2ADQB

Human manganese superoxide dismutase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
publication title Crystal structure of nitrated human manganese superoxide dismutase: mechanism of inactivation.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 196
sequence length 196
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
B PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2adqB01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2adqB02
1Y67A 1AP6A 1D5NA 1I0HA 4F6EA 1GN6A 2P4KA 3C3TA 4BR6A 2CE4A 1XREA 1GN2A 4YIPA 1JA8A 2GDSA 3AK3A 3AK2A 1JR9A 3AK1A 3KKYA 1IX9A 1AR5A 1P7GA 1I08A 1BT8A 4GUNA 4JYYA 1N0JA 1AVMA 1AP5A 1IXBA 3RN4A 4X9QA 1PM9A 4JZ2A 1ZTEA 1IDSA 3DC5A 1PL4A 1EN6A 1AR4A 2QKCA 1MA1A 3OT7A 1MMMA 1BSMA 1MSDA 3IC9A 1LUVA 2RCVA 1XUQA 1VEWA 3C3SA 1SZXA 4E4EA 1ZSPA 1LUWA 2ADPA 1ZLZA 3MDSA 1EN4A 1GN4A 1VARA 4YIOA 1EM1A 3LSUA 2QKAA 1BS3A 3DC6A 1B06A 3K9SA 1WB7A 4C7UA 5AG2A 1QNMA 4JZGA 1EN5A 1KKCA 1GN3A 1ZUQA 1MNGA 4FFKA 1XDCA 5A9GA 2CDYA 3QVNA 1N0NA 3BFRA 1XILA 3EVKA 2ADQB 1WB8A 3TJTA 2AW9A 3CEIA
chains in the Genus database with same CATH superfamily
4B3RB 4B3TB 3ZIAG 1OCZB 4MVRA 5L3CA 3ABKB 1OCCC 1GH6A 4N23A 1YIJV 4J42A 1T5EA 4JI2O 4UVAA 4BW9A 4B3SO 5J2TB 1SQBH 4LF9O 3B8NA 1SQXH 3TETA 2Y48A 4I9WA 4JPRA 1M1KW 1P7GA 2WAMA 4MVMA 5KAIZ 3LNNA 1YJNV 2FB5A 3T1YB 1NTZH 5E79Z 3E8FA 3WU2Z 3W7XA 1AP5A 1AVMA 3DXRA 1FJGO 5C93A 1RM1B 1XNRB 2HJDA 2WLMA 1QR8A 1EN6A 2XAFA 2EINC 5LL6Y 5JH7A 1VQLV 2C2AA 3JD4A 3X2QB 4FLWA 1N33B 4YHHO 1V54C 4JGSA 4JI3B 3A8TA 2CK3G 4LF7B 2Y69B 2JEUA 1IBLB 1OJHA 2UXXA 4X8AA 3K0DA 1WP8A 4J9YB 2YIAA 4DV1B 1FXHA 1YITV 1N36B 4HNAB 3H1IH 3CMAV 1U96A 1I94B 4YJ3B 2LGWA 2F23A 2IJHA 3K5LA 2B1IA 2XUMA 2W6JG 1NTKH 1L1FA 4DUYO 4I0XB 5AG2A 4AI8A 3ABMB 1GKFA 4QPKA 3TXSA 4MTOA 1SRYA 4FMTA 3L75H 2WLLA 1G8MA 5IY5C 2IJKA 2XASA 1AILA 2WLIA 1YTFB 2HVJC 1XNQB 1XILA 4FZ1A 3ZN0A 1Z5WA 4X1KA 4DR5O 1VQ9V 4O4IA 2FKXA 1PPJH 3K08A 1VQ6V 3JARB 3FFQA 3HKEB 3RYIA 3OD4A 4NXMB 1KYOF 2IJJA 2PF4E 4JYCA 4NTYA 1H2KA 4NTXA 3HB3B 2DQ3A 2H8PC 1NVPB 2HLDG 5EZYA 1SC5B 1NZ6A 2HG5C 4J7JA 2VQFB 5B1BB 5IJ9B 3ABTA 1IDSA 4J7KA 3HKDB 5IDJA 3CPWU 1AI4A 3CCQV 4Z1VA 5LMNB 4JI4O 3P32A 3K04A 3A0BZ 1VF7A 1V55C 4RAIA 3PJSK 1GK9A 3R65A 2QEXV 3OM3B 2R9RB 2F43G 4DR7O 4PELA 5H6QA 4JI5O 2KKWA 2YUAA 3OFNG 2PTMA 4GX2A 4ZBMA 5EYPA 4EFEA 4Z2WA 2EIJB 1P4RA 4H0LB 3STZC 4PV1B 3H1JH 1KQSU 1KKCA 3BEHA 4QGPA 3H1HH 3O9OA 5HFMA 5BMVB 4KFMA 2CH7A 1H8EG 1B3QA 1AI7A 3OEHG 4EEQA 4JYBA 5H2FZ 4FLXA 2AW9A 4MVSA 1JCHA 3CRAA 4X64B 3LDEA 1MSWD 2MK3A 5JJEB 2W6IG 3ZRXA 4Q6GA 1JOYA 3MHHC 4U7NA 3UT5A 2WLHA 1K3EA 2FMLA 1M57B 3JATB 4X1IA 1JA8A 4MW8A 1HNZB 2Q73A 3AK2A 3BABA 3CRMA 1VMGA 5L3EA 5KHHA 3T4DA 4BIZA 4JI0O 4IHJB 1IXBA 2QWQB 4X89A 5LA6A 4G2KA 4WCEV 5KUKA 3SYQA 4JAAA 3CE2A 4LWSA 2UUBB 4ZKIA 1XHZA 3GVMA 1BSMA 1NTMH 3B4SA 3CRCA 2YXLA 1OCZC 3ABKC 1S5HC 4X62B 1K97A 2JJ1G 3ETEA 2UU9B 2HR3A 1Q7YW 1YXBA 3J7AU 4LF4O 2LQTA 3JASB 4O2BA 3DC6A 4A5UB 4QJFB 4RQEA 3FYEB 4J9ZB 4MVQA 1TA8A 3ZEDA 4UV9A 3RW0A 2E5LB 1BQ0A 1RM1C 5C8YA 5L3DA 2V4DA 4NTWA 4NXNO 2QKSA 4ABMA 1XOUA 1IBKO 3BVOA 3ML0A 1N34O 3CHXA 3ZHTA 1QVFU 3G80A 2ZIOA 3X2QC 5B5EZ 3HKCA 2E74B 3CCSV 2JVDA 4YY3O 1R6KA 5GTHZ 1XMOB 2Y69C 1Y74B 4FLZA 3CB2A 2IM9A 1Y67A 3A2FA 5H6RA 4MTXA 1RP3B 3JD3A 1HNXB 2HP8A 1N4CA 3P3NA 5CBGA 4IIJB 3OGIB 3K57A 1RFYA 1R73A 2GSMB 2XAQA 4DO2A 1JR9A 1FJGB 3KKYA 1IX9A 3JALB 3SJCC 2WA4A 2DJVA 3ETGA 3ABMC 3RYIB 4F4LA 1BT8A 3JCZA 5A2QN 3F7YC 5J2TA 4K0KB 4PD4F 3VQXA 1V9PA 2QM7A 3L9DA 1KB9F 3RN4A 1URFA 1YTFD 4YHHB 3UQ8A 1AR4A 3APQA 4DV3O 5CB4B 2H3OA 4I50B 1MMMA 3LDDA 1IZ3A 3W7WA 2XAJA 1D2DA 2EBOA 4O4JB 3K0GA 4PA9A 1MG1A 1XL4A 5IYCO 3ZHSA 4DR1O 2Q4PA 3BHPA 4OGQB 1HNWB 3RYCB 2RJZA 4RUEA 4QE9A 2Q7GA 3UKMA 3MDSA 5GONB 4MW3A 2NN4A 4YIOA 1D5AA 2Y4TA 3OAAG 1NVPD 3D36A 4QIWF 4BW5A 1VQMV 1PKXA 1W0JG 1YHQV 4FLTA 4I7ZB 3L70H 2Q67A 1ZL8A 4YJ3A 5B1BC 3KCYA 4LF6B 1WA8B 3SJQC 1DF4A 4ZHQB 5IE9A 1H2SB 3ABUA 4CC5A 1SS3A 4ZOLA 1FFTB 2XAHA 5JCOA 2LP7A 1AI6A 3AG4B 3E89A 1XL6A 2UXNA 1WJZA 4CS3A 3CEIA 4JI6B 2YIBD 4B08A 1YDXA 3OUSA 1WNSA 2JIZG 3FYIB 2YXHA 2WLKA 4LFAB 4FM2A 1JJ2U 1H5WA 2QGNA 1U97A 4LFBB 4LNUB 3RGBA 5IJ0A 1GM8A 4DV0O 3UT5B 2EIJC 4X1IB 1HR0B 2OTLV 3IAYA 2P6JA 3M8AA 1XHXA 3AG7A 1K5QA 2UUCO 1GO3F 4OPHA 4XDJA 5L3GA 1R6TA 2G38A 2OIGA 1S77D 2F4VB 2ZE8A 5DM6V 1JJOA 2WA3A 3K5OA 3ZHRA 1FS0G 4DR7B 2JRIA 4JI5B 4P9OA 5EC1C 5KHJA 2JJ2G 4X20A 2RCVA 4O2AA 1OZ0A 2Z0AA 1K7DA 4PHZA 3ZCCA 2DYSB 3D3QA 4LH7A 4LWSB 4UCOA 1M57C 1LUWA 2K9PA 5IWAB 1ZLZA 2P4VA 3E35A 1SZTA 1GAXA 3ZS8C 2YIBA 5B1AB 4JI1B 4AQYB 3NR7A 4JV5B 4I5SA 1WB7A 4X65O 4JZGA 3L72H 2QDOA 4GKJO 5LMUO 3OMIB 3SYOA 5A9GA 4WFBV 2CDYA 1CPYA 1VQKV 3ZMZA 3CC7V 4BIUA 4H44B 5ITZA 1WB8A 2B9ZA 4CS4A 2FYUH 4DV5O 4DR6B 4PDLA 5KA5A 5KLVH 1D5NA 5L3FA 3S3WA 2AXTZ 3HKCB 3OTOO 5E1AC 4IT5A 1HDJA 3OR6C 2CE4A 1SETA 1NQTA 1WAZA 3OMNB 4MVZA 1K34A 1Q3EA 4TT3G 1S0VA 3B09A 4GZRB 2EJ7A 1AROP 2ITDC 1EZVH 1FYJA 2LW7A 5HFLA 1GM7A 3JATA 2P90A 1YI2V 1KBHA 3H01A 1L0LH 4UVBA 4DV6O 3K59A 3NXSA 2PI4A 4FZ0A 2K1EA 4KHPO 4FVMA 2L35A 2VRZA 4IHJA 3OMAB 1H2MA 3N27A 3D3IA 1MSDA 5BY1A 1NBMG 2AZ2A 1XUQA 4X1YA 1A32A 4LFCB 2RMKB 2DOSA 3ASOB 4TWKA 1X59A 3CCMV 1K92A 2CGNA 4YJ2B 2VWJA 1US6A 1QU7A 3K9AA 1KD1W 1PD3A 4DV2O 2QKAA 4CBCA 5D5QA 2Q5ZA 3B8MA 3FKSG 4JTDB 1E79G 3RYFB 2ZD9A 3FAVB 4OPAA 2Q6AA 1YCIA 4GT1A 3ZMVA 3B2EE 3E8BA 1W2BU 4YY3B 3JASA 4FFKA 2UXBB 3QVNA 3U11A 1P84F 1ZL8B 3U10A 3IFXA 3TGUH 3W7UA 1NH2B 2AZ0A 2RN9A 4MTFA 2XTAA 5DEDA 1VQ4V 1Q5OA 3L71H 3ETQA 1JPXA 4ZOLB 2E3CA 3QO8A 3ZN1A 2BTQA 3W7SA 4B3MB 3K79A 3SJAC 1Y74A 3P3PA 4L87A 1QHTA 4E2LA 4B7EA 1M93A 1EFRG 4IIJA 1I08A 1WPBA 3K5MA 3DGEA 4FM0A 1EZJA 1S3JA 2A9HA 4JYYA 1I7FA 2Q68A 5IJ0B 2ZE7A 2CGOA 5LHHA 4X66O 3H1LH 2GUZA 3JALA 2GV9A 2UUAO 3AG4C 4L8JA 3ETDA 3CXHF 4DR1B 3N2KB 2OCCB 3CRRA 2P7TC 3W7TA 1LUVA 2QWNB 4R7CA 3HKBA 3EXAA 3G4SV 1VEWA 3H1KH 5CB4A 1MZEA 4GKKO 4I50A 3DSQA 2E76B 2CTPA 1CP9A 2Z5UA 2ADPA 3OGCC 4DV7B 4X20B 2CAZC 4O2AB 3ZRVA 3L73H 2RNBA 4O4JA 3JAWB 4ZIBA 3CCEV 3RYCA 1VIBA 4K3AA 5GONA 2ARHA 1VQ8V 3TK1A 1UPGA 3ASNB 3TXQA 4DUZB 2HHHO 4IGGA 4BAYA 3SYPA 2IJIA 2VQEO 5K1PA 5KHIA 3TJTA 1WA8A 2ZINA 5B3SB 4ZHQA 4UVCA 4LH6A 2DYSC 3P30A 2PYLA 3JSLA 4DV0B 5ITZB 5KUMA 1BGYH 4BR6A 2HJFC 2ZDIC 4H37A 2ILMA 4DK0A 3VQYA 5B1AC 2VWKA 4DR2O 1UJWB 3VBBA 1L0NH 4UFZA 2Q7HA 2CUGA 4JI7B 4LNUA 1M56B 3THOA 1H38A 5B1NA 1PL4A 2A79B 2X7RB 3RT3C 2PI5A 1KP3A 4O4HB 1QLNA 5KA6A 3E8HA 4KL1A 1YEWA 2QE7G 4QE7A 2YSUB 1CXZB 3BA8A 3SPJA 1DK1A 4JF3A 3UO3A 3E2EA 2EIKB 1N32O 4EKWA 2QR4A 5FNVB 1UFIA 1XQ8A 2HVKC 2XT9A 5L3BA 3K03A 4X1YB 1B04A 1O9GA 1Q43A 2GBOA 4MT8A 4PI2A 4MSWC 4DV4O 5EBWC 3KZIZ 4DR4B 2W0FC 1PNKA 1THZA 3L74H 2ZDIA 3JD2A 4JAVA 3JD1A 5H5NA 1BMFG 4TV8B 4UXNA 3K3WA 4LF8B 2N04A 4B3RO 4B3TO 1YVWA 1J5EO 4BIOA 2ZQMA 3OTOB 1IBMB 2UXDB 1M9NA 2JGDB 1FAFA 3T1HB 1G6UA 2Q7EA 3AG3B 3ASOC 4FIPC 2PUSA 4DRXB 2JEXA 4RWUA 4U3JB 1GN6A 4FJCC 3GWKC 3IGAC 4KP4A 5EC2C 4UB6Z 3ZMTA 2A3QA 2BE3A 3T1YO 3WB0A 1P7BA 4D7TA 5LBQA 2BTQB 1AR5A 5LYJB 3A0RA 2WLJA 4JI2B 1K5SA 1ZX3A 3FX7A 4B3SB 1PP9H 1BL8A 3ZBHA 3D36C 5JVDB 4LF9B 3KDRA 1Y6XA 2Y0IA 3CS5A 1VQNV 4ICGA 1N33O 5LP6A 2EX3A 1VF5B 1NH2D 2WWWA 1Q6HA 1Q8IA 4LF7O 4UCVA 5CBHA 3OT7A 3RBZA 1SA0B 5JQGA 3CCVV 4DV1O 1N36O 2GUZB 4I9QA 2ZR3A 1AJNA 4W4KA 3A0HZ 1AJQA 4TOIA 3JAMN 1I94O 5JCOC 1NR1A 4J41A 3CWBH 4J10A 1HP8A 2BOBC 3ZRSA 1KECA 1ZSPA 3QTCA 1R3KC 2NNUA 3MD0A 3HKBB 4LC1A 3ZRWA 2WSSG 4HAMA 1FXVA 1EM1A 1VQ5V 1B06A 5K1XA 2BCCH 1IXMA 4YJ2A 2QWRB 4R6ZA 1XNQO 1L8DA 4UV8A 2YEVB 2YXYA 4FFBA 1DGSA 4PA3A 5JWPA 5BR8O 2BSKB 1LR1A 4WFGA 3RYFA 4DUYB 4QPJA 3FAVA 2OCCC 1YJ9V 5LXTB 3LSSA 1S72V 1GTOA 3RVZA 4NXMO 5FLXN 4PDRA 2UXCO 2JS3A 2ZKOA 4JTAB 5EBMC 4CC6A 3SPCA 3MAQA 1Y66A 1YF2A 2ZE5A 4DR5B 4DW0A 4UB8Z 1FXKB 2XHBA 1PV0A 4X66B 4G27B 2VQFO 2A06H 2KB1A 1S76D 4K35A 4MS2A 2KSDA 3K06A 4GUNA 3PN1A 2UUAB 2WLNA 3ASNC 1N0JA 3KCXA 5LMNO 3BRCA 1J95A 2DN9A 4I4TB 5CBFA 1PM9A 2BTOA 1Z5VA 3OW2U 3DC5A 5CA0B 4P2ZA 2QWPB 1MA1A 2EILB 2ZT9B 2MW2B 5B3SC 4YXWG 2AHZA 2OYQA 1NKDA 3EFFK 1QLEB 3R66A 4JI4B 3N2KA 3LUTB 4XBFA 4J80A 4CH3A 3QO7A 3VQWA 2P06A 1F7YA 3LSUA 1BS3A 1KMIZ 5BXZA 5KMGB 2QTSA 2B5UA 4WBNB 2Y4UA 3FB8C 1QNMA 1M56C 4LCUC 4ZI7A 2EZPA 3JAWA 5BZBA 2JS5A 1SERA 3SPHA 2YICA 2YDEA 2PZSA 1ZAUA 1S5JA 2ZXWB 4NR1A 5B66Z 1Y4MA 3J81N 1I5XA 1RPOA 2M6YA 3F7VC 4RQFA 1M5IA 5EBLC 5LHIA 1K73W 3TCUA 1HNZO 1XI1A 2EIKC 1NU1H 2DMXA 2GTSA 1I0HA 4FK5C 3CC4V 2OIEA 4J11A 1IJGA 3LNMB 5CMUA 4JAUA 4PA6A 3ZHVA 4GX0A 1QCEA 1M90W 1O9HA 3ZHUA 3S3XA 1MABG 4PI0A 1Y76A 4PA7A 1TUBB 1H2LA 1SQFA 1KU9A 4KXRA 3SJBC 2FTKA 4R8CA 3RYHB 1WP7A 1XMQO 3AG2B 2UUBO 1DTOA 4TUYB 3ZJZA 1IVSA 3FD9A 1BQZA 4JI0B 3AEIA 4H13B 4U7OA 3AG3C 1SQVH 5LP6B 3OE7G 3IC9A 2UU9O 2DW4A 3F5WC 4O4HA 2HFEC 4HYOA 1FPOA 3CJHB 2N74A 5JQGB 2GHYA 3WG7B 4DV4B 1R3LC 1EN4A 4OX9O 4B7KA 2IW5A 5JJJB 1AB3A 4GX1A 2E5LO 3RVYA 3ZMUA 1YJWV 4Q20A 5FNVA 1OV9A 2LO1A 1J5EB 3ZRWB 2Q0AA 4LF4B 1MNGA 2XNDG 3CD6V 3K5NA 1XMOO 1TGOA 4CS2A 2ZCEA 2YS8A 1HNXO 2ADQB 5CA1B 1RSOA 4FFBB 2YIDA 4NXNB 3BAAA 4TV8A 4F6RA 1IBKB 2B1GA 1N34B 1QQCA 3CRQA 3LSQA 1ENVA 2QM8A 3SYAA 4F6EA 5D5PA 3UM7A 3BA9A 2JGDA 1K4CC 1XREA 4HZ3A 1K33A 2O57A 1F4MA 1Q81W 4O4LA 2LGQA 2AHYA 4K0KO 2DWDC 4RO2A 4DRXA 3JSNA 2PYJA 1BZKA 4U3JA 3GB7C 3FB6C 1PL0A 1R3JC 4TV9B 4D7SA 1R6NA 1SKVA 3CYOA 2D3OW 1AI5A 2L6LA 1TVKB 2ETNA 5CN0A 5LYJA 4CZZA 1OHHG 1S5LZ 2GTAA 2QKCA 2KG7B 4UUJC 5JVDA 3ABLB 1HNWO 1FKAO 5FPOA 3OUFA 2ODMA 4DV3B 3C3SA 4MTGA 1JNBA 1FXKC 4E4EA 1SA0A 4LF5O 1DF5A 3QG5A 4IYHA 4GLXA 3I56V 4UCUA 5LGUA 4R50A 1VF6C 5KX5B 4LF6O 2P67A 3G71V 2CTQA 5BR8B 4H33A 3LDCA 4GCZA 2KQXA 2F95B 2W0XA 1Q82W 1GN3A 3E22B 1IURA 3UO2A 1YZBA 2ZNIA 4JI8O 2A7WA 4JI6O 2UXCB 1N0NA 2EILC 3MHSC 2OTJV 3BFRA 4ZI7B 2YEVA 4CH5A 1F4NA 1QLEC 4LFAO 2JDIG 1XEQA 2BSKA 5TISZ 1GMGA 4LFBO 2Q9LA 3U0ZA 2X6AA 1OCRB 2NLJC 5LXTA 4JYAO 1GN2A 1HR0O 4CH6A 2F1MA 1VP7A 4XDLA 3CC2V 4I55A 3N2GA 1K4DC 1WN7A 2F93B 2PY5A 1FXKA 4X88A 2PGGA 3VOUA 2F4VO 4ASUG 1NT2B 2VS0A 1JMKC 3CCJV 4FLVA 2X6BA 1VF6A 1GM9A 3E83A 1Y76B 4JASA 2H94A 2R9IA 5H9CA 2V7QG 2ZXWC 1TUEB 5DN6G 1QR9A 2UUCB 4UCRA 1XBLA 1M4UA 4I4TA 5IWAO 1F51A 2DE0X 4FPPA 3T2MA 3JYCA 5CA0A 5LGTA 4NB5A 1QBZA 1N8RW 3E86A 1OCOB 5F2VO 2BOCC 1SZXA 3DTUB 4JI1O 2M7WA 4EB6B 4AQYO 2NR5A 4P30A 3RFRA 1BE3H 4JV5O 3CCUV 4NYKA 3I5DA 5IT9N 2P5OA 5IYZB 2YI9A 4J7ZA 1YSCA 3AG2C 5LOVB 2EULA 2HEPA 1PNLA 2DYRB 1WPXA 5KMGA 4DR3O 1I5YA 1SESA 2OCHA 3GWOA 3QNEA 5B1OA 4WBNA 3CMEV 4DR6O 1W59A 4OXSA 4X65B 1NS1A 3JD0A 5LP6C 4GKJB 2ZM6O 5LMUB 4FM1A 2X0LA 3CCLV 4FLYA 3H9VA 3K58A 2A0LA 1FFXA 1AP6A 1Q6IA 4IL6Z 5JJNB 3WG7C 3C3TA 3B40A 1RSOB 3SPIA 2WPDG 4YIPA 3ICXA 4F6RB 4DV5B 3RWRD 4LP8A 2OWOA 3JCUZ 4CH4A 4WFHA 1XMQB 4MVOA 2ATKC 3AK3A 3DXRB 3BPZA 2QA4V 4WF9V 3BY6A 1PNMA 5J2UA 4N21A 1DLBA 3M99B 3VQVA 1CEZA 4O4LB 5JH7B 2R72A 1Q90D 3HR0A 3AG1B 1TUBA 2QM4A 2V1DA 3RYHA 5KHGA 4LFCO 4AILC 1NR7A 5EK0A 1K9MW 3CSXA 1JFFA 4BWAA 4DV6B 2QSAA 1XNRO 2EIMB 5IYBO 1SF9A 4TUYA 3WB1A 1KUQA 4OX9B 2P22C 5DECA 3Q4HA 1HW7A 2CTRA 4KHPB 3F5TA 4NVPA 3WFVA 4DK1A 5KHKA 3CX5F 5KAFZ 1OCCB 2ZR2A 3QO5A 4JTCB 2XAGA 4WFAV 4JI3O 1EBOA 3ZMSA 3SR2C 4DXWA 5LHGA 1IBLO 3CJHA 4QNHB 2IH3C 4PA4A 2WLLB 3KG2A 1NI8A 2UXBO 2WLIB 1EN5A 4DV2B 1ZUQA 2ZE6A 4X1KB 3JAKA 1XDCA 4HBNA 4DW1A 4O4IB 4EFBA 3T1CA 2EJRA 2Q69A 3M7MX 3ABLC 2IBZH 3QF7A 1ZWIC 2EINB 2ITCC 4W4LA 1JX9A 4B3MO 1AJPA 5EIBD 4NKGB 1ROPA 5EIBC 1P49A 3E8GA 1V54B 5J9PC 4Z1MG 2N05A 1F23A 2P4KA 1X4TA 5CA1A 4TQFA 1E1RG 4P9PA 2LFSA 1G1XB 5EZYB 2XOKG 1Q86W 3J80N 5GW7A 3AK1A 2AGAA 4LR3A 2Q0OC 5FL7G 1VQPV 4K8ZA 1NJIW 5IYDO 1VQOV 1HWYA 2OT5A 1FD9A 4GX5A 4U3FH 4I55B 3N2GB 1ZTEA 4TV9A 3C90A 2R9AA 2R70A 5IY5B 1GRJA 2IU0A 4LF5B 1TVKA 5GTIZ 3B77A 2X6CA 2IH1C 3G6BA 4DV7O 4HNAA 2EZOA 3APOA 2JGUA 1OCRC 2KG7A 3CXCU 1H8HG 1WLEA 5EYPB 2Z3YA 3STLC 5FPRA 2RDCA 2JK5C 4KUMA 4I0XA 1GN4A 1B6QA 2ZIMA 4GKKB 1KP2A 3OR7C 1KKDA 4JI8B 2Q8VA 3D8CA 4AHCA 4DUZO 4LBEC 4TSFG 2FL4A 2CH7B 3K9SA 4C7UA 4FLUA 4GYCB 3ZHQA 5KX5A 1JQ0A 2CTWA 2RQ6A 5LGNA 1BHBA 3IJ4A 3IC7A 1AR1B 1MZFA 3E22A 4TQDA 4JYAB 3JARA 3HKEA 1V55B 2HHHB 1RPRA 1OCOC 4DYLA 3I55V 2LJ2A 2LW1A 3G67A 2VQEB 1ORQC 4X64O 1VQ7V 1FFXB 2GDSA 1BHAA 3EHBB 2YI8A 2DQ0A 4JI7O 1COWG 3WB2A 4PDMA 5CA3A 2F66C 4XDKA 2D2CB 3CP1A 5LA6B 5IJ9A 2YC0A 1LNQA 3HKDA 1JVMA 1K8AW 1H2NA 2DYRC 3CCRV 1R1BA 4IYIA 3SPGA 4WFEA 3FB7C 4X9QA 4DR2B 4JZ2A 5J2UB 2IU3A 2Y0PA 3G6EV 1MOFA 4MVUA 4UCTA 1R3IC 2ZNJA 1SQGA 4D6TH 2QWOB 2QTOA 1Q6UA 2DWEC 1QVGU 3SGIA 3BCCH 4O2BB 1JFFB 1KC8W 3ZX6A 2QJ1A 1E1QG 3SYCA 1G4YB 4DR4O 3SDLA 3Q4HB 1VARA 4G28B 5C8YB 1H2GA 4X62O 3HPLC 1W0KG 1N32B 3OEEG 4DR3B 4EB6A 5BMVA 1SQPH 1TAEA 4LF8O 1Z2GA 3OTFA 1IBMO 2UXDO 2ZM6B 4UCSA 3T1HO 3AG1C 2LFRA 3UCSC 4PJ0Z 4K8XA 2E75B 1FOUA 5IYZA 3FB5C 4PDVA 1SQQH 3EVKA 5LOVA 2EIMC 2HKOA 3JAKB 3T4ZA 4RUFA 4WFFA 1BCCH 3O65A
chains in the Genus database with same CATH topology
1Y67A 1AP6A 1D5NA 1I0HA 4F6EA 1GN6A 2P4KA 3C3TA 4BR6A 2CE4A 1XREA 1GN2A 4YIPA 1JA8A 2GDSA 3AK3A 3AK2A 1JR9A 3AK1A 3KKYA 1IX9A 1AR5A 1P7GA 1I08A 1BT8A 4GUNA 4JYYA 1N0JA 3KDRA 1AVMA 1AP5A 1IXBA 3RN4A 4X9QA 1PM9A 4JZ2A 1ZTEA 1IDSA 3DC5A 1PL4A 1EN6A 1AR4A 2QKCA 1MA1A 3OT7A 1MMMA 1BSMA 1MSDA 3IC9A 1LUVA 2RCVA 1XUQA 1VEWA 3C3SA 1SZXA 4E4EA 1ZSPA 1LUWA 2ADPA 1ZLZA 3MDSA 1EN4A 1GN4A 1VARA 4YIOA 1EM1A 3LSUA 2QKAA 1BS3A 3DC6A 1B06A 3K9SA 1WB7A 4C7UA 5AG2A 1QNMA 4JZGA 1EN5A 1KKCA 1GN3A 1ZUQA 1MNGA 4FFKA 1XDCA 5A9GA 2CDYA 3QVNA 1N0NA 3BFRA 1XILA 3EVKA 2ADQB 1WB8A 3TJTA 2AW9A 3CEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y67 A;  1AP6 A;  1D5N A;  1I0H A;  4F6E A;  1GN6 A;  2P4K A;  3C3T A;  4BR6 A;  2CE4 A;  1XRE A;  1GN2 A;  4YIP A;  1JA8 A;  2GDS A;  3AK3 A;  3AK2 A;  1JR9 A;  3AK1 A;  3KKY A;  1IX9 A;  1AR5 A;  1P7G A;  1I08 A;  1BT8 A;  4GUN A;  4JYY A;  1N0J A;  1AVM A;  1AP5 A;  1IXB A;  3RN4 A;  4X9Q A;  1PM9 A;  4JZ2 A;  1ZTE A;  1IDS A;  3DC5 A;  1PL4 A;  1EN6 A;  1AR4 A;  2QKC A;  1MA1 A;  3OT7 A;  1MMM A;  1BSM A;  1MSD A;  3IC9 A;  1LUV A;  2RCV A;  1XUQ A;  1VEW A;  3C3S A;  1SZX A;  4E4E A;  1ZSP A;  1LUW A;  2ADP A;  1ZLZ A;  3MDS A;  1EN4 A;  1GN4 A;  1VAR A;  4YIO A;  1EM1 A;  3LSU A;  2QKA A;  1BS3 A;  3DC6 A;  1B06 A;  3K9S A;  1WB7 A;  4C7U A;  5AG2 A;  1QNM A;  4JZG A;  1EN5 A;  1KKC A;  1GN3 A;  1ZUQ A;  1MNG A;  4FFK A;  1XDC A;  5A9G A;  2CDY A;  3QVN A;  1N0N A;  3BFR A;  1XIL A;  3EVK A;  2ADQ B;  1WB8 A;  3TJT A;  2AW9 A;  3CEI A; 
#chains in the Genus database with same CATH topology
 4B3R B;  4B3T B;  3ZIA G;  1OCZ B;  4MVR A;  5L3C A;  3ABK B;  1OCC C;  1GH6 A;  4N23 A;  1YIJ V;  4J42 A;  1T5E A;  4JI2 O;  4UVA A;  4BW9 A;  4B3S O;  5J2T B;  1SQB H;  4LF9 O;  3B8N A;  1SQX H;  3TET A;  2Y48 A;  4I9W A;  4JPR A;  1M1K W;  1P7G A;  2WAM A;  4MVM A;  5KAI Z;  3LNN A;  1YJN V;  2FB5 A;  3T1Y B;  1NTZ H;  5E79 Z;  3E8F A;  3WU2 Z;  3W7X A;  1AP5 A;  1AVM A;  3DXR A;  1FJG O;  5C93 A;  1RM1 B;  1XNR B;  2HJD A;  2WLM A;  1QR8 A;  1EN6 A;  2XAF A;  2EIN C;  5LL6 Y;  5JH7 A;  1VQL V;  2C2A A;  3JD4 A;  3X2Q B;  4FLW A;  1N33 B;  4YHH O;  1V54 C;  4JGS A;  4JI3 B;  3A8T A;  2CK3 G;  4LF7 B;  2Y69 B;  2JEU A;  1IBL B;  1OJH A;  2UXX A;  4X8A A;  3K0D A;  1WP8 A;  4J9Y B;  2YIA A;  4DV1 B;  1FXH A;  1YIT V;  1N36 B;  4HNA B;  3H1I H;  3CMA V;  1U96 A;  1I94 B;  4YJ3 B;  2LGW A;  2F23 A;  2IJH A;  3K5L A;  2B1I A;  2XUM A;  2W6J G;  1NTK H;  1L1F A;  4DUY O;  4I0X B;  5AG2 A;  4AI8 A;  3ABM B;  1GKF A;  4QPK A;  3TXS A;  4MTO A;  1SRY A;  4FMT A;  3L75 H;  2WLL A;  1G8M A;  5IY5 C;  2IJK A;  2XAS A;  1AIL A;  2WLI A;  1YTF B;  2HVJ C;  1XNQ B;  1XIL A;  4FZ1 A;  3ZN0 A;  1Z5W A;  4X1K A;  4DR5 O;  1VQ9 V;  4O4I A;  2FKX A;  1PPJ H;  3K08 A;  1VQ6 V;  3JAR B;  3FFQ A;  3HKE B;  3RYI A;  3OD4 A;  4NXM B;  1KYO F;  2IJJ A;  2PF4 E;  4JYC A;  4NTY A;  1H2K A;  4NTX A;  3HB3 B;  2DQ3 A;  2H8P C;  1NVP B;  2HLD G;  5EZY A;  1SC5 B;  1NZ6 A;  2HG5 C;  4J7J A;  2VQF B;  5B1B B;  5IJ9 B;  3ABT A;  1IDS A;  4J7K A;  3HKD B;  5IDJ A;  3CPW U;  1AI4 A;  3CCQ V;  4Z1V A;  5LMN B;  4JI4 O;  3P32 A;  3K04 A;  3A0B Z;  1VF7 A;  1V55 C;  4RAI A;  3PJS K;  1GK9 A;  3R65 A;  2QEX V;  3OM3 B;  2R9R B;  2F43 G;  4DR7 O;  4PEL A;  5H6Q A;  4JI5 O;  2KKW A;  2YUA A;  3OFN G;  2PTM A;  4GX2 A;  4ZBM A;  5EYP A;  4EFE A;  4Z2W A;  2EIJ B;  1P4R A;  4H0L B;  3STZ C;  4PV1 B;  3H1J H;  1KQS U;  1KKC A;  3BEH A;  4QGP A;  3H1H H;  3O9O A;  5HFM A;  5BMV B;  4KFM A;  2CH7 A;  1H8E G;  1B3Q A;  1AI7 A;  3OEH G;  4EEQ A;  4JYB A;  5H2F Z;  4FLX A;  2AW9 A;  4MVS A;  1JCH A;  3CRA A;  4X64 B;  3LDE A;  1MSW D;  2MK3 A;  5JJE B;  2W6I G;  3ZRX A;  4Q6G A;  1JOY A;  3MHH C;  4U7N A;  3UT5 A;  2WLH A;  1K3E A;  2FML A;  1M57 B;  3JAT B;  4X1I A;  1JA8 A;  4MW8 A;  1HNZ B;  2Q73 A;  3AK2 A;  3BAB A;  3CRM A;  1VMG A;  5L3E A;  5KHH A;  3T4D A;  4BIZ A;  4JI0 O;  4IHJ B;  1IXB A;  2QWQ B;  4X89 A;  5LA6 A;  4G2K A;  4WCE V;  5KUK A;  3SYQ A;  4JAA A;  3CE2 A;  4LWS A;  2UUB B;  4ZKI A;  1XHZ A;  3GVM A;  1BSM A;  1NTM H;  3B4S A;  3CRC A;  2YXL A;  1OCZ C;  3ABK C;  1S5H C;  4X62 B;  1K97 A;  2JJ1 G;  3ETE A;  2UU9 B;  2HR3 A;  1Q7Y W;  1YXB A;  3J7A U;  4LF4 O;  2LQT A;  3JAS B;  4O2B A;  3DC6 A;  4A5U B;  4QJF B;  4RQE A;  3FYE B;  4J9Z B;  4MVQ A;  1TA8 A;  3ZED A;  4UV9 A;  3RW0 A;  2E5L B;  1BQ0 A;  1RM1 C;  5C8Y A;  5L3D A;  2V4D A;  4NTW A;  4NXN O;  2QKS A;  4ABM A;  1XOU A;  1IBK O;  3BVO A;  3ML0 A;  1N34 O;  3CHX A;  3ZHT A;  1QVF U;  3G80 A;  2ZIO A;  3X2Q C;  5B5E Z;  3HKC A;  2E74 B;  3CCS V;  2JVD A;  4YY3 O;  1R6K A;  5GTH Z;  1XMO B;  2Y69 C;  1Y74 B;  4FLZ A;  3CB2 A;  2IM9 A;  1Y67 A;  3A2F A;  5H6R A;  4MTX A;  1RP3 B;  3JD3 A;  1HNX B;  2HP8 A;  1N4C A;  3P3N A;  5CBG A;  4IIJ B;  3OGI B;  3K57 A;  1RFY A;  1R73 A;  2GSM B;  2XAQ A;  4DO2 A;  1JR9 A;  1FJG B;  3KKY A;  1IX9 A;  3JAL B;  3SJC C;  2WA4 A;  2DJV A;  3ETG A;  3ABM C;  3RYI B;  4F4L A;  1BT8 A;  3JCZ A;  5A2Q N;  3F7Y C;  5J2T A;  4K0K B;  4PD4 F;  3VQX A;  1V9P A;  2QM7 A;  3L9D A;  1KB9 F;  3RN4 A;  1URF A;  1YTF D;  4YHH B;  3UQ8 A;  1AR4 A;  3APQ A;  4DV3 O;  5CB4 B;  2H3O A;  4I50 B;  1MMM A;  3LDD A;  1IZ3 A;  3W7W A;  2XAJ A;  1D2D A;  2EBO A;  4O4J B;  3K0G A;  4PA9 A;  1MG1 A;  1XL4 A;  5IYC O;  3ZHS A;  4DR1 O;  2Q4P A;  3BHP A;  4OGQ B;  1HNW B;  3RYC B;  2RJZ A;  4RUE A;  4QE9 A;  2Q7G A;  3UKM A;  3MDS A;  5GON B;  4MW3 A;  2NN4 A;  4YIO A;  1D5A A;  2Y4T A;  3OAA G;  1NVP D;  3D36 A;  4QIW F;  4BW5 A;  1VQM V;  1PKX A;  1W0J G;  1YHQ V;  4FLT A;  4I7Z B;  3L70 H;  2Q67 A;  1ZL8 A;  4YJ3 A;  5B1B C;  3KCY A;  4LF6 B;  1WA8 B;  3SJQ C;  1DF4 A;  4ZHQ B;  5IE9 A;  1H2S B;  3ABU A;  4CC5 A;  1SS3 A;  4ZOL A;  1FFT B;  2XAH A;  5JCO A;  2LP7 A;  1AI6 A;  3AG4 B;  3E89 A;  1XL6 A;  2UXN A;  1WJZ A;  4CS3 A;  3CEI A;  4JI6 B;  2YIB D;  4B08 A;  1YDX A;  3OUS A;  1WNS A;  2JIZ G;  3FYI B;  2YXH A;  2WLK A;  4LFA B;  4FM2 A;  1JJ2 U;  1H5W A;  2QGN A;  1U97 A;  4LFB B;  4LNU B;  3RGB A;  5IJ0 A;  1GM8 A;  4DV0 O;  3UT5 B;  2EIJ C;  4X1I B;  1HR0 B;  2OTL V;  3IAY A;  2P6J A;  3M8A A;  1XHX A;  3AG7 A;  1K5Q A;  2UUC O;  1GO3 F;  4OPH A;  4XDJ A;  5L3G A;  1R6T A;  2G38 A;  2OIG A;  1S77 D;  2F4V B;  2ZE8 A;  5DM6 V;  1JJO A;  2WA3 A;  3K5O A;  3ZHR A;  1FS0 G;  4DR7 B;  2JRI A;  4JI5 B;  4P9O A;  5EC1 C;  5KHJ A;  2JJ2 G;  4X20 A;  2RCV A;  4O2A A;  1OZ0 A;  2Z0A A;  1K7D A;  4PHZ A;  3ZCC A;  2DYS B;  3D3Q A;  4LH7 A;  4LWS B;  4UCO A;  1M57 C;  1LUW A;  2K9P A;  5IWA B;  1ZLZ A;  2P4V A;  3E35 A;  1SZT A;  1GAX A;  3ZS8 C;  2YIB A;  5B1A B;  4JI1 B;  4AQY B;  3NR7 A;  4JV5 B;  4I5S A;  1WB7 A;  4X65 O;  4JZG A;  3L72 H;  2QDO A;  4GKJ O;  5LMU O;  3OMI B;  3SYO A;  5A9G A;  4WFB V;  2CDY A;  1CPY A;  1VQK V;  3ZMZ A;  3CC7 V;  4BIU A;  4H44 B;  5ITZ A;  1WB8 A;  2B9Z A;  4CS4 A;  2FYU H;  4DV5 O;  4DR6 B;  4PDL A;  5KA5 A;  5KLV H;  1D5N A;  5L3F A;  3S3W A;  2AXT Z;  3HKC B;  3OTO O;  5E1A C;  4IT5 A;  1HDJ A;  3OR6 C;  2CE4 A;  1SET A;  1NQT A;  1WAZ A;  3OMN B;  4MVZ A;  1K34 A;  1Q3E A;  4TT3 G;  1S0V A;  3B09 A;  4GZR B;  2EJ7 A;  1ARO P;  2ITD C;  1EZV H;  1FYJ A;  2LW7 A;  5HFL A;  1GM7 A;  3JAT A;  2P90 A;  1YI2 V;  1KBH A;  3H01 A;  1L0L H;  4UVB A;  4DV6 O;  3K59 A;  3NXS A;  2PI4 A;  4FZ0 A;  2K1E A;  4KHP O;  4FVM A;  2L35 A;  2VRZ A;  4IHJ A;  3OMA B;  1H2M A;  3N27 A;  3D3I A;  1MSD A;  5BY1 A;  1NBM G;  2AZ2 A;  1XUQ A;  4X1Y A;  1A32 A;  4LFC B;  2RMK B;  2DOS A;  3ASO B;  4TWK A;  1X59 A;  3CCM V;  1K92 A;  2CGN A;  4YJ2 B;  2VWJ A;  1US6 A;  1QU7 A;  3K9A A;  1KD1 W;  1PD3 A;  4DV2 O;  2QKA A;  4CBC A;  5D5Q A;  2Q5Z A;  3B8M A;  3FKS G;  4JTD B;  1E79 G;  3RYF B;  2ZD9 A;  3FAV B;  4OPA A;  2Q6A A;  1YCI A;  4GT1 A;  3ZMV A;  3B2E E;  3E8B A;  1W2B U;  4YY3 B;  3JAS A;  4FFK A;  2UXB B;  3QVN A;  3U11 A;  1P84 F;  1ZL8 B;  3U10 A;  3IFX A;  3TGU H;  3W7U A;  1NH2 B;  2AZ0 A;  2RN9 A;  4MTF A;  2XTA A;  5DED A;  1VQ4 V;  1Q5O A;  3L71 H;  3ETQ A;  1JPX A;  4ZOL B;  2E3C A;  3QO8 A;  3ZN1 A;  2BTQ A;  3W7S A;  4B3M B;  3K79 A;  3SJA C;  1Y74 A;  3P3P A;  4L87 A;  1QHT A;  4E2L A;  4B7E A;  1M93 A;  1EFR G;  4IIJ A;  1I08 A;  1WPB A;  3K5M A;  3DGE A;  4FM0 A;  1EZJ A;  1S3J A;  2A9H A;  4JYY A;  1I7F A;  2Q68 A;  5IJ0 B;  2ZE7 A;  2CGO A;  5LHH A;  4X66 O;  3H1L H;  2GUZ A;  3JAL A;  2GV9 A;  2UUA O;  3AG4 C;  4L8J A;  3ETD A;  3CXH F;  4DR1 B;  3N2K B;  2OCC B;  3CRR A;  2P7T C;  3W7T A;  1LUV A;  2QWN B;  4R7C A;  3HKB A;  3EXA A;  3G4S V;  1VEW A;  3H1K H;  5CB4 A;  1MZE A;  4GKK O;  4I50 A;  3DSQ A;  2E76 B;  2CTP A;  1CP9 A;  2Z5U A;  2ADP A;  3OGC C;  4DV7 B;  4X20 B;  2CAZ C;  4O2A B;  3ZRV A;  3L73 H;  2RNB A;  4O4J A;  3JAW B;  4ZIB A;  3CCE V;  3RYC A;  1VIB A;  4K3A A;  5GON A;  2ARH A;  1VQ8 V;  3TK1 A;  1UPG A;  3ASN B;  3TXQ A;  4DUZ B;  2HHH O;  4IGG A;  4BAY A;  3SYP A;  2IJI A;  2VQE O;  5K1P A;  5KHI A;  3TJT A;  1WA8 A;  2ZIN A;  5B3S B;  4ZHQ A;  4UVC A;  4LH6 A;  2DYS C;  3P30 A;  2PYL A;  3JSL A;  4DV0 B;  5ITZ B;  5KUM A;  1BGY H;  4BR6 A;  2HJF C;  2ZDI C;  4H37 A;  2ILM A;  4DK0 A;  3VQY A;  5B1A C;  2VWK A;  4DR2 O;  1UJW B;  3VBB A;  1L0N H;  4UFZ A;  2Q7H A;  2CUG A;  4JI7 B;  4LNU A;  1M56 B;  3THO A;  1H38 A;  5B1N A;  1PL4 A;  2A79 B;  2X7R B;  3RT3 C;  2PI5 A;  1KP3 A;  4O4H B;  1QLN A;  5KA6 A;  3E8H A;  4KL1 A;  1YEW A;  2QE7 G;  4QE7 A;  2YSU B;  1CXZ B;  3BA8 A;  3SPJ A;  1DK1 A;  4JF3 A;  3UO3 A;  3E2E A;  2EIK B;  1N32 O;  4EKW A;  2QR4 A;  5FNV B;  1UFI A;  1XQ8 A;  2HVK C;  2XT9 A;  5L3B A;  3K03 A;  4X1Y B;  1B04 A;  1O9G A;  1Q43 A;  2GBO A;  4MT8 A;  4PI2 A;  4MSW C;  4DV4 O;  5EBW C;  3KZI Z;  4DR4 B;  2W0F C;  1PNK A;  1THZ A;  3L74 H;  2ZDI A;  3JD2 A;  4JAV A;  3JD1 A;  5H5N A;  1BMF G;  4TV8 B;  4UXN A;  3K3W A;  4LF8 B;  2N04 A;  4B3R O;  4B3T O;  1YVW A;  1J5E O;  4BIO A;  2ZQM A;  3OTO B;  1IBM B;  2UXD B;  1M9N A;  2JGD B;  1FAF A;  3T1H B;  1G6U A;  2Q7E A;  3AG3 B;  3ASO C;  4FIP C;  2PUS A;  4DRX B;  2JEX A;  4RWU A;  4U3J B;  1GN6 A;  4FJC C;  3GWK C;  3IGA C;  4KP4 A;  5EC2 C;  4UB6 Z;  3ZMT A;  2A3Q A;  2BE3 A;  3T1Y O;  3WB0 A;  1P7B A;  4D7T A;  5LBQ A;  2BTQ B;  1AR5 A;  5LYJ B;  3A0R A;  2WLJ A;  4JI2 B;  1K5S A;  1ZX3 A;  3FX7 A;  4B3S B;  1PP9 H;  1BL8 A;  3ZBH A;  3D36 C;  5JVD B;  4LF9 B;  3KDR A;  1Y6X A;  2Y0I A;  3CS5 A;  1VQN V;  4ICG A;  1N33 O;  5LP6 A;  2EX3 A;  1VF5 B;  1NH2 D;  2WWW A;  1Q6H A;  1Q8I A;  4LF7 O;  4UCV A;  5CBH A;  3OT7 A;  3RBZ A;  1SA0 B;  5JQG A;  3CCV V;  4DV1 O;  1N36 O;  2GUZ B;  4I9Q A;  2ZR3 A;  1AJN A;  4W4K A;  3A0H Z;  1AJQ A;  4TOI A;  3JAM N;  1I94 O;  5JCO C;  1NR1 A;  4J41 A;  3CWB H;  4J10 A;  1HP8 A;  2BOB C;  3ZRS A;  1KEC A;  1ZSP A;  3QTC A;  1R3K C;  2NNU A;  3MD0 A;  3HKB B;  4LC1 A;  3ZRW A;  2WSS G;  4HAM A;  1FXV A;  1EM1 A;  1VQ5 V;  1B06 A;  5K1X A;  2BCC H;  1IXM A;  4YJ2 A;  2QWR B;  4R6Z A;  1XNQ O;  1L8D A;  4UV8 A;  2YEV B;  2YXY A;  4FFB A;  1DGS A;  4PA3 A;  5JWP A;  5BR8 O;  2BSK B;  1LR1 A;  4WFG A;  3RYF A;  4DUY B;  4QPJ A;  3FAV A;  2OCC C;  1YJ9 V;  5LXT B;  3LSS A;  1S72 V;  1GTO A;  3RVZ A;  4NXM O;  5FLX N;  4PDR A;  2UXC O;  2JS3 A;  2ZKO A;  4JTA B;  5EBM C;  4CC6 A;  3SPC A;  3MAQ A;  1Y66 A;  1YF2 A;  2ZE5 A;  4DR5 B;  4DW0 A;  4UB8 Z;  1FXK B;  2XHB A;  1PV0 A;  4X66 B;  4G27 B;  2VQF O;  2A06 H;  2KB1 A;  1S76 D;  4K35 A;  4MS2 A;  2KSD A;  3K06 A;  4GUN A;  3PN1 A;  2UUA B;  2WLN A;  3ASN C;  1N0J A;  3KCX A;  5LMN O;  3BRC A;  1J95 A;  2DN9 A;  4I4T B;  5CBF A;  1PM9 A;  2BTO A;  1Z5V A;  3OW2 U;  3DC5 A;  5CA0 B;  4P2Z A;  2QWP B;  1MA1 A;  2EIL B;  2ZT9 B;  2MW2 B;  5B3S C;  4YXW G;  2AHZ A;  2OYQ A;  1NKD A;  3EFF K;  1QLE B;  3R66 A;  4JI4 B;  3N2K A;  3LUT B;  4XBF A;  4J80 A;  4CH3 A;  3QO7 A;  3VQW A;  2P06 A;  1F7Y A;  3LSU A;  1BS3 A;  1KMI Z;  5BXZ A;  5KMG B;  2QTS A;  2B5U A;  4WBN B;  2Y4U A;  3FB8 C;  1QNM A;  1M56 C;  4LCU C;  4ZI7 A;  2EZP A;  3JAW A;  5BZB A;  2JS5 A;  1SER A;  3SPH A;  2YIC A;  2YDE A;  2PZS A;  1ZAU A;  1S5J A;  2ZXW B;  4NR1 A;  5B66 Z;  1Y4M A;  3J81 N;  1I5X A;  1RPO A;  2M6Y A;  3F7V C;  4RQF A;  1M5I A;  5EBL C;  5LHI A;  1K73 W;  3TCU A;  1HNZ O;  1XI1 A;  2EIK C;  1NU1 H;  2DMX A;  2GTS A;  1I0H A;  4FK5 C;  3CC4 V;  2OIE A;  4J11 A;  1IJG A;  3LNM B;  5CMU A;  4JAU A;  4PA6 A;  3ZHV A;  4GX0 A;  1QCE A;  1M90 W;  1O9H A;  3ZHU A;  3S3X A;  1MAB G;  4PI0 A;  1Y76 A;  4PA7 A;  1TUB B;  1H2L A;  1SQF A;  1KU9 A;  4KXR A;  3SJB C;  2FTK A;  4R8C A;  3RYH B;  1WP7 A;  1XMQ O;  3AG2 B;  2UUB O;  1DTO A;  4TUY B;  3ZJZ A;  1IVS A;  3FD9 A;  1BQZ A;  4JI0 B;  3AEI A;  4H13 B;  4U7O A;  3AG3 C;  1SQV H;  5LP6 B;  3OE7 G;  3IC9 A;  2UU9 O;  2DW4 A;  3F5W C;  4O4H A;  2HFE C;  4HYO A;  1FPO A;  3CJH B;  2N74 A;  5JQG B;  2GHY A;  3WG7 B;  4DV4 B;  1R3L C;  1EN4 A;  4OX9 O;  4B7K A;  2IW5 A;  5JJJ B;  1AB3 A;  4GX1 A;  2E5L O;  3RVY A;  3ZMU A;  1YJW V;  4Q20 A;  5FNV A;  1OV9 A;  2LO1 A;  1J5E B;  3ZRW B;  2Q0A A;  4LF4 B;  1MNG A;  2XND G;  3CD6 V;  3K5N A;  1XMO O;  1TGO A;  4CS2 A;  2ZCE A;  2YS8 A;  1HNX O;  2ADQ B;  5CA1 B;  1RSO A;  4FFB B;  2YID A;  4NXN B;  3BAA A;  4TV8 A;  4F6R A;  1IBK B;  2B1G A;  1N34 B;  1QQC A;  3CRQ A;  3LSQ A;  1ENV A;  2QM8 A;  3SYA A;  4F6E A;  5D5P A;  3UM7 A;  3BA9 A;  2JGD A;  1K4C C;  1XRE A;  4HZ3 A;  1K33 A;  2O57 A;  1F4M A;  1Q81 W;  4O4L A;  2LGQ A;  2AHY A;  4K0K O;  2DWD C;  4RO2 A;  4DRX A;  3JSN A;  2PYJ A;  1BZK A;  4U3J A;  3GB7 C;  3FB6 C;  1PL0 A;  1R3J C;  4TV9 B;  4D7S A;  1R6N A;  1SKV A;  3CYO A;  2D3O W;  1AI5 A;  2L6L A;  1TVK B;  2ETN A;  5CN0 A;  5LYJ A;  4CZZ A;  1OHH G;  1S5L Z;  2GTA A;  2QKC A;  2KG7 B;  4UUJ C;  5JVD A;  3ABL B;  1HNW O;  1FKA O;  5FPO A;  3OUF A;  2ODM A;  4DV3 B;  3C3S A;  4MTG A;  1JNB A;  1FXK C;  4E4E A;  1SA0 A;  4LF5 O;  1DF5 A;  3QG5 A;  4IYH A;  4GLX A;  3I56 V;  4UCU A;  5LGU A;  4R50 A;  1VF6 C;  5KX5 B;  4LF6 O;  2P67 A;  3G71 V;  2CTQ A;  5BR8 B;  4H33 A;  3LDC A;  4GCZ A;  2KQX A;  2F95 B;  2W0X A;  1Q82 W;  1GN3 A;  3E22 B;  1IUR A;  3UO2 A;  1YZB A;  2ZNI A;  4JI8 O;  2A7W A;  4JI6 O;  2UXC B;  1N0N A;  2EIL C;  3MHS C;  2OTJ V;  3BFR A;  4ZI7 B;  2YEV A;  4CH5 A;  1F4N A;  1QLE C;  4LFA O;  2JDI G;  1XEQ A;  2BSK A;  5TIS Z;  1GMG A;  4LFB O;  2Q9L A;  3U0Z A;  2X6A A;  1OCR B;  2NLJ C;  5LXT A;  4JYA O;  1GN2 A;  1HR0 O;  4CH6 A;  2F1M A;  1VP7 A;  4XDL A;  3CC2 V;  4I55 A;  3N2G A;  1K4D C;  1WN7 A;  2F93 B;  2PY5 A;  1FXK A;  4X88 A;  2PGG A;  3VOU A;  2F4V O;  4ASU G;  1NT2 B;  2VS0 A;  1JMK C;  3CCJ V;  4FLV A;  2X6B A;  1VF6 A;  1GM9 A;  3E83 A;  1Y76 B;  4JAS A;  2H94 A;  2R9I A;  5H9C A;  2V7Q G;  2ZXW C;  1TUE B;  5DN6 G;  1QR9 A;  2UUC B;  4UCR A;  1XBL A;  1M4U A;  4I4T A;  5IWA O;  1F51 A;  2DE0 X;  4FPP A;  3T2M A;  3JYC A;  5CA0 A;  5LGT A;  4NB5 A;  1QBZ A;  1N8R W;  3E86 A;  1OCO B;  5F2V O;  2BOC C;  1SZX A;  3DTU B;  4JI1 O;  2M7W A;  4EB6 B;  4AQY O;  2NR5 A;  4P30 A;  3RFR A;  1BE3 H;  4JV5 O;  3CCU V;  4NYK A;  3I5D A;  5IT9 N;  2P5O A;  5IYZ B;  2YI9 A;  4J7Z A;  1YSC A;  3AG2 C;  5LOV B;  2EUL A;  2HEP A;  1PNL A;  2DYR B;  1WPX A;  5KMG A;  4DR3 O;  1I5Y A;  1SES A;  2OCH A;  3GWO A;  3QNE A;  5B1O A;  4WBN A;  3CME V;  4DR6 O;  1W59 A;  4OXS A;  4X65 B;  1NS1 A;  3JD0 A;  5LP6 C;  4GKJ B;  2ZM6 O;  5LMU B;  4FM1 A;  2X0L A;  3CCL V;  4FLY A;  3H9V A;  3K58 A;  2A0L A;  1FFX A;  1AP6 A;  1Q6I A;  4IL6 Z;  5JJN B;  3WG7 C;  3C3T A;  3B40 A;  1RSO B;  3SPI A;  2WPD G;  4YIP A;  3ICX A;  4F6R B;  4DV5 B;  3RWR D;  4LP8 A;  2OWO A;  3JCU Z;  4CH4 A;  4WFH A;  1XMQ B;  4MVO A;  2ATK C;  3AK3 A;  3DXR B;  3BPZ A;  2QA4 V;  4WF9 V;  3BY6 A;  1PNM A;  5J2U A;  4N21 A;  1DLB A;  3M99 B;  3VQV A;  1CEZ A;  4O4L B;  5JH7 B;  2R72 A;  1Q90 D;  3HR0 A;  3AG1 B;  1TUB A;  2QM4 A;  2V1D A;  3RYH A;  5KHG A;  4LFC O;  4AIL C;  1NR7 A;  5EK0 A;  1K9M W;  3CSX A;  1JFF A;  4BWA A;  4DV6 B;  2QSA A;  1XNR O;  2EIM B;  5IYB O;  1SF9 A;  4TUY A;  3WB1 A;  1KUQ A;  4OX9 B;  2P22 C;  5DEC A;  3Q4H A;  1HW7 A;  2CTR A;  4KHP B;  3F5T A;  4NVP A;  3WFV A;  4DK1 A;  5KHK A;  3CX5 F;  5KAF Z;  1OCC B;  2ZR2 A;  3QO5 A;  4JTC B;  2XAG A;  4WFA V;  4JI3 O;  1EBO A;  3ZMS A;  3SR2 C;  4DXW A;  5LHG A;  1IBL O;  3CJH A;  4QNH B;  2IH3 C;  4PA4 A;  2WLL B;  3KG2 A;  1NI8 A;  2UXB O;  2WLI B;  1EN5 A;  4DV2 B;  1ZUQ A;  2ZE6 A;  4X1K B;  3JAK A;  1XDC A;  4HBN A;  4DW1 A;  4O4I B;  4EFB A;  3T1C A;  2EJR A;  2Q69 A;  3M7M X;  3ABL C;  2IBZ H;  3QF7 A;  1ZWI C;  2EIN B;  2ITC C;  4W4L A;  1JX9 A;  4B3M O;  1AJP A;  5EIB D;  4NKG B;  1ROP A;  5EIB C;  1P49 A;  3E8G A;  1V54 B;  5J9P C;  4Z1M G;  2N05 A;  1F23 A;  2P4K A;  1X4T A;  5CA1 A;  4TQF A;  1E1R G;  4P9P A;  2LFS A;  1G1X B;  5EZY B;  2XOK G;  1Q86 W;  3J80 N;  5GW7 A;  3AK1 A;  2AGA A;  4LR3 A;  2Q0O C;  5FL7 G;  1VQP V;  4K8Z A;  1NJI W;  5IYD O;  1VQO V;  1HWY A;  2OT5 A;  1FD9 A;  4GX5 A;  4U3F H;  4I55 B;  3N2G B;  1ZTE A;  4TV9 A;  3C90 A;  2R9A A;  2R70 A;  5IY5 B;  1GRJ A;  2IU0 A;  4LF5 B;  1TVK A;  5GTI Z;  3B77 A;  2X6C A;  2IH1 C;  3G6B A;  4DV7 O;  4HNA A;  2EZO A;  3APO A;  2JGU A;  1OCR C;  2KG7 A;  3CXC U;  1H8H G;  1WLE A;  5EYP B;  2Z3Y A;  3STL C;  5FPR A;  2RDC A;  2JK5 C;  4KUM A;  4I0X A;  1GN4 A;  1B6Q A;  2ZIM A;  4GKK B;  1KP2 A;  3OR7 C;  1KKD A;  4JI8 B;  2Q8V A;  3D8C A;  4AHC A;  4DUZ O;  4LBE C;  4TSF G;  2FL4 A;  2CH7 B;  3K9S A;  4C7U A;  4FLU A;  4GYC B;  3ZHQ A;  5KX5 A;  1JQ0 A;  2CTW A;  2RQ6 A;  5LGN A;  1BHB A;  3IJ4 A;  3IC7 A;  1AR1 B;  1MZF A;  3E22 A;  4TQD A;  4JYA B;  3JAR A;  3HKE A;  1V55 B;  2HHH B;  1RPR A;  1OCO C;  4DYL A;  3I55 V;  2LJ2 A;  2LW1 A;  3G67 A;  2VQE B;  1ORQ C;  4X64 O;  1VQ7 V;  1FFX B;  2GDS A;  1BHA A;  3EHB B;  2YI8 A;  2DQ0 A;  4JI7 O;  1COW G;  3WB2 A;  4PDM A;  5CA3 A;  2F66 C;  4XDK A;  2D2C B;  3CP1 A;  5LA6 B;  5IJ9 A;  2YC0 A;  1LNQ A;  3HKD A;  1JVM A;  1K8A W;  1H2N A;  2DYR C;  3CCR V;  1R1B A;  4IYI A;  3SPG A;  4WFE A;  3FB7 C;  4X9Q A;  4DR2 B;  4JZ2 A;  5J2U B;  2IU3 A;  2Y0P A;  3G6E V;  1MOF A;  4MVU A;  4UCT A;  1R3I C;  2ZNJ A;  1SQG A;  4D6T H;  2QWO B;  2QTO A;  1Q6U A;  2DWE C;  1QVG U;  3SGI A;  3BCC H;  4O2B B;  1JFF B;  1KC8 W;  3ZX6 A;  2QJ1 A;  1E1Q G;  3SYC A;  1G4Y B;  4DR4 O;  3SDL A;  3Q4H B;  1VAR A;  4G28 B;  5C8Y B;  1H2G A;  4X62 O;  3HPL C;  1W0K G;  1N32 B;  3OEE G;  4DR3 B;  4EB6 A;  5BMV A;  1SQP H;  1TAE A;  4LF8 O;  1Z2G A;  3OTF A;  1IBM O;  2UXD O;  2ZM6 B;  4UCS A;  3T1H O;  3AG1 C;  2LFR A;  3UCS C;  4PJ0 Z;  4K8X A;  2E75 B;  1FOU A;  5IYZ A;  3FB5 C;  4PDV A;  1SQQ H;  3EVK A;  5LOV A;  2EIM C;  2HKO A;  3JAK B;  3T4Z A;  4RUF A;  4WFF A;  1BCC H;  3O65 A; 
#chains in the Genus database with same CATH homology
 1Y67 A;  1AP6 A;  1D5N A;  1I0H A;  4F6E A;  1GN6 A;  2P4K A;  3C3T A;  4BR6 A;  2CE4 A;  1XRE A;  1GN2 A;  4YIP A;  1JA8 A;  2GDS A;  3AK3 A;  3AK2 A;  1JR9 A;  3AK1 A;  3KKY A;  1IX9 A;  1AR5 A;  1P7G A;  1I08 A;  1BT8 A;  4GUN A;  4JYY A;  1N0J A;  3KDR A;  1AVM A;  1AP5 A;  1IXB A;  3RN4 A;  4X9Q A;  1PM9 A;  4JZ2 A;  1ZTE A;  1IDS A;  3DC5 A;  1PL4 A;  1EN6 A;  1AR4 A;  2QKC A;  1MA1 A;  3OT7 A;  1MMM A;  1BSM A;  1MSD A;  3IC9 A;  1LUV A;  2RCV A;  1XUQ A;  1VEW A;  3C3S A;  1SZX A;  4E4E A;  1ZSP A;  1LUW A;  2ADP A;  1ZLZ A;  3MDS A;  1EN4 A;  1GN4 A;  1VAR A;  4YIO A;  1EM1 A;  3LSU A;  2QKA A;  1BS3 A;  3DC6 A;  1B06 A;  3K9S A;  1WB7 A;  4C7U A;  5AG2 A;  1QNM A;  4JZG A;  1EN5 A;  1KKC A;  1GN3 A;  1ZUQ A;  1MNG A;  4FFK A;  1XDC A;  5A9G A;  2CDY A;  3QVN A;  1N0N A;  3BFR A;  1XIL A;  3EVK A;  2ADQ B;  1WB8 A;  3TJT A;  2AW9 A;  3CEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...