4BR6A

Crystal structure of chaetomium thermophilum mnsod
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
b'KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Crystal Structure and Biochemical Characterization of a Manganese Superoxide Dismutase from Chaetomium Thermophilum.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 72
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4br6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4br6A02
1Y67A 3DC5A 1ZUQA 1IX9A 3AK1A 4BR6A 1P7GA 3C3SA 3DC6A 3BFRA 1N0NA 1ZSPA 4E4EA 3KKYA 3EVKA 3LSUA 1GN6A 1GN4A 1I0HA 3K9SA 1WB7A 1SZXA 1AP5A 1EN6A 1BS3A 1QNMA 3OT7A 5AG2A 1I08A 1WB8A 2RCVA 1ZLZA 1EN4A 1XDCA 1IDSA 1LUVA 4GUNA 1LUWA 1VEWA 1GN2A 1B06A 1PM9A 2AW9A 2CE4A 1PL4A 5A9GA 1N0JA 4YIOA 2ADPA 4JZ2A 2QKCA 3C3TA 4YIPA 3TJTA 1EM1A 1BT8A 2QKAA 2GDSA 1MA1A 1VARA 3RN4A 3QVNA 1XILA 4F6EA 4FFKA 1AVMA 3AK3A 1D5NA 1EN5A 2P4KA 2ADQB 1MMMA 1AP6A 1MNGA 3IC9A 1AR5A 3AK2A 1JR9A 1BSMA 1IXBA 1KKCA 1GN3A 1AR4A 4JYYA 3MDSA 1XUQA 4X9QA 3CEIA 1JA8A 4JZGA 1ZTEA 1MSDA 4C7UA 2CDYA 1XREA
chains in the Genus database with same CATH superfamily
4R8CA 4Z1VA 3TGUH 3ZHUA 1FJGO 1Y66A 4U7NA 2ZM6O 1IX9A 1XNRB 2BTQB 3N2GB 4QPJA 4PI0A 1XHZA 2P90A 3KKYA 5IJ9B 2XTAA 2DJVA 2HEPA 3SGIA 3JATA 1H2LA 2IU3A 1AJQA 2UUCB 2Z0AA 5KMGA 2VQEO 3G6BA 1Q43A 3EFFK 4R6ZA 4BW9A 2DMXA 1R6NA 2G38A 3T2MA 3CRAA 4EFBA 4O4IA 1BL8A 1XNRO 4NR1A 1RSOB 4FZ0A 2QEXV 5EK0A 2QKSA 2DW4A 2FMLA 2WWWA 3QG5A 2FL4A 1Q81W 3OR7C 5KUKA 2QKCA 1AJPA 2DQ0A 5D5PA 3JAWB 2UUCO 1WJZA 2Q0AA 1WP7A 1Q3EA 1YVWA 1QHTA 3QVNA 1RPOA 4GX5A 3L9DA 3QTCA 5KUMA 1XILA 4O2AA 4X62B 2Y4UA 4O4JB 2F93B 4LF7B 4QE9A 2LGQA 1MOFA 4TWKA 1KECA 4O4HA 1GN3A 1ZAUA 4Q6GA 3AG1B 3IJ4A 3RBZA 5CA3A 4K8XA 4EEQA 1ZTEA 2BSKB 4MTGA 3AG1C 4C7UA 1G1XB 3CCJV 2XAGA 4LFCB 2IBZH 5IYCO 3FAVB 5FL7G 2L6LA 2H3OA 3RW0A 1Y6XA 5KX5B 4X62O 3DC6A 4O4HB 1FAFA 1DK1A 1DLBA 1FFXA 4B3SB 3BPZA 4W4LA 1PD3A 4B7KA 3FX7A 4LF7O 4I7ZB 2JDIG 1WA8B 4MVZA 4FK5C 4ABMA 5JVDB 4DR7B 1UFIA 2HP8A 5H6RA 2YC0A 2F43G 1CP9A 4WFGA 4DYLA 1YXBA 1GKFA 4LFCO 1M90W 1HR0B 1Y76B 4WBNA 4JI2O 1M1KW 1M56B 1GM8A 2Q73A 4FFBA 4B3SO 4KHPB 1M56C 3G80A 5L3DA 2VQFB 2B5UA 5IYZB 2ZXWB 1RM1B 1SESA 1FPOA 2ZXWC 1V55B 1RM1C 4X1IA 3JCZA 3OR6C 4FVMA 5EYPA 1ORQC 1V55C 1BGYH 1K33A 2HG5C 1S72V 2PYLA 2WA4A 2P4KA 2WLLB 1VQLV 3E22A 4J9ZB 1HR0O 2RN9A 1QQCA 2KQXA 3HKDA 1Y74A 4NVPA 3GB7C 4DV4B 2IJIA 3KDRA 1P84F 4O4LA 5JH7B 2P67A 3UCSC 1NVPB 3RFRA 1IXMA 1PNLA 2VQFO 4IHJB 4F6RB 3I56V 2Q68A 2GUZA 1QLNA 3VQXA 3ZRXA 1ROPA 1Q6IA 1R3IC 4NYKA 4I5SA 2Q0OC 2NLJC 4CH5A 4CH4A 5LP6B 4O4LB 1H8HG 3D36A 3ZMVA 4PA4A 4ZOLA 3U0ZA 1DTOA 5LP6C 4ZHQA 1SF9A 4MS2A 1G6UA 5CB4B 3HKCB 2YXHA 2ITCC 4J7KA 1H5WA 3CC7V 4DK1A 1SA0B 3UO2A 3CRMA 1S5HC 2HKOA 2RCVA 5H6QA 2UUAB 2YIBD 3E8FA 3M8AA 1K5SA 4ZHQB 5CA1A 1GN2A 3E86A 4P30A 1HW7A 1TVKA 4DR1B 3VQYA 1FXVA 1Q5OA 4EB6A 4TQDA 2R9IA 1Q6UA 1GH6A 2YIAA 4X89A 2YIBA 1XOUA 2ADPA 3ABKB 4ICGA 3ZHTA 1JVMA 4YY3B 3APOA 3ABKC 1GRJA 2UUAO 3HPLC 4F6EA 2EINB 3AEIA 1K97A 2GHYA 5H5NA 4ZI7A 4LF4B 3L71H 2EINC 4DR1O 1F7YA 3ABLB 5IY5B 1DF4A 3AK2A 2VWKA 1KKCA 1AI6A 3DGEA 4GZRB 4GLXA 4CC5A 5IY5C 1XUQA 2Q6AA 3RYFA 5IDJA 3H01A 1PL0A 3W7WA 3RYHB 2EJ7A 4DR2B 4YY3O 2N74A 2X7RB 1AR1B 1PNKA 3ZS8C 4JYCA 3K5OA 1H2MA 2JJ1G 1JMKC 1YJWV 3N27A 3AK1A 2JEUA 3L73H 4I4TB 4I50B 4LF9B 2JGDB 1TGOA 3UM7A 4LF4O 3B09A 2XHBA 3RYFB 4G27B 2K9PA 2YXLA 3U10A 1K8AW 5JJEB 3UT5A 2YIDA 5D5QA 5LXTA 1AP5A 1IZ3A 4MT8A 1XMOB 2W6JG 2ZQMA 2LP7A 4DR2O 2CTRA 1AB3A 4JI8B 1QLEB 1XDCA 1M9NA 2WAMA 1KP2A 1QLEC 2UXXA 4FMTA 1B06A 4X1KA 4LF9O 3EXAA 1P49A 3CWBH 4J41A 2P7TC 5KHJA 1IBKB 4PDVA 3CCQV 3SR2C 3CE2A 1WN7A 4FM1A 4HNAB 3C3TA 4AILC 3TCUA 2ZNJA 4J7JA 5IJ0A 3RN4A 2NR5A 1H2KA 2YSUB 4JI8O 4X1KB 3CCVV 3OTFA 2ZDIA 3OUFA 3TXSA 1J5EB 1M4UA 3OMIB 1ENVA 1YTFD 4KP4A 3D3IA 1OCCB 3QF7A 1H2NA 1K9MW 1JR9A 1IBKO 5ITZB 2HJFC 1AR4A 1Q90D 1OCCC 2EIMB 2FTKA 3FKSG 4JTCB 2EIMC 2EBOA 4GT1A 4D7SA 3LDEA 5DEDA 3BVOA 3CRCA 3QO7A 1SRYA 3ABMB 3E8BA 1P7GA 4F4LA 2WSSG 3CJHB 1J5EO 5BMVB 3ABMC 1N0NA 4RQEA 1ZSPA 3ZMUA 1BQ0A 3A2FA 3LSUA 3RT3C 3ZCCA 3SYCA 2KG7A 2ZIOA 3JD4A 2P22C 2Y4TA 4EFEA 1NH2B 2PI4A 1HWYA 4BAYA 5AG2A 2HVJC 3JAKA 2W0XA 3ZRWA 1FS0G 4PA7A 3ZHQA 3K0DA 1JFFA 2CGOA 4DV1B 5JJNB 1QVFU 2ZNIA 4UCUA 4QGPA 1ZWIC 1YZBA 1B3QA 1G4YB 1AI4A 5KHKA 4PDMA 3BCCH 4I0XB 1N33B 3ML0A 3JAKB 1WAZA 1SQQH 1BT8A 3ZRSA 1SQVH 3S3WA 5JWPA 3W7SA 1XNQB 4OPHA 4AQYB 5LHHA 3AG2B 1VF6A 5IYBO 1ZL8B 3DXRA 2JEXA 2IJHA 1AVMA 4DR3B 1MMMA 1PKXA 4TV8A 2WLJA 2VS0A 3AG2C 4DV1O 1KC8W 2A7WA 2E74B 3OEHG 3E8GA 4NKGB 1FXKA 4XDKA 5LYJB 1BCCH 4H0LB 4JI0O 3AG3B 3K04A 1N33O 3H1KH 1F23A 1I5XA 3W7TA 4UCSA 1KUQA 3AG3C 3K5MA 1Y67A 1X4TA 1VQKV 1SKVA 4PA3A 1XNQO 2IU0A 3LUTB 2EIJB 4AQYO 2PGGA 4TUYB 1JCHA 3C90A 5TISZ 2BTQA 4DR3O 3N2GA 2EIJC 2P06A 4X65B 1S3JA 2AZ2A 4JI7B 4IIJA 5IJ9A 1YIJV 4ZKIA 1K4CC 2VQEB 4DR6B 1HNZO 3SYOA 1OHHG 2QA4V 1O9HA 1P7BA 3OT7A 3I5DA 1SERA 1ZLZA 4DRXB 2GTAA 5B66Z 1CEZA 5JCOC 1D2DA 2X6BA 5BXZA 4GUNA 2JS5A 4K3AA 4P2ZA 4IIJB 1EBOA 4JI1B 1Q6HA 1KBHA 1RSOA 2CUGA 3O65A 4X65O 2CE4A 2F23A 4JTDB 3UO3A 1SQXH 4JI7O 4X1YB 2ZR2A 4YIOA 5LGNA 4WFBV 1KQSU 4DR6O 2DWDC 1KB9F 3JAWA 3JASB 2Y0PA 4MSWC 1KD1W 4R7CA 2V1DA 4JI6O 4MW3A 2RMKB 4NTXA 4CH6A 2HFEC 4LCUC 3WB0A 4FFKA 2FKXA 4O4JA 3JD1A 4JI1O 1THZA 1KU9A 3ABTA 4W4KA 1TA8A 3F5TA 4FJCC 1OCOB 3QO5A 4MW8A 2XOKG 1S0VA 5J2UB 4WF9V 3B4SA 4NXMB 1SQPH 1F4MA 3JARB 2XAQA 3CMEV 2QWNB 1WP8A 3QNEA 2BSKA 1WNSA 3K59A 2BCCH 1W59A 2CH7B 2CTWA 2WLHA 2B1IA 4PV1B 1UJWB 3L74H 4JV5B 4DXWA 1RFYA 2OTLV 3FAVA 2ZKOA 1YEWA 4PD4F 4DR5B 4JGSA 5KX5A 2F66C 3JD2A 3BFRA 2CAZC 2QWPB 1S5LZ 2E76B 1H38A 3ZN0A 2JGUA 3U11A 2D2CB 3K57A 1WA8A 1WB7A 1SZXA 3GWKC 1XL4A 1JOYA 5JVDA 4NXMO 4JAAA 1VMGA 5FNVB 3IC7A 3CYOA 3CC4V 3KCYA 4EKWA 1I08A 2GSMB 4JI2B 1UPGA 4JV5O 1RP3B 4GKJB 4DR5O 1Y76A 4XDLA 4LF8B 2D3OW 4G2KA 2AW9A 4CS3A 5GONB 3CCSV 2ILMA 1XBLA 2R9RB 3SYQA 2HR3A 5IYZA 3KZIZ 2Z5UA 2QWOB 1SQBH 3TJTA 2YEVB 2QKAA 2XASA 3T4DA 3RVYA 1VARA 1NVPD 3IGAC 2AGAA 3JSLA 2NNUA 3ZMTA 2DWEC 3VBBA 4X8AA 3P30A 1V9PA 2XAHA 3FB7C 4GKJO 2WLLA 4HZ3A 4YJ3B 1XEQA 1MNGA 4LF8O 3K3WA 3SJQC 5IT9N 1U97A 5JH7A 4GYCB 3CC2V 3WU2Z 4MTXA 5LL6Y 3OMNB 3E89A 3CEIA 4IHJA 4F6RA 4J9YB 3B8NA 3RGBA 1OZ0A 1JNBA 1NR7A 2C2AA 5L3GA 3RYIB 3H1HH 1E1QG 4PDLA 3B40A 4DV0B 5LP6A 2QM8A 1RPRA 3HR0A 4LWSB 4PDRA 3T1CA 3SPCA 3G6EV 2X0LA 3ZN1A 4IT5A 1YJ9V 1GN4A 5K1XA 4UVCA 1QR9A 2IJJA 3HKCA 3NR7A 5CB4A 3AG4B 1NBMG 3CCMV 2E3CA 5KHIA 4UV9A 4MTOA 2WLKA 1SA0A 1EN6A 2DOSA 3AG4C 1BQZA 2ZE8A 1FYJA 3FB5C 3H1JH 4TV9A 2UUBB 1EN4A 2B9ZA 2Q69A 4CBCA 5C8YB 4DV0O 1PM9A 1QR8A 4J7ZA 3I55V 4X20B 4LFBO 3A8TA 5FPRA 4DR4B 5A9GA 1VQ8V 4J10A 3W7UA 1XMQB 4J80A 3M99B 1K92A 3HKBB 2Q67A 4L8JA 3WB2A 4TV9B 4LH6A 3IFXA 3SYAA 3Q4HB 2BTOA 3ZHVA 5FLXN 5C93A 1N36O 2EULA 1KMIZ 4ZIBA 4WCEV 2UUBO 3WFVA 3P3NA 1H2GA 1IBLB 2DYRB 3MHHC 3RWRD 1YCIA 1R3LC 4AI8A 1Z5WA 1L0NH 2DYRC 4DR4O 5GTIZ 1XMQO 2YICA 1AI5A 1XQ8A 1LR1A 3RYHA 2RJZA 5LHIA 4I9QA 3JD3A 2JRIA 1I94B 4P9PA 4NTWA 2H8PC 1GTOA 3ASOB 3F7VC 4RWUA 3DC5A 1VQ5V 1GAXA 3HKEB 1KKDA 4LR3A 1FD9A 3ASOC 4I4TA 4I50A 2JGDA 1IBLO 3OE7G 3ABLC 4DUZB 3EVKA 4YJ2B 4JYBA 4NB5A 1KP3A 2YXYA 3DTUB 3A0RA 4U3JB 2ZT9B 1OV9A 4CS2A 3ZX6A 2F1MA 2LO1A 3CS5A 4JPRA 2X6CA 1Z5VA 1S76D 2A06H 3ASNB 1I94O 5CBGA 4DV7B 5CBFA 5J9PC 3ASNC 3K58A 1GM7A 1LUWA 5BZBA 3BEHA 1R3JC 5DECA 3LNMB 1O9GA 4DUZO 1PL4A 1JQ0A 2MW2B 4JZ2A 4HNAA 3SJAC 4I55B 1E1RG 4RAIA 2EZOA 3ETGA 5LA6B 2QJ1A 3ZHSA 1NTKH 2EX3A 2QWQB 3LSSA 3CCEV 4LF5B 4HBNA 4IYIA 2OWOA 4DV7O 2H94A 4N23A 1Y4MA 4LH7A 1OJHA 2AXTZ 1NKDA 4UB6Z 1L8DA 2LQTA 5H9CA 4H37A 1TUBB 3CD6V 3IC9A 1IXBA 1F51A 3L70H 3H1LH 4HAMA 5ITZA 5LMNO 4JYYA 4UVBA 4LFAO 3H9VA 2QM4A 4X9QA 1EZJA 2PUSA 3ZHRA 1NTMH 4O2BB 1VQNV 5L3EA 1IURA 4LF5O 2E5LB 1JX9A 2JIZG 1ZUQA 1NH2D 4L87A 3K06A 5KAFZ 3CJHA 4CC6A 1I7FA 4TSFG 5BMVA 1YJNV 2ARHA 1FFTB 4UFZA 2Q4PA 3MAQA 2A0LA 2PF4E 3OAAG 1VQ4V 2OCCB 2QM7A 2YI8A 3R66A 4D7TA 1IVSA 2F4VB 3CCRV 2A79B 2OCCC 3NXSA 2GTSA 3G67A 3FB8C 1LUVA 2E5LO 2PY5A 5LGTA 4JAUA 1NJIW 4IL6Z 4UV8A 5J2TB 1JPXA 4N21A 1VQMV 5EC2C 2IJKA 3N2KB 4FIPC 1BZKA 1VIBA 4RUFA 2V7QG 3HB3B 4UCTA 4MVUA 2WLNA 4UVAA 2HJDA 3MHSC 4YIPA 1EFRG 4I0XA 4JF3A 1R1BA 2YS8A 4TT3G 2FYUH 4DV2B 1VQ6V 2F4VO 3UQ8A 2Q8VA 5EIBC 2OIEA 4DK0A 2YI9A 1ZL8A 5JJJB 5CA0B 2E75B 1LNQA 5KHHA 1R6TA 2DQ3A 1NR1A 4WFEA 2LFRA 4JI0B 4UB8Z 2DN9A 3O9OA 5LYJA 3JD0A 3CXHF 4H13B 3SJCC 3BA9A 4DV5B 1QU7A 3RYCB 2XT9A 1TUEB 3J80N 2RDCA 1S5JA 4DV2O 3J81N 5LGUA 3E83A 4DW0A 2ATKC 4JAVA 1SC5B 5F2VO 4TUYA 4A5UB 1VQ9V 2BOBC 3TXQA 4UCRA 1HNZB 2PTMA 1QBZA 4JI3B 4J11A 1I0HA 4YXWG 3T1HB 2AZ0A 4JI4B 1AI7A 4LNUB 5JCOA 4DV5O 1GK9A 4X66B 2RNBA 3TETA 1DGSA 4DRXA 4G28B 1IDSA 4B3MB 3JCUZ 1K34A 1FXHA 2W6IG 4FM2A 3J7AU 1H8EG 3K9AA 2LW7A 5EZYA 5GW7A 1YDXA 2JVDA 4H33A 4MVQA 4X1YA 4JI3O 3T1HO 4B3TO 2ZCEA 4JI6B 2BE3A 4JI4O 3SJBC 3OTOB 2GDSA 2HLDG 2N04A 5JQGB 4LF6O 1MA1A 3JASA 4JTAB 4K0KB 4OPAA 1R73A 4X66O 1MZEA 2WLIB 3K08A 3T4ZA 4B3MO 2QE7G 2QGNA 3FYIB 4JYAB 2KSDA 3AK3A 1XI1A 2ADQB 3OGIB 3B8MA 1CXZB 4RO2A 5EZYB 2F95B 1AP6A 3CRRA 1VP7A 3EHBB 3SYPA 5KHGA 3DSQA 1AJNA 1JJOA 3BRCA 2UXBB 5KA6A 5J2UA 5LOVB 1K73W 3JARA 2B1GA 1NU1H 3K03A 5CBHA 1EZVH 3OTOO 3M7MX 4K0KO 2CH7A 5IWAB 1NI8A 1NS1A 3E8HA 1YI2V 2JS3A 1P4RA 3JALA 3CCUV 3JYCA 1D5AA 4DV6B 2R70A 4JYAO 2UXNA 1IJGA 1K3EA 1AROP 3KG2A 3STLC 1OCOC 5LBQA 2R9AA 3MD0A 3K9SA 4ASUG 3JATB 2V4DA 2UXBO 4CH3A 5B1BB 3K79A 3OD4A 5KMGB 4KUMA 5FNVA 2EILB 4MVOA 4B3RB 1Q8IA 5B1BC 2DE0X 3JALB 4GX0A 3K0GA 2EILC 3OEEG 5L3FA 5IWAO 3A0HZ 4X64B 4O4IB 2UXDB 3L72H 2WA3A 3CB2A 1M5IA 4DV6O 3P3PA 3BY6A 4MVMA 5B1NA 5GONA 2PYJA 3SDLA 1HDJA 4QJFB 2KKWA 4FLTA 1S77D 1WLEA 2QR4A 3D8CA 4YHHB 3IAYA 2YEVA 5FPOA 3BABA 3ZIAG 2UXCB 3A0BZ 4NXNB 4NTYA 4QIWF 1M93A 1L1FA 4B3RO 2EIKB 3LDCA 1YITV 4K8ZA 5E1AC 4O2AB 3OFNG 4UXNA 4X64O 2EIKC 3CCLV 1D5NA 2UXDO 2IH1C 4B08A 2ETNA 2QWRB 4QPKA 4YJ3A 3THOA 1SQFA 2Q7EA 1E79G 3F5WC 4RQFA 2PZSA 4ZBMA 4DW1A 2EJRA 4YHHO 1NZ6A 1M57B 5DN6G 3FYEB 2CDYA 4U7OA 2UXCO 4NXNO 5HFMA 4Z1MG 1M57C 3RYIA 1PPJH 4HYOA 5L3BA 5B5EZ 1GM9A 4X88A 3AG7A 2OT5A 5B3SB 2FB5A 1FFXB 4LWSA 2PI5A 1Z2GA 2IH3C 1WPBA 5B3SC 1VF5B 3H1IH 2P4VA 2ZE7A 1A32A 4DO2A 4B7EA 1I5YA 1ZX3A 3GWOA 1BS3A 4KL1A 1GO3F 4XDJA 1N8RW 4PA6A 4DR7O 5BR8B 1R3KC 1T5EA 1WPXA 3ICXA 1NQTA 4LFBB 4WBNB 2GV9A 5CMUA 5C8YA 4R50A 3KCXA 1MABG 4FFBB 2OYQA 1W2BU 5EC1C 4X20A 4CS4A 3G4SV 2Q7GA 3P32A 1OCZB 3E2EA 2X6AA 2QSAA 5GTHZ 3APQA 1N36B 1OCZC 3HKBA 3OMAB 4KHPO 2RQ6A 3Q4HA 4X1IB 1K5QA 1R6KA 5EYPB 4QE7A 4AHCA 5BR8O 1COWG 3GVMA 3T1YB 2OCHA 3E22B 1W0KG 3WB1A 3HKDB 3ETDA 2GBOA 1Y74B 4UCOA 1HNXB 5K1PA 2OIGA 4BIUA 1HP8A 2DYSB 2JJ2G 4FLUA 2UU9B 2IM9A 4DV4O 1JA8A 1FOUA 2DYSC 3CMAV 4FLXA 2GUZB 2ZD9A 2YUAA 3CHXA 1QCEA 1N32B 4BIZA 5B1AB 2KB1A 4TQFA 3K5NA 2K1EA 1OCRB 3HKEA 2Y0IA 5B1AC 4Z2WA 5KLVH 3PN1A 1V54B 2CTQA 3T1YO 4KXRA 4MTFA 3K5LA 4ZOLB 1OCRC 2ZINA 1BHBA 1V54C 3D36C 1SZTA 1HNXO 1AILA 4YJ2A 3UKMA 3R65A 2UU9O 4XBFA 4U3JA 4TOIA 3SPGA 3BAAA 2Q7HA 1PV0A 1WB8A 1FKAO 1N32O 3G71V 5IYDO 1Q86W 4GKKB 4OGQB 5CA1B 2LJ2A 1J95A 1TVKB 1IBMB 3LSQA 2MK3A 2BOCC 4EB6B 4FM0A 4PA9A 1US6A 4Q20A 3ZMSA 4RUEA 3RVZA 1MZFA 3CRQA 4BWAA 4I55A 3D3QA 1K7DA 2M6YA 5LA6A 1GMGA 2JK5C 2O57A 1BMFG 1Q82W 3S3XA 4GKKO 5B1OA 4ZI7B 4LFAB 1CPYA 5LMNB 3CSXA 1IBMO 5LMUB 5EBLC 1TUBA 3FFQA 5A2QN 2R72A 1YSCA 4BIOA 1B6QA 5HFLA 4PHZA 4JASA 2L35A 1MSDA 4O2BA 1YF2A 2P6JA 2W0FC 3OW2U 1NTZH 2LGWA 3BA8A 3CXCU 3ABUA 4BR6A 4PI2A 4D6TH 3PJSK 1N4CA 4E4EA 2IW5A 4JI5B 2NN4A 3CPWU 5LMUO 1F4NA 1GN6A 4WFFA 3VQWA 5IE9A 5EBWC 3UT5B 3CX5F 2Q5ZA 3ZMZA 3SPJA 1L0LH 2HHHB 3ETEA 5LXTB 3SPIA 3L75H 1QNMA 4P9OA 2ITDC 1XMOO 3B2EE 4LBEC 1VQ7V 3FB6C 3OGCC 4GCZA 4E2LA 5E79Z 5EIBD 5J2TA 1JJ2U 4WFHA 3N2KA 1W0JG 2ZIMA 4LP8A 4JI5O 4IYHA 1N0JA 3JAMN 4K35A 4OXSA 3ZBHA 3F7YC 1BE3H 1XHXA 2HHHO 2AHZA 5IJ0B 4DV3B 1MSWD 1XL6A 4U3FH 4PELA 3LNNA 4WFAV 3QO8A 2LW1A 5CA0A 1EN5A 2ZDIC 1K4DC 1HNWB 4GX2A 1N34B 2CTPA 4FPPA 1AR5A 1BSMA 2M7WA 4DUYB 4LC1A 1QVGU 1KYOF 2Y69B 3JSNA 1PNMA 5H2FZ 4H44B 4OX9B 2Z3YA 4J42A 2Y69C 2HVKC 3RYCA 1XREA 5CN0A 3E35A 4DV3O 2OTJV 1YTFB 1URFA 4FLYA 2XAJA 4MVSA 2P5OA 3OUSA 1NT2B 2CGNA 3CP1A 3C3SA 4UUJC 3BHPA 1DF5A 2QTOA 2XUMA 2EZPA 4FLVA 1HNWO 1N34O 2KG7B 3VQVA 4FZ1A 4IGGA 1G8MA 4DUYO 2ZR3A 3WG7B 1BHAA 4LNUA 3VOUA 2QDOA 1X59A 3OM3B 1MG1A 2XNDG 3B77A 3FD9A 4OX9O 2QTSA 3WG7C 4QNHB 1U96A 2LFSA 3ZRWB 4I9WA 4CZZA 4UCVA 1YHQV 1PP9H 2VWJA 4PJ0Z 1JFFB 5L3CA 1VEWA 2ZE6A 5KAIZ 4B3TB 2CK3G 2XAFA 5BY1A 3ZJZA 4BW5A 3SPHA 1VQOV 1VQPV 1TAEA 4LF6B 3X2QB 2ODMA 1SS3A 2A3QA 3ZRVA 1EM1A 3X2QC 1H2SB 2Y48A 5JQGA 1FJGB 3LDDA 4FLWA 1B04A 2ZM6B 4FLZA 5DM6V 3DXRB 2WLIA 2YDEA 3TK1A 4TV8B 2Q9LA 3ZEDA 1VF6C 3W7XA 4KFMA 2WPDG 1Q7YW 5KA5A 5LHGA 2ZE5A 2AHYA 1FXKB 1SQGA 1VF7A 2A9HA 4GX1A 3MDSA 2WLMA 5LOVA 5EBMC 1FXKC 4JZGA 4MVRA 2VRZA 1SETA 2N05A 3STZC 3ETQA
chains in the Genus database with same CATH topology
1Y67A 3DC5A 1ZUQA 1IX9A 3AK1A 4BR6A 1P7GA 3C3SA 3DC6A 3BFRA 1N0NA 1ZSPA 4E4EA 3KKYA 3EVKA 3LSUA 1GN6A 1GN4A 1I0HA 3K9SA 1WB7A 1SZXA 1AP5A 1EN6A 1BS3A 1QNMA 3OT7A 5AG2A 1I08A 1WB8A 2RCVA 1ZLZA 1EN4A 1XDCA 1IDSA 1LUVA 4GUNA 1LUWA 1VEWA 1GN2A 1B06A 1PM9A 2AW9A 2CE4A 1PL4A 5A9GA 1N0JA 4YIOA 2ADPA 4JZ2A 2QKCA 3C3TA 4YIPA 3TJTA 1EM1A 1BT8A 2QKAA 2GDSA 1MA1A 1VARA 3RN4A 3QVNA 1XILA 4F6EA 4FFKA 1AVMA 3AK3A 1D5NA 1EN5A 2P4KA 2ADQB 1MMMA 1AP6A 1MNGA 3KDRA 3IC9A 1AR5A 3AK2A 1JR9A 1BSMA 1IXBA 1KKCA 1GN3A 1AR4A 4JYYA 3MDSA 1XUQA 4X9QA 3CEIA 1JA8A 4JZGA 1ZTEA 1MSDA 4C7UA 2CDYA 1XREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y67 A;  3DC5 A;  1ZUQ A;  1IX9 A;  3AK1 A;  4BR6 A;  1P7G A;  3C3S A;  3DC6 A;  3BFR A;  1N0N A;  1ZSP A;  4E4E A;  3KKY A;  3EVK A;  3LSU A;  1GN6 A;  1GN4 A;  1I0H A;  3K9S A;  1WB7 A;  1SZX A;  1AP5 A;  1EN6 A;  1BS3 A;  1QNM A;  3OT7 A;  5AG2 A;  1I08 A;  1WB8 A;  2RCV A;  1ZLZ A;  1EN4 A;  1XDC A;  1IDS A;  1LUV A;  4GUN A;  1LUW A;  1VEW A;  1GN2 A;  1B06 A;  1PM9 A;  2AW9 A;  2CE4 A;  1PL4 A;  5A9G A;  1N0J A;  4YIO A;  2ADP A;  4JZ2 A;  2QKC A;  3C3T A;  4YIP A;  3TJT A;  1EM1 A;  1BT8 A;  2QKA A;  2GDS A;  1MA1 A;  1VAR A;  3RN4 A;  3QVN A;  1XIL A;  4F6E A;  4FFK A;  1AVM A;  3AK3 A;  1D5N A;  1EN5 A;  2P4K A;  2ADQ B;  1MMM A;  1AP6 A;  1MNG A;  3IC9 A;  1AR5 A;  3AK2 A;  1JR9 A;  1BSM A;  1IXB A;  1KKC A;  1GN3 A;  1AR4 A;  4JYY A;  3MDS A;  1XUQ A;  4X9Q A;  3CEI A;  1JA8 A;  4JZG A;  1ZTE A;  1MSD A;  4C7U A;  2CDY A;  1XRE A; 
#chains in the Genus database with same CATH topology
 4R8C A;  4Z1V A;  3TGU H;  3ZHU A;  1FJG O;  1Y66 A;  4U7N A;  2ZM6 O;  1IX9 A;  1XNR B;  2BTQ B;  3N2G B;  4QPJ A;  4PI0 A;  1XHZ A;  2P90 A;  3KKY A;  5IJ9 B;  2XTA A;  2DJV A;  2HEP A;  3SGI A;  3JAT A;  1H2L A;  2IU3 A;  1AJQ A;  2UUC B;  2Z0A A;  5KMG A;  2VQE O;  3G6B A;  1Q43 A;  3EFF K;  4R6Z A;  4BW9 A;  2DMX A;  1R6N A;  2G38 A;  3T2M A;  3CRA A;  4EFB A;  4O4I A;  1BL8 A;  1XNR O;  4NR1 A;  1RSO B;  4FZ0 A;  2QEX V;  5EK0 A;  2QKS A;  2DW4 A;  2FML A;  2WWW A;  3QG5 A;  2FL4 A;  1Q81 W;  3OR7 C;  5KUK A;  2QKC A;  1AJP A;  2DQ0 A;  5D5P A;  3JAW B;  2UUC O;  1WJZ A;  2Q0A A;  1WP7 A;  1Q3E A;  1YVW A;  1QHT A;  3QVN A;  1RPO A;  4GX5 A;  3L9D A;  3QTC A;  5KUM A;  1XIL A;  4O2A A;  4X62 B;  2Y4U A;  4O4J B;  2F93 B;  4LF7 B;  4QE9 A;  2LGQ A;  1MOF A;  4TWK A;  1KEC A;  4O4H A;  1GN3 A;  1ZAU A;  4Q6G A;  3AG1 B;  3IJ4 A;  3RBZ A;  5CA3 A;  4K8X A;  4EEQ A;  1ZTE A;  2BSK B;  4MTG A;  3AG1 C;  4C7U A;  1G1X B;  3CCJ V;  2XAG A;  4LFC B;  2IBZ H;  5IYC O;  3FAV B;  5FL7 G;  2L6L A;  2H3O A;  3RW0 A;  1Y6X A;  5KX5 B;  4X62 O;  3DC6 A;  4O4H B;  1FAF A;  1DK1 A;  1DLB A;  1FFX A;  4B3S B;  3BPZ A;  4W4L A;  1PD3 A;  4B7K A;  3FX7 A;  4LF7 O;  4I7Z B;  2JDI G;  1WA8 B;  4MVZ A;  4FK5 C;  4ABM A;  5JVD B;  4DR7 B;  1UFI A;  2HP8 A;  5H6R A;  2YC0 A;  2F43 G;  1CP9 A;  4WFG A;  4DYL A;  1YXB A;  1GKF A;  4LFC O;  1M90 W;  1HR0 B;  1Y76 B;  4WBN A;  4JI2 O;  1M1K W;  1M56 B;  1GM8 A;  2Q73 A;  4FFB A;  4B3S O;  4KHP B;  1M56 C;  3G80 A;  5L3D A;  2VQF B;  2B5U A;  5IYZ B;  2ZXW B;  1RM1 B;  1SES A;  1FPO A;  2ZXW C;  1V55 B;  1RM1 C;  4X1I A;  3JCZ A;  3OR6 C;  4FVM A;  5EYP A;  1ORQ C;  1V55 C;  1BGY H;  1K33 A;  2HG5 C;  1S72 V;  2PYL A;  2WA4 A;  2P4K A;  2WLL B;  1VQL V;  3E22 A;  4J9Z B;  1HR0 O;  2RN9 A;  1QQC A;  2KQX A;  3HKD A;  1Y74 A;  4NVP A;  3GB7 C;  4DV4 B;  2IJI A;  3KDR A;  1P84 F;  4O4L A;  5JH7 B;  2P67 A;  3UCS C;  1NVP B;  3RFR A;  1IXM A;  1PNL A;  2VQF O;  4IHJ B;  4F6R B;  3I56 V;  2Q68 A;  2GUZ A;  1QLN A;  3VQX A;  3ZRX A;  1ROP A;  1Q6I A;  1R3I C;  4NYK A;  4I5S A;  2Q0O C;  2NLJ C;  4CH5 A;  4CH4 A;  5LP6 B;  4O4L B;  1H8H G;  3D36 A;  3ZMV A;  4PA4 A;  4ZOL A;  3U0Z A;  1DTO A;  5LP6 C;  4ZHQ A;  1SF9 A;  4MS2 A;  1G6U A;  5CB4 B;  3HKC B;  2YXH A;  2ITC C;  4J7K A;  1H5W A;  3CC7 V;  4DK1 A;  1SA0 B;  3UO2 A;  3CRM A;  1S5H C;  2HKO A;  2RCV A;  5H6Q A;  2UUA B;  2YIB D;  3E8F A;  3M8A A;  1K5S A;  4ZHQ B;  5CA1 A;  1GN2 A;  3E86 A;  4P30 A;  1HW7 A;  1TVK A;  4DR1 B;  3VQY A;  1FXV A;  1Q5O A;  4EB6 A;  4TQD A;  2R9I A;  1Q6U A;  1GH6 A;  2YIA A;  4X89 A;  2YIB A;  1XOU A;  2ADP A;  3ABK B;  4ICG A;  3ZHT A;  1JVM A;  4YY3 B;  3APO A;  3ABK C;  1GRJ A;  2UUA O;  3HPL C;  4F6E A;  2EIN B;  3AEI A;  1K97 A;  2GHY A;  5H5N A;  4ZI7 A;  4LF4 B;  3L71 H;  2EIN C;  4DR1 O;  1F7Y A;  3ABL B;  5IY5 B;  1DF4 A;  3AK2 A;  2VWK A;  1KKC A;  1AI6 A;  3DGE A;  4GZR B;  4GLX A;  4CC5 A;  5IY5 C;  1XUQ A;  2Q6A A;  3RYF A;  5IDJ A;  3H01 A;  1PL0 A;  3W7W A;  3RYH B;  2EJ7 A;  4DR2 B;  4YY3 O;  2N74 A;  2X7R B;  1AR1 B;  1PNK A;  3ZS8 C;  4JYC A;  3K5O A;  1H2M A;  2JJ1 G;  1JMK C;  1YJW V;  3N27 A;  3AK1 A;  2JEU A;  3L73 H;  4I4T B;  4I50 B;  4LF9 B;  2JGD B;  1TGO A;  3UM7 A;  4LF4 O;  3B09 A;  2XHB A;  3RYF B;  4G27 B;  2K9P A;  2YXL A;  3U10 A;  1K8A W;  5JJE B;  3UT5 A;  2YID A;  5D5Q A;  5LXT A;  1AP5 A;  1IZ3 A;  4MT8 A;  1XMO B;  2W6J G;  2ZQM A;  2LP7 A;  4DR2 O;  2CTR A;  1AB3 A;  4JI8 B;  1QLE B;  1XDC A;  1M9N A;  2WAM A;  1KP2 A;  1QLE C;  2UXX A;  4FMT A;  1B06 A;  4X1K A;  4LF9 O;  3EXA A;  1P49 A;  3CWB H;  4J41 A;  2P7T C;  5KHJ A;  1IBK B;  4PDV A;  3CCQ V;  3SR2 C;  3CE2 A;  1WN7 A;  4FM1 A;  4HNA B;  3C3T A;  4AIL C;  3TCU A;  2ZNJ A;  4J7J A;  5IJ0 A;  3RN4 A;  2NR5 A;  1H2K A;  2YSU B;  4JI8 O;  4X1K B;  3CCV V;  3OTF A;  2ZDI A;  3OUF A;  3TXS A;  1J5E B;  1M4U A;  3OMI B;  1ENV A;  1YTF D;  4KP4 A;  3D3I A;  1OCC B;  3QF7 A;  1H2N A;  1K9M W;  1JR9 A;  1IBK O;  5ITZ B;  2HJF C;  1AR4 A;  1Q90 D;  1OCC C;  2EIM B;  2FTK A;  3FKS G;  4JTC B;  2EIM C;  2EBO A;  4GT1 A;  4D7S A;  3LDE A;  5DED A;  3BVO A;  3CRC A;  3QO7 A;  1SRY A;  3ABM B;  3E8B A;  1P7G A;  4F4L A;  2WSS G;  3CJH B;  1J5E O;  5BMV B;  3ABM C;  1N0N A;  4RQE A;  1ZSP A;  3ZMU A;  1BQ0 A;  3A2F A;  3LSU A;  3RT3 C;  3ZCC A;  3SYC A;  2KG7 A;  2ZIO A;  3JD4 A;  2P22 C;  2Y4T A;  4EFE A;  1NH2 B;  2PI4 A;  1HWY A;  4BAY A;  5AG2 A;  2HVJ C;  3JAK A;  2W0X A;  3ZRW A;  1FS0 G;  4PA7 A;  3ZHQ A;  3K0D A;  1JFF A;  2CGO A;  4DV1 B;  5JJN B;  1QVF U;  2ZNI A;  4UCU A;  4QGP A;  1ZWI C;  1YZB A;  1B3Q A;  1G4Y B;  1AI4 A;  5KHK A;  4PDM A;  3BCC H;  4I0X B;  1N33 B;  3ML0 A;  3JAK B;  1WAZ A;  1SQQ H;  1BT8 A;  3ZRS A;  1SQV H;  3S3W A;  5JWP A;  3W7S A;  1XNQ B;  4OPH A;  4AQY B;  5LHH A;  3AG2 B;  1VF6 A;  5IYB O;  1ZL8 B;  3DXR A;  2JEX A;  2IJH A;  1AVM A;  4DR3 B;  1MMM A;  1PKX A;  4TV8 A;  2WLJ A;  2VS0 A;  3AG2 C;  4DV1 O;  1KC8 W;  2A7W A;  2E74 B;  3OEH G;  3E8G A;  4NKG B;  1FXK A;  4XDK A;  5LYJ B;  1BCC H;  4H0L B;  4JI0 O;  3AG3 B;  3K04 A;  1N33 O;  3H1K H;  1F23 A;  1I5X A;  3W7T A;  4UCS A;  1KUQ A;  3AG3 C;  3K5M A;  1Y67 A;  1X4T A;  1VQK V;  1SKV A;  4PA3 A;  1XNQ O;  2IU0 A;  3LUT B;  2EIJ B;  4AQY O;  2PGG A;  4TUY B;  1JCH A;  3C90 A;  5TIS Z;  2BTQ A;  4DR3 O;  3N2G A;  2EIJ C;  2P06 A;  4X65 B;  1S3J A;  2AZ2 A;  4JI7 B;  4IIJ A;  5IJ9 A;  1YIJ V;  4ZKI A;  1K4C C;  2VQE B;  4DR6 B;  1HNZ O;  3SYO A;  1OHH G;  2QA4 V;  1O9H A;  1P7B A;  3OT7 A;  3I5D A;  1SER A;  1ZLZ A;  4DRX B;  2GTA A;  5B66 Z;  1CEZ A;  5JCO C;  1D2D A;  2X6B A;  5BXZ A;  4GUN A;  2JS5 A;  4K3A A;  4P2Z A;  4IIJ B;  1EBO A;  4JI1 B;  1Q6H A;  1KBH A;  1RSO A;  2CUG A;  3O65 A;  4X65 O;  2CE4 A;  2F23 A;  4JTD B;  3UO3 A;  1SQX H;  4JI7 O;  4X1Y B;  2ZR2 A;  4YIO A;  5LGN A;  4WFB V;  1KQS U;  4DR6 O;  2DWD C;  1KB9 F;  3JAW A;  3JAS B;  2Y0P A;  4MSW C;  1KD1 W;  4R7C A;  2V1D A;  4JI6 O;  4MW3 A;  2RMK B;  4NTX A;  4CH6 A;  2HFE C;  4LCU C;  3WB0 A;  4FFK A;  2FKX A;  4O4J A;  3JD1 A;  4JI1 O;  1THZ A;  1KU9 A;  3ABT A;  4W4K A;  1TA8 A;  3F5T A;  4FJC C;  1OCO B;  3QO5 A;  4MW8 A;  2XOK G;  1S0V A;  5J2U B;  4WF9 V;  3B4S A;  4NXM B;  1SQP H;  1F4M A;  3JAR B;  2XAQ A;  3CME V;  2QWN B;  1WP8 A;  3QNE A;  2BSK A;  1WNS A;  3K59 A;  2BCC H;  1W59 A;  2CH7 B;  2CTW A;  2WLH A;  2B1I A;  4PV1 B;  1UJW B;  3L74 H;  4JV5 B;  4DXW A;  1RFY A;  2OTL V;  3FAV A;  2ZKO A;  1YEW A;  4PD4 F;  4DR5 B;  4JGS A;  5KX5 A;  2F66 C;  3JD2 A;  3BFR A;  2CAZ C;  2QWP B;  1S5L Z;  2E76 B;  1H38 A;  3ZN0 A;  2JGU A;  3U11 A;  2D2C B;  3K57 A;  1WA8 A;  1WB7 A;  1SZX A;  3GWK C;  1XL4 A;  1JOY A;  5JVD A;  4NXM O;  4JAA A;  1VMG A;  5FNV B;  3IC7 A;  3CYO A;  3CC4 V;  3KCY A;  4EKW A;  1I08 A;  2GSM B;  4JI2 B;  1UPG A;  4JV5 O;  1RP3 B;  4GKJ B;  4DR5 O;  1Y76 A;  4XDL A;  4LF8 B;  2D3O W;  4G2K A;  2AW9 A;  4CS3 A;  5GON B;  3CCS V;  2ILM A;  1XBL A;  2R9R B;  3SYQ A;  2HR3 A;  5IYZ A;  3KZI Z;  2Z5U A;  2QWO B;  1SQB H;  3TJT A;  2YEV B;  2QKA A;  2XAS A;  3T4D A;  3RVY A;  1VAR A;  1NVP D;  3IGA C;  2AGA A;  3JSL A;  2NNU A;  3ZMT A;  2DWE C;  3VBB A;  4X8A A;  3P30 A;  1V9P A;  2XAH A;  3FB7 C;  4GKJ O;  2WLL A;  4HZ3 A;  4YJ3 B;  1XEQ A;  1MNG A;  4LF8 O;  3K3W A;  3SJQ C;  5IT9 N;  1U97 A;  5JH7 A;  4GYC B;  3CC2 V;  3WU2 Z;  4MTX A;  5LL6 Y;  3OMN B;  3E89 A;  3CEI A;  4IHJ A;  4F6R A;  4J9Y B;  3B8N A;  3RGB A;  1OZ0 A;  1JNB A;  1NR7 A;  2C2A A;  5L3G A;  3RYI B;  3H1H H;  1E1Q G;  4PDL A;  3B40 A;  4DV0 B;  5LP6 A;  2QM8 A;  1RPR A;  3HR0 A;  4LWS B;  4PDR A;  3T1C A;  3SPC A;  3G6E V;  2X0L A;  3ZN1 A;  4IT5 A;  1YJ9 V;  1GN4 A;  5K1X A;  4UVC A;  1QR9 A;  2IJJ A;  3HKC A;  3NR7 A;  5CB4 A;  3AG4 B;  1NBM G;  3CCM V;  2E3C A;  5KHI A;  4UV9 A;  4MTO A;  2WLK A;  1SA0 A;  1EN6 A;  2DOS A;  3AG4 C;  1BQZ A;  2ZE8 A;  1FYJ A;  3FB5 C;  3H1J H;  4TV9 A;  2UUB B;  1EN4 A;  2B9Z A;  2Q69 A;  4CBC A;  5C8Y B;  4DV0 O;  1PM9 A;  1QR8 A;  4J7Z A;  3I55 V;  4X20 B;  4LFB O;  3A8T A;  5FPR A;  4DR4 B;  5A9G A;  1VQ8 V;  4J10 A;  3W7U A;  1XMQ B;  4J80 A;  3M99 B;  1K92 A;  3HKB B;  2Q67 A;  4L8J A;  3WB2 A;  4TV9 B;  4LH6 A;  3IFX A;  3SYA A;  3Q4H B;  2BTO A;  3ZHV A;  5FLX N;  5C93 A;  1N36 O;  2EUL A;  1KMI Z;  4ZIB A;  4WCE V;  2UUB O;  3WFV A;  3P3N A;  1H2G A;  1IBL B;  2DYR B;  3MHH C;  3RWR D;  1YCI A;  1R3L C;  4AI8 A;  1Z5W A;  1L0N H;  2DYR C;  4DR4 O;  5GTI Z;  1XMQ O;  2YIC A;  1AI5 A;  1XQ8 A;  1LR1 A;  3RYH A;  2RJZ A;  5LHI A;  4I9Q A;  3JD3 A;  2JRI A;  1I94 B;  4P9P A;  4NTW A;  2H8P C;  1GTO A;  3ASO B;  3F7V C;  4RWU A;  3DC5 A;  1VQ5 V;  1GAX A;  3HKE B;  1KKD A;  4LR3 A;  1FD9 A;  3ASO C;  4I4T A;  4I50 A;  2JGD A;  1IBL O;  3OE7 G;  3ABL C;  4DUZ B;  3EVK A;  4YJ2 B;  4JYB A;  4NB5 A;  1KP3 A;  2YXY A;  3DTU B;  3A0R A;  4U3J B;  2ZT9 B;  1OV9 A;  4CS2 A;  3ZX6 A;  2F1M A;  2LO1 A;  3CS5 A;  4JPR A;  2X6C A;  1Z5V A;  1S76 D;  2A06 H;  3ASN B;  1I94 O;  5CBG A;  4DV7 B;  5CBF A;  5J9P C;  3ASN C;  3K58 A;  1GM7 A;  1LUW A;  5BZB A;  3BEH A;  1R3J C;  5DEC A;  3LNM B;  1O9G A;  4DUZ O;  1PL4 A;  1JQ0 A;  2MW2 B;  4JZ2 A;  4HNA A;  3SJA C;  4I55 B;  1E1R G;  4RAI A;  2EZO A;  3ETG A;  5LA6 B;  2QJ1 A;  3ZHS A;  1NTK H;  2EX3 A;  2QWQ B;  3LSS A;  3CCE V;  4LF5 B;  4HBN A;  4IYI A;  2OWO A;  4DV7 O;  2H94 A;  4N23 A;  1Y4M A;  4LH7 A;  1OJH A;  2AXT Z;  1NKD A;  4UB6 Z;  1L8D A;  2LQT A;  5H9C A;  4H37 A;  1TUB B;  3CD6 V;  3IC9 A;  1IXB A;  1F51 A;  3L70 H;  3H1L H;  4HAM A;  5ITZ A;  5LMN O;  4JYY A;  4UVB A;  4LFA O;  3H9V A;  2QM4 A;  4X9Q A;  1EZJ A;  2PUS A;  3ZHR A;  1NTM H;  4O2B B;  1VQN V;  5L3E A;  1IUR A;  4LF5 O;  2E5L B;  1JX9 A;  2JIZ G;  1ZUQ A;  1NH2 D;  4L87 A;  3K06 A;  5KAF Z;  3CJH A;  4CC6 A;  1I7F A;  4TSF G;  5BMV A;  1YJN V;  2ARH A;  1FFT B;  4UFZ A;  2Q4P A;  3MAQ A;  2A0L A;  2PF4 E;  3OAA G;  1VQ4 V;  2OCC B;  2QM7 A;  2YI8 A;  3R66 A;  4D7T A;  1IVS A;  2F4V B;  3CCR V;  2A79 B;  2OCC C;  3NXS A;  2GTS A;  3G67 A;  3FB8 C;  1LUV A;  2E5L O;  2PY5 A;  5LGT A;  4JAU A;  1NJI W;  4IL6 Z;  4UV8 A;  5J2T B;  1JPX A;  4N21 A;  1VQM V;  5EC2 C;  2IJK A;  3N2K B;  4FIP C;  1BZK A;  1VIB A;  4RUF A;  2V7Q G;  3HB3 B;  4UCT A;  4MVU A;  2WLN A;  4UVA A;  2HJD A;  3MHS C;  4YIP A;  1EFR G;  4I0X A;  4JF3 A;  1R1B A;  2YS8 A;  4TT3 G;  2FYU H;  4DV2 B;  1VQ6 V;  2F4V O;  3UQ8 A;  2Q8V A;  5EIB C;  2OIE A;  4DK0 A;  2YI9 A;  1ZL8 A;  5JJJ B;  5CA0 B;  2E75 B;  1LNQ A;  5KHH A;  1R6T A;  2DQ3 A;  1NR1 A;  4WFE A;  2LFR A;  4JI0 B;  4UB8 Z;  2DN9 A;  3O9O A;  5LYJ A;  3JD0 A;  3CXH F;  4H13 B;  3SJC C;  3BA9 A;  4DV5 B;  1QU7 A;  3RYC B;  2XT9 A;  1TUE B;  3J80 N;  2RDC A;  1S5J A;  4DV2 O;  3J81 N;  5LGU A;  3E83 A;  4DW0 A;  2ATK C;  4JAV A;  1SC5 B;  5F2V O;  4TUY A;  4A5U B;  1VQ9 V;  2BOB C;  3TXQ A;  4UCR A;  1HNZ B;  2PTM A;  1QBZ A;  4JI3 B;  4J11 A;  1I0H A;  4YXW G;  3T1H B;  2AZ0 A;  4JI4 B;  1AI7 A;  4LNU B;  5JCO A;  4DV5 O;  1GK9 A;  4X66 B;  2RNB A;  3TET A;  1DGS A;  4DRX A;  4G28 B;  1IDS A;  4B3M B;  3JCU Z;  1K34 A;  1FXH A;  2W6I G;  4FM2 A;  3J7A U;  1H8E G;  3K9A A;  2LW7 A;  5EZY A;  5GW7 A;  1YDX A;  2JVD A;  4H33 A;  4MVQ A;  4X1Y A;  4JI3 O;  3T1H O;  4B3T O;  2ZCE A;  4JI6 B;  2BE3 A;  4JI4 O;  3SJB C;  3OTO B;  2GDS A;  2HLD G;  2N04 A;  5JQG B;  4LF6 O;  1MA1 A;  3JAS A;  4JTA B;  4K0K B;  4OPA A;  1R73 A;  4X66 O;  1MZE A;  2WLI B;  3K08 A;  3T4Z A;  4B3M O;  2QE7 G;  2QGN A;  3FYI B;  4JYA B;  2KSD A;  3AK3 A;  1XI1 A;  2ADQ B;  3OGI B;  3B8M A;  1CXZ B;  4RO2 A;  5EZY B;  2F95 B;  1AP6 A;  3CRR A;  1VP7 A;  3EHB B;  3SYP A;  5KHG A;  3DSQ A;  1AJN A;  1JJO A;  3BRC A;  2UXB B;  5KA6 A;  5J2U A;  5LOV B;  1K73 W;  3JAR A;  2B1G A;  1NU1 H;  3K03 A;  5CBH A;  1EZV H;  3OTO O;  3M7M X;  4K0K O;  2CH7 A;  5IWA B;  1NI8 A;  1NS1 A;  3E8H A;  1YI2 V;  2JS3 A;  1P4R A;  3JAL A;  3CCU V;  3JYC A;  1D5A A;  4DV6 B;  2R70 A;  4JYA O;  2UXN A;  1IJG A;  1K3E A;  1ARO P;  3KG2 A;  3STL C;  1OCO C;  5LBQ A;  2R9A A;  3MD0 A;  3K9S A;  4ASU G;  3JAT B;  2V4D A;  2UXB O;  4CH3 A;  5B1B B;  3K79 A;  3OD4 A;  5KMG B;  4KUM A;  5FNV A;  2EIL B;  4MVO A;  4B3R B;  1Q8I A;  5B1B C;  2DE0 X;  3JAL B;  4GX0 A;  3K0G A;  2EIL C;  3OEE G;  5L3F A;  5IWA O;  3A0H Z;  4X64 B;  4O4I B;  2UXD B;  3L72 H;  2WA3 A;  3CB2 A;  1M5I A;  4DV6 O;  3P3P A;  3BY6 A;  4MVM A;  5B1N A;  5GON A;  2PYJ A;  3SDL A;  1HDJ A;  4QJF B;  2KKW A;  4FLT A;  1S77 D;  1WLE A;  2QR4 A;  3D8C A;  4YHH B;  3IAY A;  2YEV A;  5FPO A;  3BAB A;  3ZIA G;  2UXC B;  3A0B Z;  4NXN B;  4NTY A;  4QIW F;  1M93 A;  1L1F A;  4B3R O;  2EIK B;  3LDC A;  1YIT V;  4K8Z A;  5E1A C;  4O2A B;  3OFN G;  4UXN A;  4X64 O;  2EIK C;  3CCL V;  1D5N A;  2UXD O;  2IH1 C;  4B08 A;  2ETN A;  2QWR B;  4QPK A;  4YJ3 A;  3THO A;  1SQF A;  2Q7E A;  1E79 G;  3F5W C;  4RQF A;  2PZS A;  4ZBM A;  4DW1 A;  2EJR A;  4YHH O;  1NZ6 A;  1M57 B;  5DN6 G;  3FYE B;  2CDY A;  4U7O A;  2UXC O;  4NXN O;  5HFM A;  4Z1M G;  1M57 C;  3RYI A;  1PPJ H;  4HYO A;  5L3B A;  5B5E Z;  1GM9 A;  4X88 A;  3AG7 A;  2OT5 A;  5B3S B;  2FB5 A;  1FFX B;  4LWS A;  2PI5 A;  1Z2G A;  2IH3 C;  1WPB A;  5B3S C;  1VF5 B;  3H1I H;  2P4V A;  2ZE7 A;  1A32 A;  4DO2 A;  4B7E A;  1I5Y A;  1ZX3 A;  3GWO A;  1BS3 A;  4KL1 A;  1GO3 F;  4XDJ A;  1N8R W;  4PA6 A;  4DR7 O;  5BR8 B;  1R3K C;  1T5E A;  1WPX A;  3ICX A;  1NQT A;  4LFB B;  4WBN B;  2GV9 A;  5CMU A;  5C8Y A;  4R50 A;  3KCX A;  1MAB G;  4FFB B;  2OYQ A;  1W2B U;  5EC1 C;  4X20 A;  4CS4 A;  3G4S V;  2Q7G A;  3P32 A;  1OCZ B;  3E2E A;  2X6A A;  2QSA A;  5GTH Z;  3APQ A;  1N36 B;  1OCZ C;  3HKB A;  3OMA B;  4KHP O;  2RQ6 A;  3Q4H A;  4X1I B;  1K5Q A;  1R6K A;  5EYP B;  4QE7 A;  4AHC A;  5BR8 O;  1COW G;  3GVM A;  3T1Y B;  2OCH A;  3E22 B;  1W0K G;  3WB1 A;  3HKD B;  3ETD A;  2GBO A;  1Y74 B;  4UCO A;  1HNX B;  5K1P A;  2OIG A;  4BIU A;  1HP8 A;  2DYS B;  2JJ2 G;  4FLU A;  2UU9 B;  2IM9 A;  4DV4 O;  1JA8 A;  1FOU A;  2DYS C;  3CMA V;  4FLX A;  2GUZ B;  2ZD9 A;  2YUA A;  3CHX A;  1QCE A;  1N32 B;  4BIZ A;  5B1A B;  2KB1 A;  4TQF A;  3K5N A;  2K1E A;  1OCR B;  3HKE A;  2Y0I A;  5B1A C;  4Z2W A;  5KLV H;  3PN1 A;  1V54 B;  2CTQ A;  3T1Y O;  4KXR A;  4MTF A;  3K5L A;  4ZOL B;  1OCR C;  2ZIN A;  1BHB A;  1V54 C;  3D36 C;  1SZT A;  1HNX O;  1AIL A;  4YJ2 A;  3UKM A;  3R65 A;  2UU9 O;  4XBF A;  4U3J A;  4TOI A;  3SPG A;  3BAA A;  2Q7H A;  1PV0 A;  1WB8 A;  1FKA O;  1N32 O;  3G71 V;  5IYD O;  1Q86 W;  4GKK B;  4OGQ B;  5CA1 B;  2LJ2 A;  1J95 A;  1TVK B;  1IBM B;  3LSQ A;  2MK3 A;  2BOC C;  4EB6 B;  4FM0 A;  4PA9 A;  1US6 A;  4Q20 A;  3ZMS A;  4RUE A;  3RVZ A;  1MZF A;  3CRQ A;  4BWA A;  4I55 A;  3D3Q A;  1K7D A;  2M6Y A;  5LA6 A;  1GMG A;  2JK5 C;  2O57 A;  1BMF G;  1Q82 W;  3S3X A;  4GKK O;  5B1O A;  4ZI7 B;  4LFA B;  1CPY A;  5LMN B;  3CSX A;  1IBM O;  5LMU B;  5EBL C;  1TUB A;  3FFQ A;  5A2Q N;  2R72 A;  1YSC A;  4BIO A;  1B6Q A;  5HFL A;  4PHZ A;  4JAS A;  2L35 A;  1MSD A;  4O2B A;  1YF2 A;  2P6J A;  2W0F C;  3OW2 U;  1NTZ H;  2LGW A;  3BA8 A;  3CXC U;  3ABU A;  4BR6 A;  4PI2 A;  4D6T H;  3PJS K;  1N4C A;  4E4E A;  2IW5 A;  4JI5 B;  2NN4 A;  3CPW U;  5LMU O;  1F4N A;  1GN6 A;  4WFF A;  3VQW A;  5IE9 A;  5EBW C;  3UT5 B;  3CX5 F;  2Q5Z A;  3ZMZ A;  3SPJ A;  1L0L H;  2HHH B;  3ETE A;  5LXT B;  3SPI A;  3L75 H;  1QNM A;  4P9O A;  2ITD C;  1XMO O;  3B2E E;  4LBE C;  1VQ7 V;  3FB6 C;  3OGC C;  4GCZ A;  4E2L A;  5E79 Z;  5EIB D;  5J2T A;  1JJ2 U;  4WFH A;  3N2K A;  1W0J G;  2ZIM A;  4LP8 A;  4JI5 O;  4IYH A;  1N0J A;  3JAM N;  4K35 A;  4OXS A;  3ZBH A;  3F7Y C;  1BE3 H;  1XHX A;  2HHH O;  2AHZ A;  5IJ0 B;  4DV3 B;  1MSW D;  1XL6 A;  4U3F H;  4PEL A;  3LNN A;  4WFA V;  3QO8 A;  2LW1 A;  5CA0 A;  1EN5 A;  2ZDI C;  1K4D C;  1HNW B;  4GX2 A;  1N34 B;  2CTP A;  4FPP A;  1AR5 A;  1BSM A;  2M7W A;  4DUY B;  4LC1 A;  1QVG U;  1KYO F;  2Y69 B;  3JSN A;  1PNM A;  5H2F Z;  4H44 B;  4OX9 B;  2Z3Y A;  4J42 A;  2Y69 C;  2HVK C;  3RYC A;  1XRE A;  5CN0 A;  3E35 A;  4DV3 O;  2OTJ V;  1YTF B;  1URF A;  4FLY A;  2XAJ A;  4MVS A;  2P5O A;  3OUS A;  1NT2 B;  2CGN A;  3CP1 A;  3C3S A;  4UUJ C;  3BHP A;  1DF5 A;  2QTO A;  2XUM A;  2EZP A;  4FLV A;  1HNW O;  1N34 O;  2KG7 B;  3VQV A;  4FZ1 A;  4IGG A;  1G8M A;  4DUY O;  2ZR3 A;  3WG7 B;  1BHA A;  4LNU A;  3VOU A;  2QDO A;  1X59 A;  3OM3 B;  1MG1 A;  2XND G;  3B77 A;  3FD9 A;  4OX9 O;  2QTS A;  3WG7 C;  4QNH B;  1U96 A;  2LFS A;  3ZRW B;  4I9W A;  4CZZ A;  4UCV A;  1YHQ V;  1PP9 H;  2VWJ A;  4PJ0 Z;  1JFF B;  5L3C A;  1VEW A;  2ZE6 A;  5KAI Z;  4B3T B;  2CK3 G;  2XAF A;  5BY1 A;  3ZJZ A;  4BW5 A;  3SPH A;  1VQO V;  1VQP V;  1TAE A;  4LF6 B;  3X2Q B;  2ODM A;  1SS3 A;  2A3Q A;  3ZRV A;  1EM1 A;  3X2Q C;  1H2S B;  2Y48 A;  5JQG A;  1FJG B;  3LDD A;  4FLW A;  1B04 A;  2ZM6 B;  4FLZ A;  5DM6 V;  3DXR B;  2WLI A;  2YDE A;  3TK1 A;  4TV8 B;  2Q9L A;  3ZED A;  1VF6 C;  3W7X A;  4KFM A;  2WPD G;  1Q7Y W;  5KA5 A;  5LHG A;  2ZE5 A;  2AHY A;  1FXK B;  1SQG A;  1VF7 A;  2A9H A;  4GX1 A;  3MDS A;  2WLM A;  5LOV A;  5EBM C;  1FXK C;  4JZG A;  4MVR A;  2VRZ A;  1SET A;  2N05 A;  3STZ C;  3ETQ A; 
#chains in the Genus database with same CATH homology
 1Y67 A;  3DC5 A;  1ZUQ A;  1IX9 A;  3AK1 A;  4BR6 A;  1P7G A;  3C3S A;  3DC6 A;  3BFR A;  1N0N A;  1ZSP A;  4E4E A;  3KKY A;  3EVK A;  3LSU A;  1GN6 A;  1GN4 A;  1I0H A;  3K9S A;  1WB7 A;  1SZX A;  1AP5 A;  1EN6 A;  1BS3 A;  1QNM A;  3OT7 A;  5AG2 A;  1I08 A;  1WB8 A;  2RCV A;  1ZLZ A;  1EN4 A;  1XDC A;  1IDS A;  1LUV A;  4GUN A;  1LUW A;  1VEW A;  1GN2 A;  1B06 A;  1PM9 A;  2AW9 A;  2CE4 A;  1PL4 A;  5A9G A;  1N0J A;  4YIO A;  2ADP A;  4JZ2 A;  2QKC A;  3C3T A;  4YIP A;  3TJT A;  1EM1 A;  1BT8 A;  2QKA A;  2GDS A;  1MA1 A;  1VAR A;  3RN4 A;  3QVN A;  1XIL A;  4F6E A;  4FFK A;  1AVM A;  3AK3 A;  1D5N A;  1EN5 A;  2P4K A;  2ADQ B;  1MMM A;  1AP6 A;  1MNG A;  3KDR A;  3IC9 A;  1AR5 A;  3AK2 A;  1JR9 A;  1BSM A;  1IXB A;  1KKC A;  1GN3 A;  1AR4 A;  4JYY A;  3MDS A;  1XUQ A;  4X9Q A;  3CEI A;  1JA8 A;  4JZG A;  1ZTE A;  1MSD A;  4C7U A;  2CDY A;  1XRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...