4BR6A

Crystal structure of chaetomium thermophilum mnsod
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATAEAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPASREGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDKDSGNLAIVTRANQDPVTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWNVINWKTVAQRFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
publication title Crystal Structure and Biochemical Characterization of a Manganese Superoxide Dismutase from Chaetomium Thermophilum.
pubmed doi rcsb
total genus 72
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4br6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4br6A02
1I08A 3DC5A 1AP5A 3TJTA 1I0HA 1N0NA 2GDSA 2P4KA 5A9GA 4FFKA 4YIPA 1P7GA 1XUQA 1WB8A 3AK2A 2AW9A 4GUNA 1VEWA 1AR5A 1LUVA 1MA1A 2QKCA 1ZTEA 3MDSA 1JA8A 1KKCA 1MMMA 1GN4A 1XREA 1B06A 3BFRA 1LUWA 1EN5A 1AP6A 1GN6A 3OT7A 2CDYA 1AR4A 2RCVA 4JZ2A 1BT8A 3AK3A 2QKAA 4JYYA 3C3SA 2CE4A 4X9QA 1PL4A 3KKYA 1N0JA 1D5NA 1PM9A 1ZUQA 5AG2A 3EVKA 1WB7A 3IC9A 2ADPA 4F6EA 1QNMA 3LSUA 1VARA 1MSDA 1ZLZA 1AVMA 1GN2A 1JR9A 3QVNA 1IDSA 1EM1A 4C7UA 1BS3A 1Y67A 1IXBA 2ADQB 1GN3A 1EN6A 3RN4A 1MNGA 4YIOA 4BR6A 1SZXA 1ZSPA 1IX9A 3AK1A 3K9SA 1EN4A 4JZGA 1XILA 1XDCA 4E4EA 3DC6A 1BSMA 3C3TA 3CEIA
chains in the Genus database with same CATH superfamily
1U96A 5B66Z 5CN0A 2BSKB 4LFBO 3JD3A 2DYSB 1TUBA 2VS0A 1LR1A 1WN7A 4O2BB 2YXHA 3JALB 3WB2A 4NKGB 3K59A 5L3BA 3VQYA 2QWNB 5D5QA 3ZEDA 1G4YB 2DJVA 2CGNA 2WLJA 3RYIB 3HKEA 4CS2A 3P32A 5ITZA 1JA8A 2N04A 4MTGA 4GX2A 2QTOA 3W7XA 4OPAA 4UV9A 5B1OA 1LUWA 3I55V 2QDOA 2RDCA 2CK3G 2A79B 2XNDG 4KHPB 2B5UA 4TUYB 3ASNB 1T5EA 4X88A 5LMUO 1GH6A 5H5NA 1CXZB 2RCVA 1JFFB 1CP9A 4JI4O 1WPBA 4GT1A 1COWG 2DN9A 3STZC 1G1XB 4P30A 4X9QA 4B3TO 1D5NA 1PM9A 2IH1C 4YXWG 3AG3C 4N21A 1K73W 3MHHC 2QWPB 4BW9A 1S76D 1AR1B 1FFTB 3I5DA 1R3LC 2E5LO 4J9ZB 4N23A 1THZA 2IJJA 1VIBA 4DV5O 3CC2V 2Y4UA 2WA4A 5IYCO 3BY6A 4H0LB 2UU9O 3K58A 2M7WA 2HR3A 4DR3B 4B3MB 1R1BA 4PDRA 1N36O 4J11A 1HP8A 2DE0X 3SYPA 4B08A 4WBNB 4TWKA 1DK1A 3B2EE 4PV1B 2HLDG 4BIUA 1OCOB 3CC4V 1JJOA 2YSUB 4B7EA 5L3GA 5IYDO 3ZN1A 3L9DA 5LP6A 3C3TA 5KAFZ 3T4ZA 2YI9A 5CBFA 4DRXA 1VQNV 4PA3A 3ZJZA 1FOUA 1PD3A 4MVSA 5IY5C 3ZMVA 4FM2A 4QGPA 4UFZA 2RQ6A 2GDSA 1AJNA 1HNWO 5JJNB 3MAQA 1XUQA 4X66B 2DYRC 1KC8W 1A32A 4WFEA 1KP3A 2HP8A 1YJNV 4XDLA 3FAVA 1KMIZ 3A0BZ 4JTCB 4TSFG 1FAFA 4I9WA 1V55B 3F7VC 2UXXA 1IBMO 4X1YB 3CCVV 3U10A 1MMMA 2PF4E 1XREA 3ZMTA 3W7WA 4K3AA 1ROPA 3UT5B 3CPWU 2CUGA 5J2TA 4ZOLA 4TV8A 1V9PA 2GTSA 3J7AU 1KECA 1NTMH 1FJGB 2BSKA 2P06A 3BCCH 2Q7GA 2CDYA 4CH5A 2IBZH 5IDJA 4ZHQA 2IJHA 3JALA 4TT3G 3CB2A 3ZHTA 1Z2GA 2Y0IA 3VBBA 3KKYA 4UB6Z 3X2QC 4FLZA 1FS0G 3M8AA 2PYJA 4EEQA 1SQGA 2YUAA 4K0KO 2HHHO 2ZR3A 2F4VB 5L3FA 1K34A 5IJ0B 1QLEB 4WCEV 4PD4F 4FM1A 1I5YA 3FB8C 1X4TA 3T1YB 3CWBH 1ORQC 2IU0A 3CE2A 1MZEA 4J7JA 4TUYA 2PGGA 3GB7C 1S5HC 4CZZA 1OCOC 2WAMA 1Y74B 4LP8A 4PA9A 2AXTZ 3ZHSA 4RUFA 3SGIA 1DF5A 3P30A 2OTJV 1XILA 4PDLA 4E4EA 3D36C 4DR3O 3B8MA 4KFMA 4JV5B 1FXVA 4JI1B 4MVZA 4UV8A 2VQFO 3H1KH 2P4KA 2ZNJA 1JNBA 1FD9A 1LNQA 1GTOA 1PNLA 1SA0B 4MTOA 2JK5C 4TV9B 5DECA 2A0LA 1IBKB 3MD0A 2EIKB 3SJAC 2F23A 4WBNA 1MABG 4LWSA 5H6RA 2CTWA 3TXSA 2P67A 5JWPA 5KHKA 1Q6IA 4P9OA 2OTLV 4O4JB 2V1DA 2IJIA 1OCZC 2GSMB 5HFMA 4DV2B 1XMOB 5EBMC 3PJSK 2CAZC 3L70H 3CJHB 5CB4B 3SPJA 3HKBB 4YY3B 1KKDA 4EFEA 1BGYH 2YIDA 4QPJA 2Q73A 2N05A 2JJ1G 3JARB 3L73H 1QLEC 3SDLA 3CCUV 3TCUA 1N0JA 1DGSA 4I50B 4DV4B 4UUJC 3K03A 2W0FC 5K1PA 2AZ2A 3BRCA 4K8ZA 1KYOF 1QNMA 2LFSA 3FKSG 4LFAB 4MVUA 3OTFA 1GN2A 4DV1O 1JR9A 5IWAO 2QWRB 5LXTB 3K06A 2Q0AA 4FLXA 4W4LA 3SJBC 4AILC 3CXHF 5GTHZ 1UPGA 3OEHG 3Q4HA 1IX9A 5LHHA 5EBWC 3K0DA 3OR6C 3D3QA 4EKWA 3SR2C 1K33A 5TISZ 5IJ0A 3CCJV 3D3IA 1YZBA 4GKJO 1H2LA 3PN1A 4FJCC 1N34B 3H1HH 1R3IC 1VMGA 2ARHA 5KHJA 1P7GA 1D5AA 4UCSA 4O4LA 2AW9A 4TQDA 2VQEO 4JI7B 5LL6Y 3E8FA 1Y74A 3A0HZ 3IFXA 2CH7A 2N74A 1FXKB 4P9PA 1N33B 2MK3A 3TXQA 1W0JG 2Y69B 2ZT9B 1BQZA 1VQKV 2OCCB 4CH6A 2ZR2A 1K4DC 3O65A 3R66A 4X20B 4OX9O 2EULA 1VF7A 4FK5C 3AEIA 4F6RB 5LMNO 1IBKO 5CA0B 3AG4C 4GYCB 2Y48A 2PI5A 4YHHO 1E79G 4UCVA 3JD1A 2WLLB 4WFAV 4DV0O 2M6YA 2X7RB 1TAEA 4DXWA 4J10A 4LF9B 3M99B 4LF6O 2QKAA 1UJWB 4JI2O 4B3RO 4J80A 2QM7A 1SA0A 3RFRA 5B3SB 4TV9A 4DV2O 2K1EA 1NU1H 3E22A 4PELA 2R9RB 1HNXB 5JCOA 4RQFA 1WAZA 1SQVH 1M9NA 1F23A 1US6A 3H1LH 4EB6B 2Q8VA 3CD6V 2EX3A 4WF9V 3QVNA 4IHJB 5D5PA 1BE3H 1AROP 5L3CA 1JX9A 2HVKC 2YIAA 4C7UA 4UCOA 3CJHA 4X65O 5CB4A 4IT5A 3K9AA 4Q20A 5DEDA 1RPOA 1QLNA 3JARA 3OAAG 1ZSPA 1AI5A 1RPRA 4NXNB 2Z3YA 4JYBA 4I50A 5LGUA 1VQ8V 3ZHRA 2QA4V 2L35A 4J7ZA 4B3SB 1SQXH 1QVFU 3UO2A 3CCMV 2UXDB 2X6AA 3ZRSA 3APOA 3DSQA 1MG1A 1NH2D 4LFBB 2EIMB 1AJQA 2KG7A 4I4TA 2NR5A 3HKCB 2R9IA 1Q43A 2Q68A 2QKCA 3W7SA 4UB8Z 4IYIA 4MVRA 2WLMA 5KLVH 2Q4PA 1Q6HA 1RSOB 2EJRA 4HNAB 2QWOB 2UXBO 4LF7O 4PJ0Z 3KDRA 5B1BB 5CA1B 3CCLV 3ZHQA 4O4HB 2PY5A 2LP7A 4KP4A 5B3SC 1AP6A 5JH7B 1JCHA 1GN6A 4DV3O 3ABKC 3OT7A 2OIEA 1KU9A 1OV9A 2Y0PA 3JD4A 3RYFB 5LMUB 1VQLV 5CA3A 4JI8O 2JS3A 4JI4B 2JGUA 1M5IA 2D2CB 1VQ5V 3CCRV 4RAIA 2Q69A 3G67A 1FXKA 4B3TB 2GUZB 4R7CA 4LBEC 4ZKIA 3G6EV 3K5LA 2YIBA 5BZBA 4IL6Z 1NVPD 1KBHA 3ICXA 4X20A 2OT5A 1EM1A 2E5LB 4F6RA 2Q6AA 5B1NA 1NZ6A 4DV5B 3OMNB 3JASB 2ZM6O 4DR4O 2UU9B 2F43G 2QJ1A 3SJCC 1S77D 4G28B 1M56B 1H8EG 1HDJA 4MVMA 3AG3B 2EIMC 3ML0A 1W59A 2YS8A 3VQVA 3FB6C 2LW7A 2ZINA 4JAAA 3JAWA 3B4SA 1O9GA 4EB6A 1I0HA 4MSWC 2VWJA 4IHJA 3RGBA 2DWEC 1MSWD 5A9GA 4NXNO 3H9VA 1JVMA 1KP2A 4O4IB 1B3QA 5BY1A 4JI5O 2OWOA 2UUBO 2LW1A 3ZRWB 1HNWB 1JOYA 1I7FA 3BHPA 3RVZA 5B1BC 4YJ3B 4H37A 1QR8A 1J5EO 5F2VO 1M90W 1YDXA 2BOBC 3ZMUA 4CH3A 4X89A 1Y76B 1IBMB 2Q9LA 5B1AC 1YI2V 4U3FH 2ZXWC 2W6JG 4LFCO 1XL4A 5KA5A 1NR7A 2ZQMA 5IY5B 2WLIB 1PP9H 3G80A 4DR7O 3OFNG 1M57B 1QQCA 3S3WA 2D3OW 3OUSA 2DYRB 3BA8A 4QE7A 3QTCA 5EYPA 2A7WA 1RSOA 2WLNA 4HNAA 4K0KB 2HHHB 4LNUB 4G27B 1P84F 2X0LA 3RT3C 1YTFB 1TA8A 4O4HA 5J2UB 4PA4A 2P7TC 5FLXN 4D7SA 4JYCA 3U11A 2NNUA 5JH7A 1H2NA 1M56C 2AZ0A 1YIJV 1VQ4V 3RYFA 2ZKOA 1FFXA 3K79A 4MTFA 1S5JA 4YIOA 2XT9A 4ZI7A 4LF4O 5A2QN 5H6QA 3X2QB 3QO8A 2GUZA 2UUCO 2YXYA 3ABLB 4KXRA 2ZDIC 3OW2U 4UCRA 2X6BA 3TJTA 1KD1W 3JAMN 3L71H 1TGOA 1F4NA 2EBOA 3K57A 4GX1A 4XDJA 2VQFB 4X64O 4GCZA 3JASA 2GTAA 3CMAV 2HJFC 2R9AA 4IIJB 1N8RW 1L1FA 2ZIOA 4MS2A 4ASUG 1IVSA 1VQOV 1G8MA 2LGWA 4LR3A 1DTOA 1M57C 2MW2B 1NI8A 3QO7A 4DUYO 4O4IA 1QBZA 5BMVB 1XHZA 5IT9N 1PV0A 1PL4A 3ZRWA 4F4LA 5IE9A 1RP3B 4YJ3A 2Y4TA 1SETA 5IYBO 4LF5O 1K3EA 2P6JA 1Y76A 3P3NA 1L0LH 1VARA 4NTXA 3JAKB 1AVMA 1AJPA 4O2BA 2ITDC 4J7KA 4NXMO 1Y66A 2JGDB 1OCZB 3F5TA 1WJZA 1BS3A 4DV1B 5IWAB 4PA6A 3ETEA 1P49A 1VQ6V 1IXBA 1URFA 3RYIA 5E1AC 3ABLC 1EN6A 3UM7A 1MNGA 1OHHG 1SRYA 5JVDB 2XOKG 1GRJA 2QM8A 2BE3A 3SPIA 3FFQA 1N0NA 1HW7A 1VF5B 3A8TA 3BPZA 1JFFA 4GKJB 4H44B 1XBLA 1I5XA 1NVPB 3HR0A 2EIJC 2EILB 2VQEB 4U3JB 1SC5B 1NJIW 1YVWA 3CXCU 3LSQA 4JAVA 1B06A 1M93A 2IM9A 2ZE8A 3ETGA 5B5EZ 4GLXA 1S3JA 3O9OA 3F5WC 4MVOA 1EN5A 1JPXA 1K97A 3OR7C 2EINB 1QR9A 3LNNA 3CS5A 1H2KA 1M4UA 1SESA 4DR2O 4CS3A 4OX9B 5LMNB 5LYJB 1KUQA 5EZYB 4YHHB 2E74B 3UQ8A 4DV0B 3S3XA 4LF6B 2DQ3A 2ZNIA 4JI2B 4B3RB 4IIJA 3B8NA 1TVKB 1NR1A 1ENVA 2FYUH 2R72A 1Q8IA 2LGQA 3ABTA 3JSLA 2PI4A 1Q81W 1IXMA 3SYQA 4UCTA 4DK0A 4HYOA 3A0RA 4OXSA 3ZRVA 2QM4A 4MW3A 3D36A 1VQMV 3G4SV 4JAUA 4OGQB 3AG1B 3AG4B 4X65B 2P5OA 3I56V 4X1YA 1Z5VA 2HJDA 1WP7A 3UT5A 3SPHA 3B40A 4BWAA 4XDKA 5K1XA 2KQXA 4FFBB 4FMTA 4H33A 4DV7O 3QNEA 4JI0O 3JAKA 3FYIB 5KMGB 2EILC 5KHGA 2YC0A 1Y4MA 1QVGU 3AG2C 3OTOO 3EFFK 4E2LA 3AK2A 1XNQO 1N32O 1XQ8A 3ZN0A 3N2GB 2ETNA 1ZWIC 3JYCA 2EINC 1W0KG 4X1KB 4I55B 1WNSA 1Q82W 3QO5A 2LFRA 2UXBB 4LF7B 2FTKA 1NQTA 1PNMA 3J80N 3CRCA 4JZ2A 4O2AB 4DV3B 2QEXV 1GM9A 4JYYA 3JATB 3J81N 2V4DA 2PZSA 3ZMSA 3EXAA 1YXBA 3E83A 3THOA 4JI8B 4FIPC 1NS1A 2XTAA 5L3DA 4DV6O 2X6CA 2ZE6A 3AG1C 1ZLZA 3LNMB 1CPYA 5KX5B 5GONB 3U0ZA 1H2MA 1VF6C 2W6IG 2KB1A 2A3QA 3ABKB 1GK9A 5LYJA 2BTQB 5EZYA 3BVOA 1NT2B 2P22C 4DUZO 1K5QA 3RBZA 2ZM6B 4DR4B 3AK1A 1H5WA 4CBCA 4AQYO 1K9MW 1EN4A 4O4JA 2ZD9A 1XHXA 2V7QG 3K08A 3RVYA 3BABA 2LJ2A 1Y6XA 3F7YC 3N2KB 4OPHA 2KSDA 4FLTA 3HKBA 1L0NH 1W2BU 1M1KW 1VEWA 1LUVA 5LA6B 5KHIA 2Q5ZA 3DGEA 4FM0A 1R73A 1YCIA 4JI5B 2UUBB 4J9YB 1ZL8B 3SPGA 1J5EB 2LQTA 3VOUA 3BFRA 2RJZA 4FFBA 1P7BA 1PL0A 3G71V 2PUSA 4QNHB 3CYOA 5LXTA 1B04A 2Q0OC 4GX0A 3SYOA 2GHYA 3ZBHA 1X59A 4LFCB 4UVAA 5CMUA 3AK3A 2FMLA 3KCYA 3C3SA 1AI4A 1S5LZ 3IC7A 2ATKC 3QF7A 5CBHA 1O9HA 3N2GA 4DR7B 5AG2A 2XAFA 4I5SA 4I0XB 4X1KA 4I55A 2XAQA 3L72H 4FZ0A 3APQA 5LGTA 2AHYA 3HKDB 1GO3F 2QWQB 4LH7A 1IBLB 5B1AB 2ZXWB 3ZRXA 4WFHA 1U97A 2F1MA 3VQXA 4QIWF 1SQPH 1DF4A 1E1RG 1SZXA 3A2FA 1SQFA 3ABMC 2AGAA 3W7TA 1GM7A 4LF4B 4I9QA 4WFGA 4H13B 4MT8A 1I08A 1HR0B 3DC5A 3OGCC 5CA0A 2UUCB 1SS3A 1RM1B 4DYLA 2WLLA 1Q86W 1VP7A 5JQGB 5KX5A 2RNBA 2RMKB 5LOVB 2QGNA 5GONA 2FKXA 2HKOA 3QG5A 2A9HA 2XASA 2BTQA 2WSSG 4X64B 3ABUA 3JD0A 3IAYA 4K35A 2KKWA 1EFRG 5EK0A 1RFYA 3RYCB 5LP6B 1GAXA 1OCCC 3RYHB 3K04A 2QR4A 2QSAA 2P90A 3T4DA 1VQ7V 1BT8A 4DO2A 2B9ZA 5LA6A 3GWOA 4DUYB 2RN9A 3FAVB 1YJ9V 1YITV 1H38A 1ZL8A 3EVKA 3E89A 4JYAO 3ZS8C 4LF5B 3LSUA 3FYEB 5C8YB 2GV9A 3SJQC 4TV8B 4PDVA 3ETDA 2DMXA 2NN4A 5DN6G 4RWUA 3MHSC 1Y67A 3HKCA 4NXMB 4X1IB 3BA9A 2EJ7A 5L3EA 1F7YA 1XNRO 4ZHQB 3JD2A 2OYQA 4MVQA 1NBMG 3LDDA 1FKAO 4BR6A 1QCEA 3FB5C 2YEVB 1RM1C 2DWDC 2ZE7A 5CA1A 4JI3O 1IBLO 4I0XA 1H2GA 3LSSA 4ABMA 3STLC 3N27A 4QJFB 1XL6A 3HKDA 3H1JH 1HNZO 1Q5OA 4JASA 4YIPA 1MOFA 1AR5A 2WLHA 1UFIA 2IU3A 1P4RA 4ZIBA 3DXRB 3RW0A 5DM6V 1HR0O 1AI7A 2FB5A 4HAMA 3ZIAG 5LP6C 1XMQO 2H3OA 3OD4A 5H2FZ 1IZ3A 3KZIZ 4LH6A 1J95A 3AG7A 1ZAUA 5EC2C 2JVDA 1VQ9V 2JS5A 4DR1O 4KUMA 4CS4A 3H1IH 4IYHA 5JQGA 4G2KA 4A5UB 5LOVA 1MZFA 2JEXA 3GVMA 4DR2B 2YXLA 2CE4A 4UXNA 3SYCA 3L75H 4DR5O 3K0GA 4MW8A 2FL4A 2ITCC 2E75B 2EIJB 2BCCH 1OCRC 3OGIB 3TK1A 2YIBD 3W7UA 4WFFA 3CRMA 2HG5C 4ICGA 4JTDB 2DYSC 1AB3A 1E1QG 4LWSB 1BHAA 1SF9A 5LHGA 2R70A 4UVBA 1S72V 4NTYA 4JI6O 3RYCA 4D7TA 5EC1C 1I94B 3T1HO 4L87A 2ZDIA 3FX7A 5FPOA 5JJJB 2HVJC 3RYHA 1Q7YW 1FXHA 4FLYA 1NH2B 2H94A 1Z5WA 1V54B 4GKKO 4DW0A 2UUAO 1DLBA 4UVCA 3IJ4A 2JJ2G 5LGNA 4X62O 2L6LA 4LF8O 2NLJC 5EIBD 2VRZA 3E35A 2XUMA 4U7NA 3CP1A 2DOSA 2YI8A 4TOIA 3K5OA 3KCXA 5CBGA 5KHHA 3ASNC 5C8YA 2OCHA 1AP5A 3OMIB 3B09A 2BTOA 3JSNA 4DV7B 2WLIA 4JI0B 3K3WA 1YHQV 4FFKA 1WB8A 2UXCB 4HZ3A 4CC6A 1SKVA 4X1IA 2CTQA 1MA1A 3OTOB 3UKMA 5JJEB 2E3CA 2DQ0A 4PA7A 3VQWA 1XNQB 1N32B 2ZE5A 2Q67A 1ZX3A 1K7DA 2YEVA 3Q4HB 4U7OA 2Q7HA 4LNUA 1Q90D 5EBLC 5J2UA 4KHPO 1XEQA 1EZJA 1BHBA 2Z0AA 1BQ0A 3T1CA 1K8AW 3M7MX 4MTXA 5FL7G 2C2AA 3FB7C 3UO3A 2WLKA 3AG2B 3R65A 4O4LB 2E76B 4GZRB 3WG7B 4FLWA 4FLVA 5H9CA 4RO2A 3DXRA 2IW5A 4IGGA 2F95B 2PYLA 3CX5F 2CH7B 3CRRA 1WLEA 2EZPA 4FPPA 4DV6B 2XAHA 1V54C 1R6TA 1IDSA 4D6TH 4PHZA 3E86A 4DK1A 4B3MO 5GTIZ 3LDEA 3GWKC 1V55C 2F93B 1KB9F 4JF3A 3SPCA 1EBOA 2HFEC 2XAJA 4B7KA 1FPOA 1F51A 2XAGA 3ZHUA 1I94O 3NR7A 3K9SA 2IJKA 4CC5A 4DUZB 2AHZA 3ETQA 3KG2A 3E22B 1GKFA 3CEIA 3ZHVA 4GX5A 3CCQV 4AQYB 4J41A 3WFVA 3E8GA 4X66O 5J9PC 4HBNA 5IYZB 4R6ZA 5BMVA 3CSXA 3CCEV 3CRAA 5KUKA 3SYAA 2PTMA 4EFBA 4JPRA 1AILA 2DW4A 3ASOB 1N4CA 1L8DA 1GN4A 1R3JC 1FJGO 2UXCO 2JGDA 2F66C 2G38A 2IH3C 3K5MA 3WG7C 2QKSA 4AHCA 1SZTA 1AR4A 2YDEA 1F4MA 1WP8A 3CRQA 1PNKA 4UCUA 2KG7B 4I4TB 4X8AA 3ZCCA 2F4VO 5JVDA 2Z5UA 1Q3EA 2GBOA 5IJ9B 1TUEB 3NXSA 3IC9A 2ADPA 1BCCH 1HWYA 3T1YO 2LO1A 3HPLC 2EZOA 1WA8B 2ZCEA 1AI6A 5KA6A 1KQSU 3B77A 3CC7V 1D2DA 3CHXA 3TGUH 2EIKC 2ADQB 1GN3A 1K4CC 4U3JA 1GM8A 3E8HA 3FD9A 5JCOC 3RN4A 4NB5A 4BIZA 5C93A 4LC1A 4NVPA 4WFBV 2O57A 4RQEA 3E2EA 1R6KA 2H8PC 2WWWA 1FYJA 1IJGA 4JV5O 3P3PA 4JI1O 3DC6A 1BSMA 1YTFD 2JDIG 3ZX6A 2QTSA 4P2ZA 1YEWA 1YJWV 3C90A 3BAAA 4BW5A 1Q6UA 5BR8B 4BAYA 4FLUA 1R3KC 4Q6GA 1BMFG 3ASOC 4AI8A 4JTAB 2OIGA 4GUNA 4PDMA 3H01A 1QHTA 2ILMA 3EHBB 4ZBMA 3L74H 3WB0A 1TVKA 2VWKA 1KKCA 3HB3B 4Z2WA 3ABMB 4XBFA 3LDCA 1XMOO 4QPKA 4KL1A 3JAWB 4YY3O 5FNVB 2JIZG 1BL8A 2ZIMA 1XOUA 5IYZA 2WA3A 1SQQH 1CEZA 3JCUZ 3UCSC 2P4VA 5FPRA 4DV4O 3OUFA 1VF6A 1ZUQA 2W0XA 4LFAO 3OMAB 2XHBA 4YJ2B 3OE7G 5E79Z 5BXZA 5KMGA 4DR6B 4PI2A 4JYAB 4BIOA 1TUBB 1SQBH 4DW1A 1S0VA 1QU7A 1JQ0A 1OCCB 3LUTB 4Z1MG 3WB1A 3CMEV 1H8HG 1FXKC 5KUMA 4FVMA 3HKEB 1EZVH 2Y69C 5ITZB 2OCCC 1XI1A 1XNRB 5IJ9A 5EYPB 1XDCA 1OZ0A 4QE9A 1OJHA 1N34O 4RUEA 5LHIA 4JI3B 3JCZA 4K8XA 1R6NA 1WA8A 4JI7O 4O2AA 4Z1VA 5GW7A 1PPJH 1B6QA 1YF2A 3JATA 2B1IA 5LBQA 1NKDA 3ZMZA 1HNZB 1N33O 4CH4A 1ZTEA 1SERA 2UXNA 4I7ZB 5EIBC 3D8CA 3OM3B 3MDSA 1FFXB 2CGOA 5BR8O 4ZI7B 4PI0A 2Q7EA 1XMQB 2YICA 3BEHA 3IGAC 4L8JA 2CTRA 2HEPA 3G6BA 5KAIZ 4NR1A 3TETA 2K9PA 4LF9O 4DR1B 1K5SA 2WPDG 3WU2Z 1K92A 3CCSV 3RWRD 4NTWA 3DTUB 1HNXO 2A06H 1NTZH 1G6UA 2JRIA 4DR5B 1WB7A 2B1GA 2BOCC 2JEUA 4F6EA 1MSDA 4DRXB 4W4KA 1BZKA 1N36B 3N2KA 2QE7G 4J42A 4R50A 1VQPV 4R8CA 4JGSA 3T2MA 4JI6B 5FNVA 1YSCA 1JJ2U 4NYKA 3T1HB 4TQFA 5HFLA 4LCUC 4DR6O 3OEEG 1IURA 4GKKB 1JMKC 4B3SO 1GMGA 4FZ1A 3K5NA 2UUAB 1NTKH 2ODMA 1WPXA 1H2SB 3E8BA 2CTPA 5J2TB 4JZGA 4X62B 4ZOLB 4LF8B 2UXDO 1OCRB 1PKXA 4YJ2A
chains in the Genus database with same CATH topology
1I08A 3DC5A 1AP5A 3TJTA 1I0HA 1N0NA 2GDSA 2P4KA 5A9GA 4FFKA 4YIPA 1P7GA 1XUQA 1WB8A 3AK2A 2AW9A 4GUNA 1VEWA 1AR5A 1LUVA 1MA1A 2QKCA 1ZTEA 3MDSA 1JA8A 1KKCA 1MMMA 1GN4A 1XREA 3KDRA 1B06A 3BFRA 1LUWA 1EN5A 1AP6A 1GN6A 3OT7A 2CDYA 1AR4A 2RCVA 4JZ2A 1BT8A 3AK3A 2QKAA 4JYYA 3C3SA 2CE4A 4X9QA 1PL4A 3KKYA 1N0JA 1D5NA 1PM9A 1ZUQA 5AG2A 3EVKA 1WB7A 3IC9A 2ADPA 4F6EA 1QNMA 3LSUA 1VARA 1MSDA 1ZLZA 1AVMA 1GN2A 1JR9A 3QVNA 1IDSA 1EM1A 4C7UA 1BS3A 1Y67A 1IXBA 2ADQB 1GN3A 1EN6A 3RN4A 1MNGA 4YIOA 4BR6A 1SZXA 1ZSPA 1IX9A 3AK1A 3K9SA 1EN4A 4JZGA 1XILA 1XDCA 4E4EA 3DC6A 1BSMA 3C3TA 3CEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I08 A;  3DC5 A;  1AP5 A;  3TJT A;  1I0H A;  1N0N A;  2GDS A;  2P4K A;  5A9G A;  4FFK A;  4YIP A;  1P7G A;  1XUQ A;  1WB8 A;  3AK2 A;  2AW9 A;  4GUN A;  1VEW A;  1AR5 A;  1LUV A;  1MA1 A;  2QKC A;  1ZTE A;  3MDS A;  1JA8 A;  1KKC A;  1MMM A;  1GN4 A;  1XRE A;  1B06 A;  3BFR A;  1LUW A;  1EN5 A;  1AP6 A;  1GN6 A;  3OT7 A;  2CDY A;  1AR4 A;  2RCV A;  4JZ2 A;  1BT8 A;  3AK3 A;  2QKA A;  4JYY A;  3C3S A;  2CE4 A;  4X9Q A;  1PL4 A;  3KKY A;  1N0J A;  1D5N A;  1PM9 A;  1ZUQ A;  5AG2 A;  3EVK A;  1WB7 A;  3IC9 A;  2ADP A;  4F6E A;  1QNM A;  3LSU A;  1VAR A;  1MSD A;  1ZLZ A;  1AVM A;  1GN2 A;  1JR9 A;  3QVN A;  1IDS A;  1EM1 A;  4C7U A;  1BS3 A;  1Y67 A;  1IXB A;  2ADQ B;  1GN3 A;  1EN6 A;  3RN4 A;  1MNG A;  4YIO A;  4BR6 A;  1SZX A;  1ZSP A;  1IX9 A;  3AK1 A;  3K9S A;  1EN4 A;  4JZG A;  1XIL A;  1XDC A;  4E4E A;  3DC6 A;  1BSM A;  3C3T A;  3CEI A; 
#chains in the Genus database with same CATH topology
 1U96 A;  5B66 Z;  5CN0 A;  2BSK B;  4LFB O;  3JD3 A;  2DYS B;  1TUB A;  2VS0 A;  1LR1 A;  1WN7 A;  4O2B B;  2YXH A;  3JAL B;  3WB2 A;  4NKG B;  3K59 A;  5L3B A;  3VQY A;  2QWN B;  5D5Q A;  3ZED A;  1G4Y B;  2DJV A;  2CGN A;  2WLJ A;  3RYI B;  3HKE A;  4CS2 A;  3P32 A;  5ITZ A;  1JA8 A;  2N04 A;  4MTG A;  4GX2 A;  2QTO A;  3W7X A;  4OPA A;  4UV9 A;  5B1O A;  1LUW A;  3I55 V;  2QDO A;  2RDC A;  2CK3 G;  2A79 B;  2XND G;  4KHP B;  2B5U A;  4TUY B;  3ASN B;  1T5E A;  4X88 A;  5LMU O;  1GH6 A;  5H5N A;  1CXZ B;  2RCV A;  1JFF B;  1CP9 A;  4JI4 O;  1WPB A;  4GT1 A;  1COW G;  2DN9 A;  3STZ C;  1G1X B;  4P30 A;  4X9Q A;  4B3T O;  1D5N A;  1PM9 A;  2IH1 C;  4YXW G;  3AG3 C;  4N21 A;  1K73 W;  3MHH C;  2QWP B;  4BW9 A;  1S76 D;  1AR1 B;  1FFT B;  3I5D A;  1R3L C;  2E5L O;  4J9Z B;  4N23 A;  1THZ A;  2IJJ A;  1VIB A;  4DV5 O;  3CC2 V;  2Y4U A;  2WA4 A;  5IYC O;  3BY6 A;  4H0L B;  2UU9 O;  3K58 A;  2M7W A;  2HR3 A;  4DR3 B;  4B3M B;  1R1B A;  4PDR A;  1N36 O;  4J11 A;  1HP8 A;  2DE0 X;  3SYP A;  4B08 A;  4WBN B;  4TWK A;  1DK1 A;  3B2E E;  4PV1 B;  2HLD G;  4BIU A;  1OCO B;  3CC4 V;  1JJO A;  2YSU B;  4B7E A;  5L3G A;  5IYD O;  3ZN1 A;  3L9D A;  5LP6 A;  3C3T A;  5KAF Z;  3T4Z A;  2YI9 A;  5CBF A;  4DRX A;  1VQN V;  4PA3 A;  3ZJZ A;  1FOU A;  1PD3 A;  4MVS A;  5IY5 C;  3ZMV A;  4FM2 A;  4QGP A;  4UFZ A;  2RQ6 A;  2GDS A;  1AJN A;  1HNW O;  5JJN B;  3MAQ A;  1XUQ A;  4X66 B;  2DYR C;  1KC8 W;  1A32 A;  4WFE A;  1KP3 A;  2HP8 A;  1YJN V;  4XDL A;  3FAV A;  1KMI Z;  3A0B Z;  4JTC B;  4TSF G;  1FAF A;  4I9W A;  1V55 B;  3F7V C;  2UXX A;  1IBM O;  4X1Y B;  3CCV V;  3U10 A;  1MMM A;  2PF4 E;  1XRE A;  3ZMT A;  3W7W A;  4K3A A;  1ROP A;  3UT5 B;  3CPW U;  2CUG A;  5J2T A;  4ZOL A;  4TV8 A;  1V9P A;  2GTS A;  3J7A U;  1KEC A;  1NTM H;  1FJG B;  2BSK A;  2P06 A;  3BCC H;  2Q7G A;  2CDY A;  4CH5 A;  2IBZ H;  5IDJ A;  4ZHQ A;  2IJH A;  3JAL A;  4TT3 G;  3CB2 A;  3ZHT A;  1Z2G A;  2Y0I A;  3VBB A;  3KKY A;  4UB6 Z;  3X2Q C;  4FLZ A;  1FS0 G;  3M8A A;  2PYJ A;  4EEQ A;  1SQG A;  2YUA A;  4K0K O;  2HHH O;  2ZR3 A;  2F4V B;  5L3F A;  1K34 A;  5IJ0 B;  1QLE B;  4WCE V;  4PD4 F;  4FM1 A;  1I5Y A;  3FB8 C;  1X4T A;  3T1Y B;  3CWB H;  1ORQ C;  2IU0 A;  3CE2 A;  1MZE A;  4J7J A;  4TUY A;  2PGG A;  3GB7 C;  1S5H C;  4CZZ A;  1OCO C;  2WAM A;  1Y74 B;  4LP8 A;  4PA9 A;  2AXT Z;  3ZHS A;  4RUF A;  3SGI A;  1DF5 A;  3P30 A;  2OTJ V;  1XIL A;  4PDL A;  4E4E A;  3D36 C;  4DR3 O;  3B8M A;  4KFM A;  4JV5 B;  1FXV A;  4JI1 B;  4MVZ A;  4UV8 A;  2VQF O;  3H1K H;  2P4K A;  2ZNJ A;  1JNB A;  1FD9 A;  1LNQ A;  1GTO A;  1PNL A;  1SA0 B;  4MTO A;  2JK5 C;  4TV9 B;  5DEC A;  2A0L A;  1IBK B;  3MD0 A;  2EIK B;  3SJA C;  2F23 A;  4WBN A;  1MAB G;  4LWS A;  5H6R A;  2CTW A;  3TXS A;  2P67 A;  5JWP A;  5KHK A;  1Q6I A;  4P9O A;  2OTL V;  4O4J B;  2V1D A;  2IJI A;  1OCZ C;  2GSM B;  5HFM A;  4DV2 B;  1XMO B;  5EBM C;  3PJS K;  2CAZ C;  3L70 H;  3CJH B;  5CB4 B;  3SPJ A;  3HKB B;  4YY3 B;  1KKD A;  4EFE A;  1BGY H;  2YID A;  4QPJ A;  2Q73 A;  2N05 A;  2JJ1 G;  3JAR B;  3L73 H;  1QLE C;  3SDL A;  3CCU V;  3TCU A;  1N0J A;  1DGS A;  4I50 B;  4DV4 B;  4UUJ C;  3K03 A;  2W0F C;  5K1P A;  2AZ2 A;  3BRC A;  4K8Z A;  1KYO F;  1QNM A;  2LFS A;  3FKS G;  4LFA B;  4MVU A;  3OTF A;  1GN2 A;  4DV1 O;  1JR9 A;  5IWA O;  2QWR B;  5LXT B;  3K06 A;  2Q0A A;  4FLX A;  4W4L A;  3SJB C;  4AIL C;  3CXH F;  5GTH Z;  1UPG A;  3OEH G;  3Q4H A;  1IX9 A;  5LHH A;  5EBW C;  3K0D A;  3OR6 C;  3D3Q A;  4EKW A;  3SR2 C;  1K33 A;  5TIS Z;  5IJ0 A;  3CCJ V;  3D3I A;  1YZB A;  4GKJ O;  1H2L A;  3PN1 A;  4FJC C;  1N34 B;  3H1H H;  1R3I C;  1VMG A;  2ARH A;  5KHJ A;  1P7G A;  1D5A A;  4UCS A;  4O4L A;  2AW9 A;  4TQD A;  2VQE O;  4JI7 B;  5LL6 Y;  3E8F A;  1Y74 A;  3A0H Z;  3IFX A;  2CH7 A;  2N74 A;  1FXK B;  4P9P A;  1N33 B;  2MK3 A;  3TXQ A;  1W0J G;  2Y69 B;  2ZT9 B;  1BQZ A;  1VQK V;  2OCC B;  4CH6 A;  2ZR2 A;  1K4D C;  3O65 A;  3R66 A;  4X20 B;  4OX9 O;  2EUL A;  1VF7 A;  4FK5 C;  3AEI A;  4F6R B;  5LMN O;  1IBK O;  5CA0 B;  3AG4 C;  4GYC B;  2Y48 A;  2PI5 A;  4YHH O;  1E79 G;  4UCV A;  3JD1 A;  2WLL B;  4WFA V;  4DV0 O;  2M6Y A;  2X7R B;  1TAE A;  4DXW A;  4J10 A;  4LF9 B;  3M99 B;  4LF6 O;  2QKA A;  1UJW B;  4JI2 O;  4B3R O;  4J80 A;  2QM7 A;  1SA0 A;  3RFR A;  5B3S B;  4TV9 A;  4DV2 O;  2K1E A;  1NU1 H;  3E22 A;  4PEL A;  2R9R B;  1HNX B;  5JCO A;  4RQF A;  1WAZ A;  1SQV H;  1M9N A;  1F23 A;  1US6 A;  3H1L H;  4EB6 B;  2Q8V A;  3CD6 V;  2EX3 A;  4WF9 V;  3QVN A;  4IHJ B;  5D5P A;  1BE3 H;  1ARO P;  5L3C A;  1JX9 A;  2HVK C;  2YIA A;  4C7U A;  4UCO A;  3CJH A;  4X65 O;  5CB4 A;  4IT5 A;  3K9A A;  4Q20 A;  5DED A;  1RPO A;  1QLN A;  3JAR A;  3OAA G;  1ZSP A;  1AI5 A;  1RPR A;  4NXN B;  2Z3Y A;  4JYB A;  4I50 A;  5LGU A;  1VQ8 V;  3ZHR A;  2QA4 V;  2L35 A;  4J7Z A;  4B3S B;  1SQX H;  1QVF U;  3UO2 A;  3CCM V;  2UXD B;  2X6A A;  3ZRS A;  3APO A;  3DSQ A;  1MG1 A;  1NH2 D;  4LFB B;  2EIM B;  1AJQ A;  2KG7 A;  4I4T A;  2NR5 A;  3HKC B;  2R9I A;  1Q43 A;  2Q68 A;  2QKC A;  3W7S A;  4UB8 Z;  4IYI A;  4MVR A;  2WLM A;  5KLV H;  2Q4P A;  1Q6H A;  1RSO B;  2EJR A;  4HNA B;  2QWO B;  2UXB O;  4LF7 O;  4PJ0 Z;  3KDR A;  5B1B B;  5CA1 B;  3CCL V;  3ZHQ A;  4O4H B;  2PY5 A;  2LP7 A;  4KP4 A;  5B3S C;  1AP6 A;  5JH7 B;  1JCH A;  1GN6 A;  4DV3 O;  3ABK C;  3OT7 A;  2OIE A;  1KU9 A;  1OV9 A;  2Y0P A;  3JD4 A;  3RYF B;  5LMU B;  1VQL V;  5CA3 A;  4JI8 O;  2JS3 A;  4JI4 B;  2JGU A;  1M5I A;  2D2C B;  1VQ5 V;  3CCR V;  4RAI A;  2Q69 A;  3G67 A;  1FXK A;  4B3T B;  2GUZ B;  4R7C A;  4LBE C;  4ZKI A;  3G6E V;  3K5L A;  2YIB A;  5BZB A;  4IL6 Z;  1NVP D;  1KBH A;  3ICX A;  4X20 A;  2OT5 A;  1EM1 A;  2E5L B;  4F6R A;  2Q6A A;  5B1N A;  1NZ6 A;  4DV5 B;  3OMN B;  3JAS B;  2ZM6 O;  4DR4 O;  2UU9 B;  2F43 G;  2QJ1 A;  3SJC C;  1S77 D;  4G28 B;  1M56 B;  1H8E G;  1HDJ A;  4MVM A;  3AG3 B;  2EIM C;  3ML0 A;  1W59 A;  2YS8 A;  3VQV A;  3FB6 C;  2LW7 A;  2ZIN A;  4JAA A;  3JAW A;  3B4S A;  1O9G A;  4EB6 A;  1I0H A;  4MSW C;  2VWJ A;  4IHJ A;  3RGB A;  2DWE C;  1MSW D;  5A9G A;  4NXN O;  3H9V A;  1JVM A;  1KP2 A;  4O4I B;  1B3Q A;  5BY1 A;  4JI5 O;  2OWO A;  2UUB O;  2LW1 A;  3ZRW B;  1HNW B;  1JOY A;  1I7F A;  3BHP A;  3RVZ A;  5B1B C;  4YJ3 B;  4H37 A;  1QR8 A;  1J5E O;  5F2V O;  1M90 W;  1YDX A;  2BOB C;  3ZMU A;  4CH3 A;  4X89 A;  1Y76 B;  1IBM B;  2Q9L A;  5B1A C;  1YI2 V;  4U3F H;  2ZXW C;  2W6J G;  4LFC O;  1XL4 A;  5KA5 A;  1NR7 A;  2ZQM A;  5IY5 B;  2WLI B;  1PP9 H;  3G80 A;  4DR7 O;  3OFN G;  1M57 B;  1QQC A;  3S3W A;  2D3O W;  3OUS A;  2DYR B;  3BA8 A;  4QE7 A;  3QTC A;  5EYP A;  2A7W A;  1RSO A;  2WLN A;  4HNA A;  4K0K B;  2HHH B;  4LNU B;  4G27 B;  1P84 F;  2X0L A;  3RT3 C;  1YTF B;  1TA8 A;  4O4H A;  5J2U B;  4PA4 A;  2P7T C;  5FLX N;  4D7S A;  4JYC A;  3U11 A;  2NNU A;  5JH7 A;  1H2N A;  1M56 C;  2AZ0 A;  1YIJ V;  1VQ4 V;  3RYF A;  2ZKO A;  1FFX A;  3K79 A;  4MTF A;  1S5J A;  4YIO A;  2XT9 A;  4ZI7 A;  4LF4 O;  5A2Q N;  5H6Q A;  3X2Q B;  3QO8 A;  2GUZ A;  2UUC O;  2YXY A;  3ABL B;  4KXR A;  2ZDI C;  3OW2 U;  4UCR A;  2X6B A;  3TJT A;  1KD1 W;  3JAM N;  3L71 H;  1TGO A;  1F4N A;  2EBO A;  3K57 A;  4GX1 A;  4XDJ A;  2VQF B;  4X64 O;  4GCZ A;  3JAS A;  2GTA A;  3CMA V;  2HJF C;  2R9A A;  4IIJ B;  1N8R W;  1L1F A;  2ZIO A;  4MS2 A;  4ASU G;  1IVS A;  1VQO V;  1G8M A;  2LGW A;  4LR3 A;  1DTO A;  1M57 C;  2MW2 B;  1NI8 A;  3QO7 A;  4DUY O;  4O4I A;  1QBZ A;  5BMV B;  1XHZ A;  5IT9 N;  1PV0 A;  1PL4 A;  3ZRW A;  4F4L A;  5IE9 A;  1RP3 B;  4YJ3 A;  2Y4T A;  1SET A;  5IYB O;  4LF5 O;  1K3E A;  2P6J A;  1Y76 A;  3P3N A;  1L0L H;  1VAR A;  4NTX A;  3JAK B;  1AVM A;  1AJP A;  4O2B A;  2ITD C;  4J7K A;  4NXM O;  1Y66 A;  2JGD B;  1OCZ B;  3F5T A;  1WJZ A;  1BS3 A;  4DV1 B;  5IWA B;  4PA6 A;  3ETE A;  1P49 A;  1VQ6 V;  1IXB A;  1URF A;  3RYI A;  5E1A C;  3ABL C;  1EN6 A;  3UM7 A;  1MNG A;  1OHH G;  1SRY A;  5JVD B;  2XOK G;  1GRJ A;  2QM8 A;  2BE3 A;  3SPI A;  3FFQ A;  1N0N A;  1HW7 A;  1VF5 B;  3A8T A;  3BPZ A;  1JFF A;  4GKJ B;  4H44 B;  1XBL A;  1I5X A;  1NVP B;  3HR0 A;  2EIJ C;  2EIL B;  2VQE B;  4U3J B;  1SC5 B;  1NJI W;  1YVW A;  3CXC U;  3LSQ A;  4JAV A;  1B06 A;  1M93 A;  2IM9 A;  2ZE8 A;  3ETG A;  5B5E Z;  4GLX A;  1S3J A;  3O9O A;  3F5W C;  4MVO A;  1EN5 A;  1JPX A;  1K97 A;  3OR7 C;  2EIN B;  1QR9 A;  3LNN A;  3CS5 A;  1H2K A;  1M4U A;  1SES A;  4DR2 O;  4CS3 A;  4OX9 B;  5LMN B;  5LYJ B;  1KUQ A;  5EZY B;  4YHH B;  2E74 B;  3UQ8 A;  4DV0 B;  3S3X A;  4LF6 B;  2DQ3 A;  2ZNI A;  4JI2 B;  4B3R B;  4IIJ A;  3B8N A;  1TVK B;  1NR1 A;  1ENV A;  2FYU H;  2R72 A;  1Q8I A;  2LGQ A;  3ABT A;  3JSL A;  2PI4 A;  1Q81 W;  1IXM A;  3SYQ A;  4UCT A;  4DK0 A;  4HYO A;  3A0R A;  4OXS A;  3ZRV A;  2QM4 A;  4MW3 A;  3D36 A;  1VQM V;  3G4S V;  4JAU A;  4OGQ B;  3AG1 B;  3AG4 B;  4X65 B;  2P5O A;  3I56 V;  4X1Y A;  1Z5V A;  2HJD A;  1WP7 A;  3UT5 A;  3SPH A;  3B40 A;  4BWA A;  4XDK A;  5K1X A;  2KQX A;  4FFB B;  4FMT A;  4H33 A;  4DV7 O;  3QNE A;  4JI0 O;  3JAK A;  3FYI B;  5KMG B;  2EIL C;  5KHG A;  2YC0 A;  1Y4M A;  1QVG U;  3AG2 C;  3OTO O;  3EFF K;  4E2L A;  3AK2 A;  1XNQ O;  1N32 O;  1XQ8 A;  3ZN0 A;  3N2G B;  2ETN A;  1ZWI C;  3JYC A;  2EIN C;  1W0K G;  4X1K B;  4I55 B;  1WNS A;  1Q82 W;  3QO5 A;  2LFR A;  2UXB B;  4LF7 B;  2FTK A;  1NQT A;  1PNM A;  3J80 N;  3CRC A;  4JZ2 A;  4O2A B;  4DV3 B;  2QEX V;  1GM9 A;  4JYY A;  3JAT B;  3J81 N;  2V4D A;  2PZS A;  3ZMS A;  3EXA A;  1YXB A;  3E83 A;  3THO A;  4JI8 B;  4FIP C;  1NS1 A;  2XTA A;  5L3D A;  4DV6 O;  2X6C A;  2ZE6 A;  3AG1 C;  1ZLZ A;  3LNM B;  1CPY A;  5KX5 B;  5GON B;  3U0Z A;  1H2M A;  1VF6 C;  2W6I G;  2KB1 A;  2A3Q A;  3ABK B;  1GK9 A;  5LYJ A;  2BTQ B;  5EZY A;  3BVO A;  1NT2 B;  2P22 C;  4DUZ O;  1K5Q A;  3RBZ A;  2ZM6 B;  4DR4 B;  3AK1 A;  1H5W A;  4CBC A;  4AQY O;  1K9M W;  1EN4 A;  4O4J A;  2ZD9 A;  1XHX A;  2V7Q G;  3K08 A;  3RVY A;  3BAB A;  2LJ2 A;  1Y6X A;  3F7Y C;  3N2K B;  4OPH A;  2KSD A;  4FLT A;  3HKB A;  1L0N H;  1W2B U;  1M1K W;  1VEW A;  1LUV A;  5LA6 B;  5KHI A;  2Q5Z A;  3DGE A;  4FM0 A;  1R73 A;  1YCI A;  4JI5 B;  2UUB B;  4J9Y B;  1ZL8 B;  3SPG A;  1J5E B;  2LQT A;  3VOU A;  3BFR A;  2RJZ A;  4FFB A;  1P7B A;  1PL0 A;  3G71 V;  2PUS A;  4QNH B;  3CYO A;  5LXT A;  1B04 A;  2Q0O C;  4GX0 A;  3SYO A;  2GHY A;  3ZBH A;  1X59 A;  4LFC B;  4UVA A;  5CMU A;  3AK3 A;  2FML A;  3KCY A;  3C3S A;  1AI4 A;  1S5L Z;  3IC7 A;  2ATK C;  3QF7 A;  5CBH A;  1O9H A;  3N2G A;  4DR7 B;  5AG2 A;  2XAF A;  4I5S A;  4I0X B;  4X1K A;  4I55 A;  2XAQ A;  3L72 H;  4FZ0 A;  3APQ A;  5LGT A;  2AHY A;  3HKD B;  1GO3 F;  2QWQ B;  4LH7 A;  1IBL B;  5B1A B;  2ZXW B;  3ZRX A;  4WFH A;  1U97 A;  2F1M A;  3VQX A;  4QIW F;  1SQP H;  1DF4 A;  1E1R G;  1SZX A;  3A2F A;  1SQF A;  3ABM C;  2AGA A;  3W7T A;  1GM7 A;  4LF4 B;  4I9Q A;  4WFG A;  4H13 B;  4MT8 A;  1I08 A;  1HR0 B;  3DC5 A;  3OGC C;  5CA0 A;  2UUC B;  1SS3 A;  1RM1 B;  4DYL A;  2WLL A;  1Q86 W;  1VP7 A;  5JQG B;  5KX5 A;  2RNB A;  2RMK B;  5LOV B;  2QGN A;  5GON A;  2FKX A;  2HKO A;  3QG5 A;  2A9H A;  2XAS A;  2BTQ A;  2WSS G;  4X64 B;  3ABU A;  3JD0 A;  3IAY A;  4K35 A;  2KKW A;  1EFR G;  5EK0 A;  1RFY A;  3RYC B;  5LP6 B;  1GAX A;  1OCC C;  3RYH B;  3K04 A;  2QR4 A;  2QSA A;  2P90 A;  3T4D A;  1VQ7 V;  1BT8 A;  4DO2 A;  2B9Z A;  5LA6 A;  3GWO A;  4DUY B;  2RN9 A;  3FAV B;  1YJ9 V;  1YIT V;  1H38 A;  1ZL8 A;  3EVK A;  3E89 A;  4JYA O;  3ZS8 C;  4LF5 B;  3LSU A;  3FYE B;  5C8Y B;  2GV9 A;  3SJQ C;  4TV8 B;  4PDV A;  3ETD A;  2DMX A;  2NN4 A;  5DN6 G;  4RWU A;  3MHS C;  1Y67 A;  3HKC A;  4NXM B;  4X1I B;  3BA9 A;  2EJ7 A;  5L3E A;  1F7Y A;  1XNR O;  4ZHQ B;  3JD2 A;  2OYQ A;  4MVQ A;  1NBM G;  3LDD A;  1FKA O;  4BR6 A;  1QCE A;  3FB5 C;  2YEV B;  1RM1 C;  2DWD C;  2ZE7 A;  5CA1 A;  4JI3 O;  1IBL O;  4I0X A;  1H2G A;  3LSS A;  4ABM A;  3STL C;  3N27 A;  4QJF B;  1XL6 A;  3HKD A;  3H1J H;  1HNZ O;  1Q5O A;  4JAS A;  4YIP A;  1MOF A;  1AR5 A;  2WLH A;  1UFI A;  2IU3 A;  1P4R A;  4ZIB A;  3DXR B;  3RW0 A;  5DM6 V;  1HR0 O;  1AI7 A;  2FB5 A;  4HAM A;  3ZIA G;  5LP6 C;  1XMQ O;  2H3O A;  3OD4 A;  5H2F Z;  1IZ3 A;  3KZI Z;  4LH6 A;  1J95 A;  3AG7 A;  1ZAU A;  5EC2 C;  2JVD A;  1VQ9 V;  2JS5 A;  4DR1 O;  4KUM A;  4CS4 A;  3H1I H;  4IYH A;  5JQG A;  4G2K A;  4A5U B;  5LOV A;  1MZF A;  2JEX A;  3GVM A;  4DR2 B;  2YXL A;  2CE4 A;  4UXN A;  3SYC A;  3L75 H;  4DR5 O;  3K0G A;  4MW8 A;  2FL4 A;  2ITC C;  2E75 B;  2EIJ B;  2BCC H;  1OCR C;  3OGI B;  3TK1 A;  2YIB D;  3W7U A;  4WFF A;  3CRM A;  2HG5 C;  4ICG A;  4JTD B;  2DYS C;  1AB3 A;  1E1Q G;  4LWS B;  1BHA A;  1SF9 A;  5LHG A;  2R70 A;  4UVB A;  1S72 V;  4NTY A;  4JI6 O;  3RYC A;  4D7T A;  5EC1 C;  1I94 B;  3T1H O;  4L87 A;  2ZDI A;  3FX7 A;  5FPO A;  5JJJ B;  2HVJ C;  3RYH A;  1Q7Y W;  1FXH A;  4FLY A;  1NH2 B;  2H94 A;  1Z5W A;  1V54 B;  4GKK O;  4DW0 A;  2UUA O;  1DLB A;  4UVC A;  3IJ4 A;  2JJ2 G;  5LGN A;  4X62 O;  2L6L A;  4LF8 O;  2NLJ C;  5EIB D;  2VRZ A;  3E35 A;  2XUM A;  4U7N A;  3CP1 A;  2DOS A;  2YI8 A;  4TOI A;  3K5O A;  3KCX A;  5CBG A;  5KHH A;  3ASN C;  5C8Y A;  2OCH A;  1AP5 A;  3OMI B;  3B09 A;  2BTO A;  3JSN A;  4DV7 B;  2WLI A;  4JI0 B;  3K3W A;  1YHQ V;  4FFK A;  1WB8 A;  2UXC B;  4HZ3 A;  4CC6 A;  1SKV A;  4X1I A;  2CTQ A;  1MA1 A;  3OTO B;  3UKM A;  5JJE B;  2E3C A;  2DQ0 A;  4PA7 A;  3VQW A;  1XNQ B;  1N32 B;  2ZE5 A;  2Q67 A;  1ZX3 A;  1K7D A;  2YEV A;  3Q4H B;  4U7O A;  2Q7H A;  4LNU A;  1Q90 D;  5EBL C;  5J2U A;  4KHP O;  1XEQ A;  1EZJ A;  1BHB A;  2Z0A A;  1BQ0 A;  3T1C A;  1K8A W;  3M7M X;  4MTX A;  5FL7 G;  2C2A A;  3FB7 C;  3UO3 A;  2WLK A;  3AG2 B;  3R65 A;  4O4L B;  2E76 B;  4GZR B;  3WG7 B;  4FLW A;  4FLV A;  5H9C A;  4RO2 A;  3DXR A;  2IW5 A;  4IGG A;  2F95 B;  2PYL A;  3CX5 F;  2CH7 B;  3CRR A;  1WLE A;  2EZP A;  4FPP A;  4DV6 B;  2XAH A;  1V54 C;  1R6T A;  1IDS A;  4D6T H;  4PHZ A;  3E86 A;  4DK1 A;  4B3M O;  5GTI Z;  3LDE A;  3GWK C;  1V55 C;  2F93 B;  1KB9 F;  4JF3 A;  3SPC A;  1EBO A;  2HFE C;  2XAJ A;  4B7K A;  1FPO A;  1F51 A;  2XAG A;  3ZHU A;  1I94 O;  3NR7 A;  3K9S A;  2IJK A;  4CC5 A;  4DUZ B;  2AHZ A;  3ETQ A;  3KG2 A;  3E22 B;  1GKF A;  3CEI A;  3ZHV A;  4GX5 A;  3CCQ V;  4AQY B;  4J41 A;  3WFV A;  3E8G A;  4X66 O;  5J9P C;  4HBN A;  5IYZ B;  4R6Z A;  5BMV A;  3CSX A;  3CCE V;  3CRA A;  5KUK A;  3SYA A;  2PTM A;  4EFB A;  4JPR A;  1AIL A;  2DW4 A;  3ASO B;  1N4C A;  1L8D A;  1GN4 A;  1R3J C;  1FJG O;  2UXC O;  2JGD A;  2F66 C;  2G38 A;  2IH3 C;  3K5M A;  3WG7 C;  2QKS A;  4AHC A;  1SZT A;  1AR4 A;  2YDE A;  1F4M A;  1WP8 A;  3CRQ A;  1PNK A;  4UCU A;  2KG7 B;  4I4T B;  4X8A A;  3ZCC A;  2F4V O;  5JVD A;  2Z5U A;  1Q3E A;  2GBO A;  5IJ9 B;  1TUE B;  3NXS A;  3IC9 A;  2ADP A;  1BCC H;  1HWY A;  3T1Y O;  2LO1 A;  3HPL C;  2EZO A;  1WA8 B;  2ZCE A;  1AI6 A;  5KA6 A;  1KQS U;  3B77 A;  3CC7 V;  1D2D A;  3CHX A;  3TGU H;  2EIK C;  2ADQ B;  1GN3 A;  1K4C C;  4U3J A;  1GM8 A;  3E8H A;  3FD9 A;  5JCO C;  3RN4 A;  4NB5 A;  4BIZ A;  5C93 A;  4LC1 A;  4NVP A;  4WFB V;  2O57 A;  4RQE A;  3E2E A;  1R6K A;  2H8P C;  2WWW A;  1FYJ A;  1IJG A;  4JV5 O;  3P3P A;  4JI1 O;  3DC6 A;  1BSM A;  1YTF D;  2JDI G;  3ZX6 A;  2QTS A;  4P2Z A;  1YEW A;  1YJW V;  3C90 A;  3BAA A;  4BW5 A;  1Q6U A;  5BR8 B;  4BAY A;  4FLU A;  1R3K C;  4Q6G A;  1BMF G;  3ASO C;  4AI8 A;  4JTA B;  2OIG A;  4GUN A;  4PDM A;  3H01 A;  1QHT A;  2ILM A;  3EHB B;  4ZBM A;  3L74 H;  3WB0 A;  1TVK A;  2VWK A;  1KKC A;  3HB3 B;  4Z2W A;  3ABM B;  4XBF A;  3LDC A;  1XMO O;  4QPK A;  4KL1 A;  3JAW B;  4YY3 O;  5FNV B;  2JIZ G;  1BL8 A;  2ZIM A;  1XOU A;  5IYZ A;  2WA3 A;  1SQQ H;  1CEZ A;  3JCU Z;  3UCS C;  2P4V A;  5FPR A;  4DV4 O;  3OUF A;  1VF6 A;  1ZUQ A;  2W0X A;  4LFA O;  3OMA B;  2XHB A;  4YJ2 B;  3OE7 G;  5E79 Z;  5BXZ A;  5KMG A;  4DR6 B;  4PI2 A;  4JYA B;  4BIO A;  1TUB B;  1SQB H;  4DW1 A;  1S0V A;  1QU7 A;  1JQ0 A;  1OCC B;  3LUT B;  4Z1M G;  3WB1 A;  3CME V;  1H8H G;  1FXK C;  5KUM A;  4FVM A;  3HKE B;  1EZV H;  2Y69 C;  5ITZ B;  2OCC C;  1XI1 A;  1XNR B;  5IJ9 A;  5EYP B;  1XDC A;  1OZ0 A;  4QE9 A;  1OJH A;  1N34 O;  4RUE A;  5LHI A;  4JI3 B;  3JCZ A;  4K8X A;  1R6N A;  1WA8 A;  4JI7 O;  4O2A A;  4Z1V A;  5GW7 A;  1PPJ H;  1B6Q A;  1YF2 A;  3JAT A;  2B1I A;  5LBQ A;  1NKD A;  3ZMZ A;  1HNZ B;  1N33 O;  4CH4 A;  1ZTE A;  1SER A;  2UXN A;  4I7Z B;  5EIB C;  3D8C A;  3OM3 B;  3MDS A;  1FFX B;  2CGO A;  5BR8 O;  4ZI7 B;  4PI0 A;  2Q7E A;  1XMQ B;  2YIC A;  3BEH A;  3IGA C;  4L8J A;  2CTR A;  2HEP A;  3G6B A;  5KAI Z;  4NR1 A;  3TET A;  2K9P A;  4LF9 O;  4DR1 B;  1K5S A;  2WPD G;  3WU2 Z;  1K92 A;  3CCS V;  3RWR D;  4NTW A;  3DTU B;  1HNX O;  2A06 H;  1NTZ H;  1G6U A;  2JRI A;  4DR5 B;  1WB7 A;  2B1G A;  2BOC C;  2JEU A;  4F6E A;  1MSD A;  4DRX B;  4W4K A;  1BZK A;  1N36 B;  3N2K A;  2QE7 G;  4J42 A;  4R50 A;  1VQP V;  4R8C A;  4JGS A;  3T2M A;  4JI6 B;  5FNV A;  1YSC A;  1JJ2 U;  4NYK A;  3T1H B;  4TQF A;  5HFL A;  4LCU C;  4DR6 O;  3OEE G;  1IUR A;  4GKK B;  1JMK C;  4B3S O;  1GMG A;  4FZ1 A;  3K5N A;  2UUA B;  1NTK H;  2ODM A;  1WPX A;  1H2S B;  3E8B A;  2CTP A;  5J2T B;  4JZG A;  4X62 B;  4ZOL B;  4LF8 B;  2UXD O;  1OCR B;  1PKX A;  4YJ2 A; 
#chains in the Genus database with same CATH homology
 1I08 A;  3DC5 A;  1AP5 A;  3TJT A;  1I0H A;  1N0N A;  2GDS A;  2P4K A;  5A9G A;  4FFK A;  4YIP A;  1P7G A;  1XUQ A;  1WB8 A;  3AK2 A;  2AW9 A;  4GUN A;  1VEW A;  1AR5 A;  1LUV A;  1MA1 A;  2QKC A;  1ZTE A;  3MDS A;  1JA8 A;  1KKC A;  1MMM A;  1GN4 A;  1XRE A;  3KDR A;  1B06 A;  3BFR A;  1LUW A;  1EN5 A;  1AP6 A;  1GN6 A;  3OT7 A;  2CDY A;  1AR4 A;  2RCV A;  4JZ2 A;  1BT8 A;  3AK3 A;  2QKA A;  4JYY A;  3C3S A;  2CE4 A;  4X9Q A;  1PL4 A;  3KKY A;  1N0J A;  1D5N A;  1PM9 A;  1ZUQ A;  5AG2 A;  3EVK A;  1WB7 A;  3IC9 A;  2ADP A;  4F6E A;  1QNM A;  3LSU A;  1VAR A;  1MSD A;  1ZLZ A;  1AVM A;  1GN2 A;  1JR9 A;  3QVN A;  1IDS A;  1EM1 A;  4C7U A;  1BS3 A;  1Y67 A;  1IXB A;  2ADQ B;  1GN3 A;  1EN6 A;  3RN4 A;  1MNG A;  4YIO A;  4BR6 A;  1SZX A;  1ZSP A;  1IX9 A;  3AK1 A;  3K9S A;  1EN4 A;  4JZG A;  1XIL A;  1XDC A;  4E4E A;  3DC6 A;  1BSM A;  3C3T A;  3CEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...