 1TUEB 2UXBB 1WP7A 4CC6A 1YSCA 4DR4O 1P84F 3ZMVA 2E74B 3TXSA 1MMMA 3CWBH 2YI9A 1VQNV 2D2CB 4DV3O 1P7GA 3JASB 3QVNA 3HKEA 4GYCB 1YCIA 2V1DA 4QJFB 2WLNA 4X66B 2DMXA 2E76B 3AK1A 4UB8Z 3E8HA 1XMOB 4YHHB 2A3QA 4G2KA 4I0XA 4RQEA 2F43G 4B7KA 3SGIA 3SPGA 4JI4O 1Z5VA 1SF9A 3DXRB 2NR5A 3DTUB 2NNUA 1G8MA 3BA8A 4F6RA 4YY3B 1OCOB 2FB5A 4U7NA 4LF8B 4YXWG 3QO8A 4UV9A 1M57B 4JTDB 4ZBMA 3RWRD 1M4UA 4YIPA 2UXCO 3E86A 4DV5O 1FS0G 3C90A 3L72H 3ZRVA 1HNXO 1QVFU 3CHXA 5IJ9A 5J2TA 4LF6O 5LBQA 1OHHG 4UXNA 1XHZA 5IY5C 3FYEB 2B1IA 2A79B 1VF6C 4J7KA 5DN6G 4X62B 2ZE8A 5B1AC 1XUQA 2ZIMA 1H38A 1IBKB 1Q6HA 1Q81W 4X1KA 1JMKC 3OW2U 4GX0A 1QQCA 3AG4B 5LP6B 1PL0A 1FOUA 2F66C 2YI8A 1KU9A 3FB8C 2IM9A 3SYCA 3ASNC 1ROPA 3G80A 3WFVA 3ZHRA 1K9MW 1D5AA 5CB4A 3Q4HA 3BFRA 2XHBA 4UVCA 4X9QA 2PGGA 3IFXA 3K0GA 2ADPA 3ABMB 2EZPA 3AG3B 2Q67A 1R73A 4PHZA 1KD1W 3RYFB 1BHBA 2XTAA 5L3FA 3B4SA 3I5DA 3E8BA 1VQOV 3CSXA 3HKBA 2R9IA 2X0LA 3CCJV 3CCQV 5LMUB 1ZL8A 1KMIZ 4QPJA 1Q86W 2CTPA 2ZT9B 4BW5A 5KA6A 3APOA 4I50A 3JAMN 1GH6A 4DR5B 1LR1A 2FL4A 1HR0B 1Q43A 4MVOA 2YDEA 2XAJA 3ABTA 5JH7B 4EFBA 3JCUZ 1K4DC 1DGSA 3RVZA 2YIBA 5D5PA 4F4LA 5H6RA 4DK0A 1NKDA 3E83A 3KG2A 1R3KC 3SJAC 1W2BU 4FPPA 4WBNA 4NTWA 3ICXA 4I9QA 1OZ0A 3DC5A 2UXBO 3G4SV 4R7CA 3TGUH 1SZXA 4KUMA 1YHQV 2JRIA 5EZYB 5L3EA 1NJIW 4FVMA 4UCTA 4HNAB 4O2BA 4NVPA 1S5HC 4LNUB 3RYHA 1B06A 4EB6B 1SQGA 1CXZB 2DYRB 1HDJA 3E89A 1WA8A 4ASUG 3CMAV 2XAGA 4X66O 3MD0A 1VQMV 1FXVA 1XMOO 1YVWA 2Q68A 4MTFA 4K3AA 2PF4E 4IIJB 5KHHA 4FZ0A 3AG2B 1VP7A 1JFFB
chains in the Genus database with same CATH topology
1JR9A 2CDYA 2ADPA 1WB8A 1GN3A 3C3SA 3LSUA 1D5NA 1N0NA 3AK1A 1ZUQA 1PL4A 1IX9A 2QKCA 1XILA 1ZLZA 1EN4A 1AP5A 1WB7A 1BSMA 1KKCA 3KKYA 4F6EA 2AW9A 4GUNA 1GN6A 1QNMA 1EN5A 1XDCA 2P4KA 1I08A 3TJTA 1LUVA 1EN6A 2RCVA 1MNGA 2GDSA 3MDSA 2CE4A 4YIPA 4FFKA 1GN2A 1N0JA 1IXBA 1LUWA 3RN4A 1ZSPA 1MA1A 1PM9A 1GN4A 3CEIA 1XREA 1I0HA 1VARA 3KDRA 5A9GA 3DC5A 2ADQB 4JZ2A 3AK2A 1XUQA 1SZXA 4JYYA 1ZTEA 1BT8A 4E4EA 3DC6A 1JA8A 4BR6A 1AP6A 1MSDA 3C3TA 4JZGA 1B06A 3K9SA 1AR4A 2QKAA 3AK3A 1IDSA 1EM1A 4YIOA 1AVMA 1MMMA 1Y67A 4C7UA 1BS3A 1VEWA 1AR5A 3EVKA 1P7GA 3IC9A 3BFRA 3QVNA 4X9QA 5AG2A 3OT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR9 A;  2CDY A;  2ADP A;  1WB8 A;  1GN3 A;  3C3S A;  3LSU A;  1D5N A;  1N0N A;  3AK1 A;  1ZUQ A;  1PL4 A;  1IX9 A;  2QKC A;  1XIL A;  1ZLZ A;  1EN4 A;  1AP5 A;  1WB7 A;  1BSM A;  1KKC A;  3KKY A;  4F6E A;  2AW9 A;  4GUN A;  1GN6 A;  1QNM A;  1EN5 A;  1XDC A;  2P4K A;  1I08 A;  3TJT A;  1LUV A;  1EN6 A;  2RCV A;  1MNG A;  2GDS A;  3MDS A;  2CE4 A;  4YIP A;  4FFK A;  1GN2 A;  1N0J A;  1IXB A;  1LUW A;  3RN4 A;  1ZSP A;  1MA1 A;  1PM9 A;  1GN4 A;  3CEI A;  1XRE A;  1I0H A;  1VAR A;  5A9G A;  3DC5 A;  2ADQ B;  4JZ2 A;  3AK2 A;  1XUQ A;  1SZX A;  4JYY A;  1ZTE A;  1BT8 A;  4E4E A;  3DC6 A;  1JA8 A;  4BR6 A;  1AP6 A;  1MSD A;  3C3T A;  4JZG A;  1B06 A;  3K9S A;  1AR4 A;  2QKA A;  3AK3 A;  1IDS A;  1EM1 A;  4YIO A;  1AVM A;  1MMM A;  1Y67 A;  4C7U A;  1BS3 A;  1VEW A;  1AR5 A;  3EVK A;  1P7G A;  3IC9 A;  3BFR A;  3QVN A;  4X9Q A;  5AG2 A;  3OT7 A; 
#chains in the Genus database with same CATH topology
 1G6U A;  3HKC A;  3VQY A;  2Y0I A;  2CGO A;  2PTM A;  1JPX A;  2WLL B;  5FNV A;  1H2L A;  1VQ9 V;  2OTL V;  2EJR A;  2JEX A;  1FXK B;  2ARH A;  4PDL A;  1SQP H;  3CRM A;  1EN4 A;  2CTW A;  4EEQ A;  1MSW D;  1SQQ H;  2F23 A;  2RN9 A;  2QWR B;  4JYC A;  1BSM A;  4LF8 O;  3FX7 A;  4XDK A;  2CUG A;  1WJZ A;  2UXD B;  1VQP V;  1SQX H;  4GUN A;  4WF9 V;  4DR1 O;  2Q7H A;  3K5M A;  1AIL A;  1GN6 A;  3SDL A;  4LC1 A;  4X1I B;  2GV9 A;  2BTO A;  4MVR A;  1P49 A;  2L6L A;  2EIJ B;  1NVP B;  1WPB A;  4OPA A;  4GT1 A;  5KUM A;  4TT3 G;  1XL4 A;  2GTS A;  4X64 B;  1IBK O;  3T1Y B;  4OXS A;  3JD1 A;  1H2S B;  4H37 A;  1NT2 B;  3DXR A;  1IBM B;  4JYB A;  1BZK A;  2XOK G;  4QNH B;  2ADQ B;  4FLT A;  4TOI A;  1ZTE A;  1VQ6 V;  1S76 D;  2YUA A;  1GM7 A;  1XQ8 A;  4UCO A;  3OMN B;  5FPO A;  1FD9 A;  3LNM B;  4JI1 B;  3CXC U;  2ILM A;  4FZ1 A;  2QE7 G;  3AG1 C;  5H5N A;  3IGA C;  2WAM A;  2YS8 A;  2AZ0 A;  2XAS A;  1HNZ B;  4FM1 A;  4MW8 A;  5LYJ B;  2HG5 C;  2HFE C;  5D5Q A;  4CS4 A;  2F4V B;  3CRQ A;  4ZHQ A;  4JAA A;  4W4L A;  2NN4 A;  2YID A;  3R65 A;  4B3T B;  4FK5 C;  4NXM B;  1WB8 A;  2JIZ G;  2KKW A;  2X6C A;  1RM1 B;  3C3S A;  5LMU O;  2M6Y A;  4O2A B;  4YJ2 B;  3U0Z A;  2GUZ A;  3NR7 A;  5J2U A;  4RUF A;  1QU7 A;  3RYI B;  3QF7 A;  4ZKI A;  4JI5 B;  3X2Q B;  4DR5 O;  1HR0 O;  1MOF A;  3UO2 A;  1AR1 B;  3D8C A;  1X4T A;  2JJ2 G;  3JAK A;  3ZRX A;  4RQF A;  5JWP A;  2B1G A;  3M8A A;  2P7T C;  2ZE5 A;  1T5E A;  4TUY B;  2G38 A;  4GZR B;  4AIL C;  2HR3 A;  1VQ5 V;  3TCU A;  4NTY A;  3OD4 A;  5ITZ B;  3CCU V;  1AI6 A;  3B09 A;  1LUV A;  1FFT B;  4FMT A;  3CCR V;  1NS1 A;  1BHA A;  4HAM A;  4O4J B;  2A9H A;  5IY5 B;  2UUB O;  3UM7 A;  1U96 A;  2EUL A;  1R6N A;  4BIO A;  4K8Z A;  2F1M A;  1NU1 H;  1CPY A;  5BXZ A;  4PA9 A;  3M7M X;  5CA1 A;  3RYC A;  1XI1 A;  3K04 A;  2YEV A;  3A0R A;  5DED A;  4U3J A;  1XNQ B;  2E3C A;  3ML0 A;  4BIU A;  3E2E A;  2PY5 A;  4R50 A;  5IYZ B;  1ZX3 A;  4I55 A;  5L3B A;  2ZNI A;  2PUS A;  3K58 A;  1PKX A;  2XND G;  2IJH A;  3OGC C;  4ZI7 B;  4TQD A;  1IZ3 A;  5EC1 C;  3KZI Z;  4LWS A;  3BAA A;  4GLX A;  2QWN B;  5C8Y A;  1AI7 A;  3JD0 A;  3LUT B;  5BZB A;  4I4T A;  1KP2 A;  3K59 A;  4R8C A;  4EB6 A;  4H44 B;  2VWK A;  2UXD O;  1D5N A;  2XAQ A;  2PI5 A;  2A0L A;  1TVK B;  1KQS U;  2FYU H;  1ARO P;  2K1E A;  2NLJ C;  3B40 A;  1XIL A;  4O4I A;  5JJN B;  2HVJ C;  3DSQ A;  1KYO F;  5CA0 A;  3CRC A;  2AGA A;  2WLH A;  4DV2 O;  4B3S O;  1QBZ A;  4BIZ A;  4WCE V;  4ZOL A;  3UT5 A;  3SPI A;  5IWA B;  2E5L B;  3CPW U;  1K34 A;  3SPC A;  3T1Y O;  4LFC B;  5LXT A;  1QLN A;  1I08 A;  3TJT A;  4QE9 A;  2ZXW C;  1IBM O;  1DTO A;  1MNG A;  3M99 B;  4NTX A;  2A06 H;  2X6B A;  1ZAU A;  3S3X A;  1IVS A;  1HNW B;  5KHI A;  3OEE G;  2EIL C;  5BMV B;  4B7E A;  1GN4 A;  4JI1 O;  4B3M B;  1HW7 A;  1VAR A;  4X1I A;  1K8A W;  2FTK A;  4PI2 A;  1GK9 A;  5DEC A;  2IU0 A;  1GRJ A;  3I55 V;  3PJS K;  1HNZ O;  1GM8 A;  4QPK A;  3IAY A;  4EFE A;  4BR6 A;  2F4V O;  1Y74 A;  1MSD A;  2LGW A;  4MVQ A;  4TV8 B;  4HYO A;  3OTO B;  4UCS A;  4J42 A;  2N05 A;  3JAT A;  4B3T O;  1M90 W;  4RUE A;  3BHP A;  2P5O A;  2E75 B;  2HHH O;  1Q6U A;  4JI5 O;  3K5N A;  1VQL V;  3CC7 V;  2WPD G;  1GN3 A;  2JK5 C;  1Y76 B;  2QWP B;  3LSU A;  1AJP A;  1ZUQ A;  3RVY A;  5GTH Z;  3UQ8 A;  2YXH A;  1O9H A;  2MW2 B;  1V54 C;  4UV8 A;  4HBN A;  1SA0 B;  2RDC A;  3OMI B;  5B1O A;  3CJH A;  4F6E A;  2Q9L A;  4N23 A;  2HJF C;  3BAB A;  1Q90 D;  4LF9 B;  2BE3 A;  4YJ2 A;  1YZB A;  1EN5 A;  1SC5 B;  2RCV A;  5L3C A;  1CEZ A;  1F4M A;  4G27 B;  5EYP A;  4FFK A;  2Q69 A;  1N0J A;  1SQF A;  2VWJ A;  4UUJ C;  5KUK A;  3JAR B;  2LFS A;  1MA1 A;  5IJ0 B;  4KHP O;  2ZQM A;  4P30 A;  2GHY A;  2DWD C;  2OIG A;  4LR3 A;  5K1X A;  3CEI A;  1K7D A;  1R1B A;  1XNQ O;  3ETQ A;  3AG7 A;  2Z5U A;  5A9G A;  3UCS C;  5H9C A;  2EJ7 A;  4JI8 B;  1AB3 A;  3OAA G;  4IL6 Z;  4LH7 A;  3G6E V;  3SPJ A;  1NR7 A;  1TUB A;  5KX5 A;  2GSM B;  4GCZ A;  1AR4 A;  2EX3 A;  1COW G;  2QKS A;  2JGU A;  3AK3 A;  5LGU A;  1R3I C;  4DUY B;  3N2G A;  3JAL A;  1BS3 A;  1GO3 F;  3LSS A;  1VMG A;  4BWA A;  1N33 O;  2GTA A;  3EVK A;  2VQF B;  3OFN G;  3W7X A;  3CCV V;  4JAU A;  3ZRW A;  2CDY A;  4DUZ O;  3W7T A;  4NXN B;  4ZIB A;  2WLI A;  1RP3 B;  4O4L A;  3HKD A;  2LJ2 A;  3AEI A;  1PNM A;  3KCY A;  1RPR A;  4LFC O;  2ZKO A;  4CBC A;  2Y69 C;  5L3D A;  4FLU A;  3R66 A;  1SZT A;  2AW9 A;  3K06 A;  2QSA A;  2OCC B;  1L1F A;  1N36 B;  5B3S B;  2XAF A;  4J7J A;  4FLW A;  3LNN A;  3ZBH A;  2R9A A;  3CME V;  4B3M O;  4MVZ A;  2HVK C;  1LUW A;  4GKJ B;  2YIB D;  4X20 B;  1B3Q A;  2X6A A;  4P9P A;  3ZX6 A;  5EBL C;  3EHB B;  4TV9 B;  2EIK C;  3ASO C;  4FM0 A;  4LCU C;  2UUC B;  4JI0 B;  3ABK C;  4MTG A;  1Y4M A;  1QCE A;  3FYI B;  5KMG B;  3RW0 A;  3H1K H;  3OTO O;  3ZHV A;  1FFX B;  4O4H A;  2CH7 A;  5HFM A;  3T1C A;  4B3R B;  1WP8 A;  3DC6 A;  1QHT A;  4GKK B;  1Z5W A;  1JA8 A;  3E22 B;  1SS3 A;  4GX1 A;  4X65 O;  1YJ9 V;  1FPO A;  3CX5 F;  2JGD B;  1XMQ B;  2C2A A;  1U97 A;  4JI3 B;  3OM3 B;  5IDJ A;  4YJ3 A;  4A5U B;  5GON B;  5CBH A;  4IHJ B;  4JI2 B;  4FFB B;  4C7U A;  1EBO A;  2LP7 A;  5JCO A;  4J10 A;  1H2G A;  3JD4 A;  3ABU A;  1J5E B;  1KKD A;  4H13 B;  3ZHU A;  4N21 A;  5K1P A;  1OCC B;  4LBE C;  2BTQ A;  3TET A;  4H0L B;  5JQG A;  5KHG A;  3FAV B;  4DXW A;  5B1N A;  5JCO C;  3CCS V;  2KG7 B;  4FIP C;  4LF9 O;  1XNR B;  2XT9 A;  3SYA A;  4CZZ A;  1UFI A;  5B1B C;  4FM2 A;  3H01 A;  4JPR A;  4YHH O;  1I7F A;  1JJO A;  3THO A;  1H8E G;  1KBH A;  1GTO A;  1SQB H;  2Q0A A;  4RO2 A;  4UVB A;  1J95 A;  4NYK A;  1Y76 A;  4X89 A;  2VQE B;  3H9V A;  1V55 C;  3FD9 A;  2W0X A;  1E1R G;  4KP4 A;  2R70 A;  2L35 A;  5KAI Z;  4CH4 A;  2ZXW B;  3OR6 C;  5EIB D;  4YY3 O;  1SA0 A;  3JYC A;  3ABL B;  2W6I G;  2H3O A;  1SER A;  3JAS A;  4LFA B;  4JI8 O;  1N32 B;  2PYL A;  5LGT A;  3CCE V;  2YIA A;  2VRZ A;  3G71 V;  5IYD O;  3CP1 A;  3BA9 A;  3K79 A;  2ZE6 A;  4PDR A;  5L3G A;  2WLM A;  5JVD B;  1BT8 A;  1RSO B;  4OGQ B;  4X62 O;  3EFF K;  2A7W A;  2Q7G A;  4I7Z B;  2CTR A;  4LF4 B;  2DN9 A;  2Q0O C;  4DRX B;  4ICG A;  3ZRS A;  4J7Z A;  1IXM A;  1EFR G;  2UUA B;  5BR8 B;  2CK3 G;  4FLY A;  4YIO A;  3BCC H;  1RPO A;  5EIB C;  5BY1 A;  2KQX A;  2WA4 A;  2PI4 A;  1AJN A;  2LW1 A;  1AR5 A;  1ORQ C;  3SYP A;  1BCC H;  3K08 A;  1QLE B;  5EK0 A;  1JOY A;  1K92 A;  5LA6 B;  2V7Q G;  1QVG U;  3H1H H;  5LOV B;  3E35 A;  2UU9 B;  2ETN A;  2YIC A;  3K0D A;  3WB1 A;  2QKC A;  3JAW B;  2ZR3 A;  1W59 A;  1N36 O;  4UB6 Z;  2X7R B;  1VF7 A;  4FLV A;  2HEP A;  3L9D A;  1US6 A;  3BRC A;  4GKJ O;  1BQZ A;  2R72 A;  5LP6 A;  1YF2 A;  1YXB A;  1G1X B;  2XUM A;  4OX9 B;  2LO1 A;  4KL1 A;  2Q6A A;  5EBM C;  1KEC A;  2UUC O;  5IT9 N;  4JI0 O;  4PI0 A;  1AI4 A;  3SR2 C;  3CE2 A;  2BCC H;  1IXB A;  5A2Q N;  2RQ6 A;  1S77 D;  3HKE B;  2LFR A;  1R3J C;  4IYH A;  4IGG A;  1W0J G;  3BPZ A;  5E1A C;  4GKK O;  2IJK A;  4RAI A;  2ZDI A;  3LDC A;  3STL C;  2JJ1 G;  3RYF A;  2ZM6 B;  3STZ C;  2Y4T A;  1N4C A;  1XMQ O;  1YJN V;  4NKG B;  1VQ8 V;  4L8J A;  4UFZ A;  4JI2 O;  2P67 A;  3IJ4 A;  2LW7 A;  3VOU A;  5C93 A;  4I0X B;  2N04 A;  2IBZ H;  4PV1 B;  1YTF D;  3CYO A;  3L74 H;  4D6T H;  1DK1 A;  2Z0A A;  4TV9 A;  4JAS A;  1I94 B;  2ZDI C;  4F6R B;  3LSQ A;  1JNB A;  4P2Z A;  4PEL A;  1KP3 A;  1Y67 A;  2DOS A;  5KMG A;  4JV5 B;  5JH7 A;  3J80 N;  5B1A B;  3ZMS A;  1JJ2 U;  1KC8 W;  1R6K A;  3BVO A;  2LQT A;  5IJ9 B;  3OT7 A;  5J2T B;  1F7Y A;  3E22 A;  1XNR O;  3CB2 A;  4PDV A;  1SRY A;  4WFA V;  1QR8 A;  2IW5 A;  3L75 H;  2JS3 A;  3HR0 A;  3B2E E;  4Z2W A;  3H1J H;  3WB2 A;  1IX9 A;  5KAF Z;  1OCZ C;  3LDD A;  4MTX A;  2V4D A;  1EZJ A;  2OWO A;  3ASN B;  3S3W A;  2VQE O;  2BSK B;  3JCZ A;  1F51 A;  4X1K B;  2WLK A;  1NTZ H;  5EZY A;  4HNA A;  4JAV A;  4X88 A;  4LNU A;  3CS5 A;  2EBO A;  3CCM V;  4MVS A;  3A2F A;  4LFA O;  2YXL A;  2ZD9 A;  2OIE A;  5GW7 A;  1HNX B;  4J9Z B;  3SJC C;  2CE4 A;  5CB4 B;  2FML A;  3Q4H B;  1PM9 A;  1NBM G;  4IIJ A;  1YJW V;  4Z1M G;  2Q7E A;  1JFF A;  1A32 A;  4DR3 B;  5CMU A;  2WLL A;  4X64 O;  2QM7 A;  3JSN A;  5EC2 C;  3GWK C;  3AK2 A;  3T1H B;  1FXK A;  2UUA O;  2KB1 A;  3HKB B;  5BR8 O;  3MHS C;  1DF4 A;  1H2K A;  4E4E A;  1S0V A;  3AG2 C;  2PZS A;  1OCR C;  1FJG B;  1H2N A;  3VQX A;  4I50 B;  4U3F H;  2FKX A;  2QWQ B;  1ENV A;  3JD2 A;  2ITC C;  3L70 H;  2VS0 A;  1FXK C;  1IBL B;  1L0N H;  3ETG A;  2UU9 O;  4AQY B;  3ZED A;  4MVM A;  3SYQ A;  5CBG A;  2H8P C;  3TK1 A;  3ZIA G;  3QTC A;  3JSL A;  3I56 V;  5AG2 A;  1GAX A;  4L87 A;  3GWO A;  3OUF A;  3K3W A;  4WBN B;  3EXA A;  4MSW C;  3CRR A;  4MTO A;  1YI2 V;  4MT8 A;  2D3O W;  4DV0 B;  5F2V O;  4NXM O;  2EIJ C;  5IE9 A;  1ZLZ A;  2Z3Y A;  4OX9 O;  2YXY A;  1H2M A;  1X59 A;  4FLZ A;  4O2B B;  3ZJZ A;  4DV6 B;  1P4R A;  2F95 B;  3A0B Z;  5KHJ A;  2JVD A;  5KHK A;  1PNL A;  1WA8 B;  4X8A A;  1BMF G;  1V55 B;  2B9Z A;  4WFB V;  4DV7 B;  1P7B A;  1K97 A;  1EN6 A;  1G4Y B;  1EZV H;  4QIW F;  5LYJ A;  2OYQ A;  3MDS A;  1BL8 A;  3SPH A;  1M5I A;  3WB0 A;  5FL7 G;  1URF A;  3OEH G;  3HKC B;  1GM9 A;  1OV9 A;  1PNK A;  5FNV B;  3J81 N;  3E8G A;  4O2A A;  2Q5Z A;  3TXQ A;  4X1Y B;  2Y48 A;  1I94 O;  3OGI B;  4JZ2 A;  1JX9 A;  4MS2 A;  3RYI A;  1XEQ A;  1Z2G A;  4D7S A;  3BEH A;  4JV5 O;  3MHH C;  1MZF A;  2CGN A;  3OUS A;  1TAE A;  2DJV A;  1OJH A;  4JTC B;  4K0K B;  1FXH A;  1NH2 D;  1B6Q A;  1PP9 H;  1TGO A;  1Y6X A;  4JZG A;  4TUY A;  1RM1 C;  1PD3 A;  2QKA A;  3UO3 A;  3K57 A;  1GMG A;  1IDS A;  5ITZ A;  5LHG A;  3X2Q C;  1M56 C;  2BOB C;  2GBO A;  5FLX N;  2WA3 A;  1LNQ A;  2Q73 A;  2W0F C;  2EIM C;  4QE7 A;  5J9P C;  4O4J A;  1NZ6 A;  3AG1 B;  5HFL A;  2JDI G;  3B8N A;  1FAF A;  1VF6 A;  3MAQ A;  2PYJ A;  5IYB O;  3WU2 Z;  4NR1 A;  4JYA B;  4IYI A;  4UCU A;  1W0K G;  4DR1 B;  4EKW A;  2QR4 A;  3KKY A;  1I5Y A;  1NTM H;  4CS3 A;  2QDO A;  3P32 A;  5DM6 V;  3P30 A;  3ZN1 A;  3P3N A;  5IYZ A;  4PD4 F;  3T2M A;  1RFY A;  1QNM A;  4DR3 O;  3D3Q A;  2QM4 A;  2QTS A;  2EIN C;  3K03 A;  1ZWI C;  5IWA O;  2E5L O;  2BSK A;  4ZI7 A;  4GX5 A;  3F7Y C;  1GN2 A;  3SJB C;  1TA8 A;  3CRA A;  4LP8 A;  4ZHQ B;  3T1H O;  1GKF A;  1YDX A;  4JI6 B;  4MVU A;  3W7W A;  4NB5 A;  4J9Y B;  1NI8 A;  1DF5 A;  1HNW O;  2GUZ B;  1FJG O;  5J2U B;  1TVK A;  4K35 A;  1K33 A;  2AZ2 A;  1L8D A;  4TSF G;  3JAK B;  3FB7 C;  1IBL O;  3O65 A;  5LHH A;  4AQY O;  1YIT V;  1WAZ A;  3C3T A;  3K9S A;  4J80 A;  4CH3 A;  3F5W C;  4BW9 A;  3F5T A;  2HJD A;  1EM1 A;  3O9O A;  1AJQ A;  4I9W A;  3CD6 V;  1VEW A;  3FKS G;  1HP8 A;  2DYS C;  3SJQ C;  1AI5 A;  2IH3 C;  4HZ3 A;  4DV0 O;  4DW1 A;  4PA3 A;  3ZCC A;  1PPJ H;  2QJ1 A;  4UCR A;  5BMV A;  2Y0P A;  2QEX V;  5LHI A;  4PA7 A;  3ZMU A;  4CS2 A;  2DW4 A;  1Y66 A;  4DV6 O;  1OCZ B;  5LMN B;  5CA1 B;  3RYC B;  2DQ3 A;  2QA4 V;  2YEV B;  4PA6 A;  4DV7 O;  1YTF B;  4U3J B;  3N2K B;  2EZO A;  4GX2 A;  1NQT A;  4I55 B;  4TV8 A;  3VQW A;  3B8M A;  4P9O A;  2P4K A;  4KXR A;  4KFM A;  3H1I H;  2JS5 A;  4DV1 B;  4Q6G A;  2P22 C;  3NXS A;  5EBW C;  2GDS A;  4LWS B;  4AI8 A;  5C8Y B;  2UUB B;  4UCV A;  1K73 W;  1N8R W;  4I4T B;  1VQ4 V;  1N34 B;  3G67 A;  1Q7Y W;  4LF7 B;  1Q6I A;  1SQV H;  3A0H Z;  5TIS Z;  4JI7 B;  1PV0 A;  4LFB B;  1NR1 A;  4K0K O;  3KDR A;  2WWW A;  4XDL A;  2IU3 A;  3QO5 A;  4DR2 B;  3WG7 C;  3D3I A;  1S5J A;  2IH1 C;  2CTQ A;  3OR7 C;  4O4I B;  4DW0 A;  3P3P A;  5GTI Z;  5CA0 B;  4D7T A;  2HLD G;  4DR7 B;  1R3L C;  1I5X A;  4DYL A;  4JF3 A;  3W7U A;  2WSS G;  1OCR B;  4ZOL B;  3UT5 B;  4DV4 B;  4CH5 A;  2EIL B;  4Z1V A;  2ODM A;  3U11 A;  1SET A;  5LXT B;  1F23 A;  5H2F Z;  2OCH A;  4H33 A;  4X1Y A;  1IJG A;  3ZMZ A;  5FPR A;  2P6J A;  1JQ0 A;  3L71 H;  4ABM A;  4DUY O;  2LGQ A;  4I5S A;  1XL6 A;  3JAR A;  4BAY A;  4FJC C;  5CN0 A;  1UJW B;  5IJ0 A;  4B08 A;  4JYA O;  3E8F A;  2UXN A;  1S72 V;  4E2L A;  2VQF O;  1YIJ V;  4UVA A;  5B66 Z;  1N0N A;  1PL4 A;  1F4N A;  2DE0 X;  5LGN A;  3G6B A;  4DV2 B;  3K5O A;  4B3S B;  4NXN O;  1UPG A;  2DQ0 A;  1M9N A;  1Q3E A;  3HB3 B;  3ZHQ A;  2QTO A;  2P90 A;  1Y74 B;  2K9P A;  1H5W A;  3CXH F;  3ZMT A;  3JAT B;  4JI6 O;  4JGS A;  1OCO C;  4Q20 A;  3B77 A;  3CCL V;  3ETE A;  2YSU B;  4WFH A;  3W7S A;  1V9P A;  1M57 C;  4W4K A;  4JTA B;  4DR6 B;  1V54 B;  2RJZ A;  3RN4 A;  5B5E Z;  2WLJ A;  1XOU A;  1WPX A;  2QM8 A;  3UKM A;  1I0H A;  4U7O A;  2ZCE A;  1MG1 A;  1Q8I A;  1HWY A;  4JYY A;  3D36 A;  2N74 A;  3T4D A;  3CJH B;  3BY6 A;  3LDE A;  3ZHS A;  1AP6 A;  1MAB G;  3AG4 C;  1KB9 F;  5LP6 C;  2QWO B;  3H1L H;  4B3R O;  4DK1 A;  1QR9 A;  4AHC A;  3A8T A;  3FB6 C;  3ZN0 A;  2HHH B;  5KA5 A;  1M56 B;  2Y4U A;  4LF5 B;  3D36 C;  5EYP B;  4JI3 O;  5CBF A;  5KLV H;  5LMN O;  4DO2 A;  2P06 A;  3IC9 A;  1H8H G;  4X20 A;  2EIM B;  4DR4 B;  2B5U A;  2OCC C;  3OMA B;  1JR9 A;  2AHZ A;  2HKO A;  1J5E O;  2OTJ V;  3ABM C;  3AG3 C;  4TWK A;  3GB7 C;  5B3S C;  4DV3 B;  1BQ0 A;  2RMK B;  1M1K W;  3K5L A;  1FFX A;  3N27 A;  1VIB A;  3QNE A;  1KKC A;  1WN7 A;  4DV1 O;  2YC0 A;  1R6T A;  2AXT Z;  1TUB B;  5KX5 B;  1NH2 B;  5JJJ B;  2KSD A;  2JGD A;  3N2G B;  1N34 O;  4OPH A;  3JAL B;  4LF7 O;  5GON A;  4IHJ A;  3CC4 V;  1XDC A;  2XAH A;  1M93 A;  2M7W A;  2EIN B;  4FFB A;  3ZHT A;  3HPL C;  5E79 Z;  3SYO A;  4KHP B;  4JI7 O;  2MK3 A;  2HP8 A;  4LFB O;  1YEW A;  3GVM A;  3VQV A;  4CH6 A;  4JI4 B;  3F7V C;  1DLB A;  4DR2 O;  1ZSP A;  2Y69 B;  3DGE A;  3N2K A;  3ZRW B;  3RGB A;  4DR7 O;  1Q5O A;  4RWU A;  4PJ0 Z;  1BGY H;  3VBB A;  5IYC O;  1K5S A;  3FAV A;  2WLI B;  4J11 A;  1XRE A;  2ATK C;  4O4L B;  4PA4 A;  1Q82 W;  2ITD C;  1N32 O;  4DV5 B;  1BE3 H;  2UXC B;  3HKD B;  4DV4 O;  2P4V A;  4MW3 A;  2KG7 A;  2ZNJ A;  4LF6 B;  2ZE7 A;  2Q8V A;  4K8X A;  4XBF A;  3L73 H;  1OCC C;  1S3J A;  1FKA O;  1E1Q G;  2DWE C;  2Q4P A;  4J41 A;  5H6Q A;  1CP9 A;  2DYR C;  2EIK B;  3RBZ A;  3ASO B;  2R9R B;  3FFQ A;  1N33 B;  1AVM A;  2UXX A;  4LF4 O;  3ABK B;  1XBL A;  1K5Q A;  5JJE B;  4WFE A;  1NVP D;  2RNB A;  2DYS B;  3JD3 A;  4DUZ B;  2ZIO A;  1FYJ A;  1JCH A;  4PDM A;  1B04 A;  3APQ A;  1ZL8 B;  2O57 A;  1MZE A;  3U10 A;  3PN1 A;  3FB5 C;  5CA3 A;  4R6Z A;  2ZR2 A;  3QO7 A;  3RT3 C;  1D2D A;  4XDJ A;  3OE7 G;  4O4H B;  1WLE A;  3ABL C;  1JVM A;  2CH7 B;  4TQF A;  2QGN A;  3IC7 A;  1AP5 A;  5JVD A;  2F93 B;  1E79 G;  4WFF A;  1RSO A;  1WB7 A;  1IUR A;  1K4C C;  4DR6 O;  2ZIN A;  1VF5 B;  4LH6 A;  1L0L H;  4DRX A;  2W6J G;  4YJ3 B;  1VQ7 V;  2H94 A;  2AHY A;  1NTK H;  3CC2 V;  1SKV A;  2IJJ A;  4FLX A;  4G28 B;  2BTQ B;  3ETD A;  2CAZ C;  1SES A;  5B1B B;  4CC5 A;  1XHX A;  2OT5 A;  1VQK V;  3RYH B;  5JQG B;  3QG5 A;  5LA6 A;  5LOV A;  5LL6 Y;  3OTF A;  1O9G A;  3JAW A;  3RFR A;  3T4Z A;  3WG7 B;  1K3E A;  2BOC C;  4X65 B;  1WNS A;  3K9A A;  4QGP A;  2ZM6 O;  2JEU A;  3KCX A;  4WFG A;  2IJI A;  1THZ A;  4LF5 O;  1S5L Z;  1QLE C;  3ZS8 C;  3J7A U;  1KUQ A;  4IT5 A;  1TUE B;  2UXB B;  1WP7 A;  4CC6 A;  1YSC A;  4DR4 O;  1P84 F;  3ZMV A;  2E74 B;  3TXS A;  1MMM A;  3CWB H;  2YI9 A;  1VQN V;  2D2C B;  4DV3 O;  1P7G A;  3JAS B;  3QVN A;  3HKE A;  4GYC B;  1YCI A;  2V1D A;  4QJF B;  2WLN A;  4X66 B;  2DMX A;  2E76 B;  3AK1 A;  4UB8 Z;  3E8H A;  1XMO B;  4YHH B;  2A3Q A;  4G2K A;  4I0X A;  4RQE A;  2F43 G;  4B7K A;  3SGI A;  3SPG A;  4JI4 O;  1Z5V A;  1SF9 A;  3DXR B;  2NR5 A;  3DTU B;  2NNU A;  1G8M A;  3BA8 A;  4F6R A;  4YY3 B;  1OCO B;  2FB5 A;  4U7N A;  4LF8 B;  4YXW G;  3QO8 A;  4UV9 A;  1M57 B;  4JTD B;  4ZBM A;  3RWR D;  1M4U A;  4YIP A;  2UXC O;  3E86 A;  4DV5 O;  1FS0 G;  3C90 A;  3L72 H;  3ZRV A;  1HNX O;  1QVF U;  3CHX A;  5IJ9 A;  5J2T A;  4LF6 O;  5LBQ A;  1OHH G;  4UXN A;  1XHZ A;  5IY5 C;  3FYE B;  2B1I A;  2A79 B;  1VF6 C;  4J7K A;  5DN6 G;  4X62 B;  2ZE8 A;  5B1A C;  1XUQ A;  2ZIM A;  1H38 A;  1IBK B;  1Q6H A;  1Q81 W;  4X1K A;  1JMK C;  3OW2 U;  4GX0 A;  1QQC A;  3AG4 B;  5LP6 B;  1PL0 A;  1FOU A;  2F66 C;  2YI8 A;  1KU9 A;  3FB8 C;  2IM9 A;  3SYC A;  3ASN C;  1ROP A;  3G80 A;  3WFV A;  3ZHR A;  1K9M W;  1D5A A;  5CB4 A;  3Q4H A;  3BFR A;  2XHB A;  4UVC A;  4X9Q A;  2PGG A;  3IFX A;  3K0G A;  2ADP A;  3ABM B;  2EZP A;  3AG3 B;  2Q67 A;  1R73 A;  4PHZ A;  1KD1 W;  3RYF B;  1BHB A;  2XTA A;  5L3F A;  3B4S A;  3I5D A;  3E8B A;  1VQO V;  3CSX A;  3HKB A;  2R9I A;  2X0L A;  3CCJ V;  3CCQ V;  5LMU B;  1ZL8 A;  1KMI Z;  4QPJ A;  1Q86 W;  2CTP A;  2ZT9 B;  4BW5 A;  5KA6 A;  3APO A;  4I50 A;  3JAM N;  1GH6 A;  4DR5 B;  1LR1 A;  2FL4 A;  1HR0 B;  1Q43 A;  4MVO A;  2YDE A;  2XAJ A;  3ABT A;  5JH7 B;  4EFB A;  3JCU Z;  1K4D C;  1DGS A;  3RVZ A;  2YIB A;  5D5P A;  4F4L A;  5H6R A;  4DK0 A;  1NKD A;  3E83 A;  3KG2 A;  1R3K C;  3SJA C;  1W2B U;  4FPP A;  4WBN A;  4NTW A;  3ICX A;  4I9Q A;  1OZ0 A;  3DC5 A;  2UXB O;  3G4S V;  4R7C A;  3TGU H;  1SZX A;  4KUM A;  1YHQ V;  2JRI A;  5EZY B;  5L3E A;  1NJI W;  4FVM A;  4UCT A;  4HNA B;  4O2B A;  4NVP A;  1S5H C;  4LNU B;  3RYH A;  1B06 A;  4EB6 B;  1SQG A;  1CXZ B;  2DYR B;  1HDJ A;  3E89 A;  1WA8 A;  4ASU G;  3CMA V;  2XAG A;  4X66 O;  3MD0 A;  1VQM V;  1FXV A;  1XMO O;  1YVW A;  2Q68 A;  4MTF A;  4K3A A;  2PF4 E;  4IIJ B;  5KHH A;  4FZ0 A;  3AG2 B;  1VP7 A;  1JFF B; 
#chains in the Genus database with same CATH homology
 1JR9 A;  2CDY A;  2ADP A;  1WB8 A;  1GN3 A;  3C3S A;  3LSU A;  1D5N A;  1N0N A;  3AK1 A;  1ZUQ A;  1PL4 A;  1IX9 A;  2QKC A;  1XIL A;  1ZLZ A;  1EN4 A;  1AP5 A;  1WB7 A;  1BSM A;  1KKC A;  3KKY A;  4F6E A;  2AW9 A;  4GUN A;  1GN6 A;  1QNM A;  1EN5 A;  1XDC A;  2P4K A;  1I08 A;  3TJT A;  1LUV A;  1EN6 A;  2RCV A;  1MNG A;  2GDS A;  3MDS A;  2CE4 A;  4YIP A;  4FFK A;  1GN2 A;  1N0J A;  1IXB A;  1LUW A;  3RN4 A;  1ZSP A;  1MA1 A;  1PM9 A;  1GN4 A;  3CEI A;  1XRE A;  1I0H A;  1VAR A;  3KDR A;  5A9G A;  3DC5 A;  2ADQ B;  4JZ2 A;  3AK2 A;  1XUQ A;  1SZX A;  4JYY A;  1ZTE A;  1BT8 A;  4E4E A;  3DC6 A;  1JA8 A;  4BR6 A;  1AP6 A;  1MSD A;  3C3T A;  4JZG A;  1B06 A;  3K9S A;  1AR4 A;  2QKA A;  3AK3 A;  1IDS A;  1EM1 A;  4YIO A;  1AVM A;  1MMM A;  1Y67 A;  4C7U A;  1BS3 A;  1VEW A;  1AR5 A;  3EVK A;  1P7G A;  3IC9 A;  3BFR A;  3QVN A;  4X9Q A;  5AG2 A;  3OT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...