2ADQB

Human manganese superoxide dismutase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Crystal structure of nitrated human manganese superoxide dismutase: mechanism of inactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 69
structure length 196
sequence length 196
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
B PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2adqB01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2adqB02
1XUQA 3QVNA 1QNMA 1Y67A 1B06A 3BFRA 1MSDA 1AP6A 1LUWA 4FFKA 1MNGA 1N0JA 4YIOA 1MMMA 1XILA 2CDYA 3EVKA 3CEIA 2QKAA 1ZSPA 5A9GA 1WB8A 3MDSA 1EN4A 1PL4A 1ZUQA 3AK1A 1IXBA 3AK3A 2CE4A 1D5NA 4JZGA 1ZLZA 2ADPA 3LSUA 1KKCA 1BS3A 1AR5A 1IDSA 2GDSA 1AP5A 1GN2A 1ZTEA 2ADQB 3DC6A 3AK2A 1EN5A 1MA1A 4GUNA 1PM9A 3OT7A 2AW9A 1N0NA 4YIPA 1AR4A 1GN4A 1JA8A 1EN6A 3C3SA 3RN4A 1EM1A 4E4EA 4BR6A 4JYYA 2P4KA 1GN3A 1I0HA 2QKCA 5AG2A 1XREA 1AVMA 1XDCA 3K9SA 3DC5A 1WB7A 1IX9A 1P7GA 2RCVA 4F6EA 4JZ2A 4C7UA 1VARA 1LUVA 1GN6A 1SZXA 1I08A 1VEWA 3KKYA 1BSMA 1BT8A 3IC9A 1JR9A 3C3TA 4X9QA 3TJTA
chains in the Genus database with same CATH superfamily
5CBGA 5FPRA 1YJNV 3LDDA 2LFRA 5LXTB 4FLUA 1GKFA 2HKOA 3B2EE 1XNQB 4EFBA 1M1KW 4K35A 4FFBB 2F43G 3B8NA 5KHKA 5EBMC 1OCOB 3H01A 5LBQA 1M56B 1IBKO 4NXMO 2V4DA 1VF6A 2FYUH 1PD3A 3SPGA 1V9PA 5JJEB 4WFBV 3JATA 1KKCA 3CJHA 3BAAA 4U3JB 4CH3A 1PNMA 1BQZA 5LMNO 4I7ZB 5B3SC 1KKDA 1EN5A 1VQ6V 3H1KH 1Q7YW 1KD1W 2WLIB 4X65O 3THOA 4DV4O 1VQLV 2CGNA 4J10A 1VQ7V 1XL4A 1COWG 4TV9B 3ZJZA 3K9AA 4JYAB 1H2SB 3OEEG 4WFFA 3BABA 1M9NA 1QCEA 1KP3A 1XDCA 5LOVB 1ZL8A 2YIAA 2NR5A 2QWPB 4H13B 2HVJC 2XT9A 1BMFG 2RJZA 3OE7G 3MHHC 4JV5B 2Y4TA 1NR7A 5IDJA 3OTOO 3EXAA 1BT8A 2F66C 2OIGA 1WPBA 1NZ6A 1XUQA 3AG2C 5JCOC 1Y4MA 3ZRSA 4QNHB 4O2BA 3WFVA 3UO2A 4QPJA 4LF5O 1MNGA 4MVQA 2HP8A 3K79A 5D5QA 4MVSA 1ZAUA 4JI2O 5B1BB 5C8YA 3C90A 5TISZ 2X6CA 2Q5ZA 2N04A 1KECA 3E22A 4WFGA 1YVWA 3RGBA 2HG5C 1QR9A 4RO2A 1BS3A 1TVKA 2YXYA 4JI7O 1FOUA 2P6JA 2GDSA 3SJCC 4O4IB 2D2CB 5K1PA 4X8AA 1YIJV 1JJOA 1TGOA 4NXNO 1KP2A 1VIBA 1PV0A 4AQYO 4OX9B 2JVDA 1NI8A 4MTXA 1HNXB 4LFBB 2EULA 4UV9A 4CS2A 3GWKC 1YDXA 1VF6C 1NKDA 3VOUA 1XEQA 1JA8A 3CCQV 3P3NA 1EFRG 3SJQC 1OV9A 3F5TA 2GTAA 2OT5A 4UXNA 5J9PC 3R65A 2VQEO 3SYOA 3JD3A 3FAVA 4L8JA 3BEHA 2Q69A 2CH7B 2IW5A 2UU9B 5DEDA 4WCEV 3FX7A 1NTKH 4ASUG 4K0KB 2A06H 3RYHB 2Y0IA 5BR8B 4DV2B 2EIJB 2ZCEA 1I94O 3A0HZ 5IY5C 4LF7B 2E5LB 2OYQA 2CAZC 3G6BA 5GTHZ 4DUYB 4TOIA 1VQKV 2WWWA 4FZ0A 2PY5A 1FFTB 2WLHA 2ARHA 4FLYA 2UXXA 3UKMA 4B3RO 3SR2C 4PA3A 3T1HO 1P49A 1B06A 4DV5O 5LL6Y 3RVYA 3VQYA 2P06A 4QGPA 3ZMUA 1PPJH 1WLEA 1MMMA 1S3JA 3E2EA 1V55C 4CS4A 3FB5C 1QLEB 3CP1A 2EIMC 2CGOA 1M93A 2H94A 4D7TA 1K5SA 4X64B 5CBHA 2N74A 1JFFA 2Y69C 1L1FA 2ZE8A 2Z0AA 2QWNB 2R72A 2R9RB 3CE2A 4X62B 4TWKA 3AG1B 4FZ1A 2PGGA 2R9AA 1SESA 2RN9A 3OFNG 5L3DA 2ZDIA 4ICGA 3B4SA 1XNRB 1VQNV 3DXRB 3P3PA 1MA1A 1XHXA 4JI6O 1RP3B 3K5MA 5KUKA 1AI7A 2DW4A 4J11A 1M5IA 3SJBC 1F7YA 4GKJO 5KX5B 1UFIA 4NR1A 2NLJC 3ABMC 4JYBA 2L6LA 1UJWB 2KG7B 1IBLB 1JCHA 3K0GA 1WJZA 1HDJA 4FIPC 3JALB 4LF6O 5LYJB 4RUEA 5DN6G 5KUMA 3AG4C 3D3QA 4DR6O 4FK5C 1J5EB 1DF4A 4IGGA 1IURA 1JOYA 4KUMA 3T1YO 4B3MO 1U96A 3HKEA 4PDMA 4GKKB 3ASOB 1NT2B 1S72V 1LUWA 4OPAA 1CXZB 2R9IA 4YIOA 5JVDB 2LFSA 4F6RB 4RQEA 1URFA 4DR4B 2Q7EA 5KMGB 3IGAC 4GYCB 4DR1O 4XDLA 5JJNB 1R3LC 4I5SA 4N23A 3UM7A 3ZCCA 3X2QB 3SYAA 3RYFA 1D5NA 1V54B 2ADPA 2HLDG 3FD9A 1N8RW 4JI4O 3RT3C 3CSXA 5LGNA 4I50B 4GZRB 1AP5A 4R6ZA 1F4NA 1TUBA 4ZBMA 2F23A 2QA4V 2OCCB 1YJWV 3DC6A 3ABUA 2DYSC 5H6QA 3CC7V 1Q81W 3J7AU 1K4CC 2XAJA 1H2KA 4JTDB 3A2FA 4CBCA 2YSUB 2HJDA 1SETA 1OCCC 4MVRA 3J80N 5JJJB 1B6QA 3IJ4A 4UCSA 2W6JG 1SQFA 2JGDA 5LMNB 4IL6Z 1FXKB 2ZNJA 2O57A 5LA6B 1IX9A 2ZDIC 1SZTA 1PNLA 3TCUA 3CB2A 5JH7B 3OUSA 3CCUV 1LUVA 2LW7A 4ZOLA 3B09A 2IH1C 3ZMTA 4B3TB 1ORQC 2F93B 1MZEA 2DQ0A 4G2KA 4I4TB 1YF2A 2H8PC 1H38A 3K5NA 3G4SV 2LJ2A 2ZM6O 4X1YA 3BCCH 3JAWA 3HKDB 5LHGA 2ZXWB 2FKXA 1MABG 5LGTA 1BCCH 1SF9A 4GX1A 4KFMA 3OR7C 2ZR2A 4I9QA 3OEHG 5L3EA 3G67A 2BE3A 2QKAA 2LGQA 4YY3O 4LCUC 4J42A 2QDOA 1YEWA 2YUAA 1FJGB 4DV3O 3WG7B 2QTOA 1W0KG 3T4ZA 1Z2GA 1BE3H 3PJSK 4TV8A 2Q6AA 4JAVA 3UO3A 5EIBC 5EK0A 1Y74B 2GUZA 4W4KA 2DE0X 4I9WA 3BRCA 1W0JG 2M7WA 5J2TB 1SC5B 4J9YB 1N34O 3F5WC 2E76B 2K1EA 4J41A 3W7UA 5IYCO 2LW1A 1P84F 1YI2V 4R50A 4XBFA 3QNEA 1BHBA 2EINC 4JAAA 2OIEA 3F7VC 3ABKC 5L3CA 5EC2C 1FS0G 5C93A 5IWAB 1NVPB 2JJ2G 3E8GA 2EZPA 2FB5A 5BMVB 4OPHA 5KHHA 2UUCB 2E75B 5FNVB 4F6EA 3HR0A 1Q82W 3WB0A 2IU0A 3JSNA 4FVMA 4O4LB 1W2BU 4YJ2B 4ABMA 3N2GA 3ETDA 2EX3A 5CB4A 2CTPA 3E35A 2UUAO 3BVOA 1R3JC 3LDEA 5JQGA 1XMOO 2NN4A 4B08A 2VQFO 1Y67A 4H37A 1CPYA 3ETGA 3CCLV 2Q68A 4PHZA 4WBNB 2W6IG 5LP6B 3CCEV 1FFXA 4DO2A 4LFCB 3L74H 3CRRA 5A9GA 1VQ4V 1S0VA 1WA8A 3CCMV 2DYRC 1SRYA 2PUSA 2Q4PA 3JD1A 1EZJA 1R6TA 3HKCB 3UQ8A 1QR8A 2Y4UA 3KZIZ 1H5WA 1AJPA 3SPIA 5IJ9B 1AJNA 1ZTEA 4MTFA 2UUBB 3FB6C 4KHPB 5EBLC 3ML0A 2DMXA 2WPDG 3AG3B 1HW7A 4NKGB 1VQOV 4P30A 1A32A 4JI8B 2ZIOA 1AI6A 3QTCA 3MHSC 3DGEA 1GN4A 3SPJA 4X66O 5E79Z 5BY1A 1KYOF 3SDLA 2WA4A 1Y6XA 1OZ0A 4GX5A 5ITZB 2HFEC 1HNWO 4DR3B 4OGQB 1PP9H 1NBMG 2QE7G 1P7GA 4AI8A 1TA8A 1G8MA 4C7UA 1AB3A 2WLJA 4HBNA 1L8DA 1Q43A 3D36A 4O4JB 4JI3B 2N05A 3OTFA 1D5AA 2JK5C 3LSQA 4W4LA 3GB7C 4HNAA 4PA4A 3O65A 1K34A 4DW0A 5KA6A 5B1BC 2Z3YA 2KB1A 5DM6V 4LF6B 3HKBB 1WNSA 2Z5UA 2BTOA 5EZYB 3NR7A 1H2NA 1AP6A 1AI4A 4LNUA 1VQ9V 2JS5A 2A9HA 3ZMZA 3LNMB 3EVKA 1QBZA 2FMLA 1SA0B 4U7OA 1P7BA 1K8AW 4IT5A 3LSSA 4Z2WA 4DV1B 4DR2B 4J7KA 4ZKIA 3CC2V 3AK1A 3CPWU 2JJ1G 5CA1A 2XAGA 5LYJA 3CMAV 2ZT9B 2YS8A 4NVPA 3BA8A 4DR5O 1X59A 1DGSA 1N32B 3ZN0A 1R3KC 1S5JA 5B3SB 4LF9O 2X6AA 4JTCB 4ZHQB 1H2GA 4HZ3A 4TUYA 3KDRA 1K33A 3G80A 2BTQB 2PYLA 3AK2A 2UXCO 3EFFK 4JI1O 4I0XA 2AZ0A 1Y76A 4I55B 3UT5B 3B40A 3FB7C 4YIPA 3QO7A 1H2MA 2VWJA 1OCZC 1S5HC 3OD4A 3Q4HB 1NR1A 4DUZB 3JCZA 2PZSA 1O9GA 1GO3F 1Q5OA 3SYPA 5LMUB 4X20B 2Q0OC 1DK1A 2HHHO 3DC5A 2KSDA 1QU7A 1XL6A 3ZS8C 3IFXA 3OMAB 3CC4V 4YHHB 5IYZB 2CTWA 5CMUA 4PELA 3RWRD 5HFLA 2BSKB 1CEZA 4I50A 4D6TH 4FLWA 4CH5A 1ROPA 1IBMB 2WA3A 1RSOA 3CX5F 4DV0O 3VQVA 1S5LZ 2G38A 4JPRA 5IJ0B 4LWSB 4JI5O 3E8FA 3CYOA 3KCXA 4X1IB 5EYPA 2YXLA 3S3XA 4EFEA 4B7EA 2XUMA 4YJ3B 4UCUA 3ZN1A 3H1IH 1SQGA 2P4VA 5LGUA 1YTFD 1XILA 4MS2A 4ZIBA 2EIKC 5LA6A 1IVSA 3D36C 4JI0B 3RYCB 2UXDB 1YJ9V 1WAZA 4H44B 4BW9A 1SKVA 1SQVH 3ZHVA 3ETQA 1JNBA 1BL8A 1OCRB 4Z1VA 4RQFA 1E79G 4B3SO 2QM4A 4EEQA 1N33O 2F4VO 1YTFB 1OHHG 4PJ0Z 3QO5A 2EZOA 3ZMVA 3ZHRA 5HFMA 5GONA 2HEPA 1NTMH 3HKDA 4LFAO 1R3IC 3STLC 4MVUA 4O4HA 3SJAC 1T5EA 3U0ZA 3W7SA 1NH2D 3A0RA 3I5DA 3JATB 3N2KA 3JAKA 4O2AA 3CJHB 4PDRA 2PI4A 3TXSA 2WLLA 2YIBA 4EB6B 3W7XA 2JEUA 4HAMA 2RQ6A 1GTOA 2OTJV 4PD4F 1M57C 1NH2B 1PNKA 5IY5B 1B04A 2MW2B 1QHTA 4P9OA 2CK3G 3JSLA 4CZZA 4ZI7A 4GLXA 4LH6A 3KCYA 2B1IA 1NS1A 3I55V 2AHZA 1HNZB 2MK3A 4FLXA 2A79B 2QWOB 3P30A 4UCTA 2Q67A 3QVNA 2ITCC 2A3QA 1DF5A 5EC1C 2UXNA 1V55B 5CA0B 4IHJA 4LF8B 2EIMB 4DYLA 4DV7B 2UUAB 4JYAO 1WP8A 2P90A 1KUQA 4DV6B 2OCCC 3CS5A 1ZUQA 2QWRB 3M99B 2CE4A 4DR7B 1Q6IA 4AILC 5IYBO 5EBWC 1BHAA 4IIJA 1NQTA 3FYEB 2QKSA 3ABLC 3BHPA 3LDCA 3W7WA 1XMQB 4KL1A 4JV5O 1MOFA 1HR0B 1BQ0A 3SYQA 5IYDO 2YEVB 3ASNB 4NTYA 1GM7A 4NTWA 1Q3EA 1N4CA 1RPOA 1YSCA 4K3AA 2YC0A 4PA7A 4AHCA 3ZHTA 3E22B 4FM2A 2JRIA 3ABMB 1PL0A 1TVKB 1IXMA 2XOKG 5FL7G 1SQBH 2CUGA 3CXCU 4PV1B 2ZINA 1IBKB 4NXMB 4X1KB 2OCHA 2IU3A 3OAAG 5AG2A 2P22C 3A0BZ 3BY6A 1WB7A 3N27A 3S3WA 5LXTA 1GMGA 3WB2A 3AG4B 4H0LB 2EBOA 1G4YB 3VQXA 2W0XA 4FFBA 5DECA 2VRZA 1JMKC 1AI5A 1Q6HA 2F95B 1JR9A 4K8ZA 5KHIA 1K5QA 3FAVB 4MT8A 2EILC 3OMIB 1YZBA 4FLTA 2YI9A 4PDLA 5H6RA 4X65B 4OX9O 1HNXO 4DV4B 2GV9A 4LFBO 2WAMA 3BFRA 1MSDA 3RYIB 2VWKA 2K9PA 1RM1C 4U3JA 5ITZA 3CEIA 2HJFC 3H1LH 3CMEV 1QQCA 4H33A 2LO1A 2UU9O 2F1MA 2WLIA 4K0KO 4BAYA 1CP9A 5E1AC 5H5NA 5BR8O 4DV2O 1VQ5V 1GM9A 3M8AA 1SQXH 3OTOB 4TV9A 3JAMN 1N36O 4LF7O 4DXWA 1QVGU 1H8EG 1R1BA 4U7NA 1Q8IA 4DUYO 2DYSB 5LOVA 3JD0A 3HKBA 3JARB 1OCCB 4LF5B 2DWEC 1KQSU 3ZHQA 3HPLC 1IJGA 4L87A 2XAHA 5GW7A 2XASA 4JI2B 3B8MA 5CBFA 4JI1B 1AVMA 3K04A 4QE9A 4X64O 4WFEA 1YCIA 2XAFA 2IH3C 4JI7B 3F7YC 3L70H 4JTAB 2PI5A 4MW3A 4X62O 4A5UB 1E1RG 3CCJV 3QG5A 4PA9A 1FPOA 5B1AC 1O9HA 1D2DA 1BSMA 2HHHB 1WPXA 1HWYA 2L35A 4NXNB 4WFAV 4AQYB 4UCOA 2IM9A 1XNRO 2ZE7A 4UVAA 1Z5WA 2DJVA 2LGWA 1YHQV 1ENVA 4TQDA 2QGNA 1R6NA 1G6UA 2VQEB 1NU1H 4O4IA 5EIBD 4GCZA 1MSWD 3L72H 4J7ZA 4G27B 1VQMV 5FPOA 1ZSPA 4FPPA 1OCOC 3E83A 1IBLO 3MDSA 1VQPV 5B5EZ 2YDEA 1I7FA 1M56C 1TUEB 2QM8A 3OR6C 3ZHSA 3HKEB 3AG3C 1IXBA 1Q86W 3MAQA 1I94B 2PYJA 3G71V 1P4RA 1I5YA 2QTSA 4MVOA 3G6EV 1J5EO 4J80A 4U3FH 3SPCA 3DSQA 3NXSA 2CH7A 2IJIA 4IYIA 4B3RB 3T1HB 4GUNA 3E8HA 3PN1A 4YJ3A 3RYHA 2FL4A 4HYOA 4DV5B 4B3SB 3UCSC 4GKKO 3RYFB 3RN4A 1EM1A 3EHBB 4E4EA 4CC6A 4BR6A 2OTLV 1ZX3A 2P4KA 1JJ2U 4DR4O 1I0HA 1TUBB 3RYCA 1XI1A 4QE7A 4PDVA 1XREA 2LQTA 2Q73A 2ZE6A 1R6KA 1XBLA 1B3QA 2DN9A 4JZ2A 5CA3A 1GAXA 4JASA 2Q7HA 4BIZA 3SGIA 2WLMA 5KLVH 3KKYA 4RWUA 1W59A 4WF9V 2JGDB 1TAEA 1GK9A 2HVKC 2CTRA 3JYCA 1Q90D 3IC7A 4JI6B 3ZMSA 4UCRA 4GKJB 2M6YA 4FFKA 1YITV 5BXZA 5B66Z 2EJ7A 4ZOLB 1Z5VA 1FXVA 1JX9A 4NYKA 3FFQA 4B7KA 4EB6A 5KA5A 1F23A 1J95A 1QVFU 4EKWA 4JGSA 2QR4A 3DXRA 3RW0A 2DYRB 2KQXA 4X1YB 3JAWB 1SQQH 1IZ3A 4LR3A 2B5UA 2XHBA 2QM7A 1M4UA 3MD0A 5KX5A 3WB1A 4DR6B 1JQ0A 4CC5A 5BZBA 1KMIZ 1WN7A 4P2ZA 1SQPH 1SS3A 4B3TO 1VF5B 2KG7A 3T1YB 3TK1A 3ZX6A 4CH6A 1THZA 1WP7A 4B3MB 2UXBO 3JALA 2YICA 3ZRWB 1X4TA 4KP4A 2E3CA 3OT7A 4JF3A 4Q20A 3CCRV 5CA0A 1EN6A 3ZBHA 1JPXA 4TV8B 1HP8A 1GM8A 3BPZA 4WFHA 1Y66A 3AG7A 4DR1B 5J2UB 1VMGA 3D3IA 2GUZB 3LNNA 1XOUA 4UVBA 3K08A 2OWOA 1EZVH 1FJGO 4JI4B 5JVDA 3D8CA 4F6RA 5IT9N 2YEVA 3KG2A 2EIJC 3T2MA 3K06A 4LF4O 5KMGA 3APOA 1LNQA 5KHGA 3K5LA 4UB6Z 3JASB 2P7TC 4PI2A 2JGUA 3H9VA 2YIDA 4UVCA 1N0JA 4BIOA 4K8XA 1OCRC 2P67A 1JVMA 4X1KA 3N2GB 5CB4B 1QLEC 3AG2B 4FJCC 5IWAO 2BCCH 4UUJC 5JQGB 1K4DC 3ICXA 2B9ZA 2BOBC 2UUCO 2AGAA 2IJJA 2QSAA 3H1JH 3CHXA 2LP7A 4X89A 1AR5A 4DRXB 4CS3A 1IDSA 1MZFA 4E2LA 3AG1C 4TQFA 1FXKA 2ZM6B 1FFXB 4LP8A 4UCVA 3RVZA 2ODMA 3K0DA 2ZQMA 5LHIA 3ZHUA 1WA8B 3FKSG 1VP7A 3O9OA 5F2VO 5JH7A 1S76D 1N0NA 2GSMB 3RYIA 4NB5A 1OCZB 3ZRVA 3OW2U 1E1QG 4UV8A 3CWBH 3CRQA 1N36B 2IJKA 4CH4A 2XTAA 4I4TA 1GRJA 2NNUA 3IAYA 2XNDG 4PA6A 4YY3B 4UFZA 4LFCO 2ITDC 4DV3B 2CTQA 1F4MA 4R8CA 1RPRA 2IBZH 4MW8A 1DTOA 1ZWIC 1XNQO 5KAIZ 1SZXA 1I08A 3SPHA 1YXBA 3C3TA 4R7CA 2AZ2A 1N34B 4D7SA 1RFYA 2UUBO 4GX2A 4KHPO 3JARA 2IJHA 1LR1A 4JI8O 1H2LA 2Q7GA 3T4DA 2GBOA 1K73W 3ASOC 4FMTA 1KC8W 1KBHA 1M90W 2EIKB 5H9CA 5JWPA 1K9MW 3OUFA 1Y74A 1I5XA 3FB8C 2V1DA 4GX0A 4KXRA 5J2TA 4HNAB 3ASNC 4DR3O 2A0LA 2B1GA 4J7JA 2JDIG 4G28B 3CD6V 1ZL8B 4DK0A 3L73H 3H1HH 2Q8VA 2ILMA 3OMNB 3ZEDA 2W0FC 3X2QC 4LNUB 5GTIZ 1V54C 2V7QG 3TETA 2AHYA 1GN2A 4JI3O 3ETEA 2ZIMA 1NTZH 2ADQB 5BMVA 1MG1A 2ZE5A 4J9ZB 2Y69B 3E89A 2JEXA 1XMOB 3RFRA 4XDJA 1PM9A 4TT3G 2VQFB 5FNVA 4BIUA 4MTGA 5CA1B 4LBEC 2QJ1A 4O2BB 1K92A 3JCUZ 3C3SA 1R73A 1VQ8V 4MVMA 4O4LA 3ZIAG 5B1NA 4YJ2A 2ZNIA 2RDCA 2PF4E 2VS0A 2QKCA 2ATKC 4TUYB 3K9SA 1M57B 2JIZG 3OM3B 5CN0A 1FXKC 5C8YB 2ZKOA 4DK1A 4I0XB 4DV1O 1H8HG 1Y76B 2JS3A 4DR2O 4X88A 4YXWG 3JD2A 3I56V 3CCVV 3ABTA 2A7WA 2YI8A 1K7DA 1VF7A 5L3FA 3LUTB 4WBNA 1AROP 5LP6A 1VEWA 3BA9A 3M7MX 1FXHA 2HR3A 5H2FZ 4QJFB 1N32O 3IC9A 1EBOA 1L0NH 3CRMA 3QF7A 5KAFZ 2YXHA 4FM1A 3T1CA 2DQ3A 3E8BA 4BW5A 2ZXWC 4X66B 4LC1A 3CRCA 3CXHF 5D5PA 3HKCA 4UB8Z 2FTKA 1FKAO 2C2AA 3A8TA 3K5OA 5KHJA 3CRAA 1G1XB 2XAQA 3ZRXA 5IJ9A 4P9PA 4MSWC 3HB3B 4DUZO 2R70A 2D3OW 2PTMA 1HNWB 1RSOB 5LMUO 2Y0PA 3L9DA 1EN4A 5EYPB 1PL4A 3AK3A 3ABLB 1AR1B 1ZLZA 3LSUA 4YHHO 2QWQB 3WG7C 1AJQA 4MTOA 1S77D 4FLZA 1KB9F 3FYIB 4RAIA 1IBMO 3AEIA 3VQWA 3K03A 2GHYA 4MVZA 1US6A 1BZKA 4OXSA 2AW9A 1GH6A 4Z1MG 4BWAA 4O4JA 4JAUA 4JYYA 2ZR3A 2E5LO 4FM0A 2UXBB 2YIBD 2ZD9A 5GONB 1OJHA 4JI0O 3QO8A 4O4HB 2X6BA 3WU2Z 2UXDO 2ETNA 1FAFA 5EZYA 3CCSV 1JFFB 2P5OA 2RCVA 4PI0A 2X0LA 3TGUH 5L3BA 4DR5B 1VARA 2QEXV 2WSSG 3N2KB 3JAKB 4O2AB 2RMKB 4LF9B 2EILB 4LH7A 1SA0A 2WLLB 3B77A 2UXCB 4X9QA 3TJTA 1SERA 4Q6GA 3ZRWA 3L75H 1DLBA 3STZC 5FLXN 3U10A 3GWOA 1BGYH 1QNMA 2KKWA 1RM1B 5K1XA 4LF4B 1UPGA 4ZI7B 2CDYA 3K59A 5J2UA 3K58A 1XHZA 4ZHQA 2Y48A 2E74B 4JYCA 5LP6C 2BTQA 1NVPD 3W7TA 3RBZA 3U11A 1WB8A 1NJIW 4I55A 3UT5A 2Q9LA 3GVMA 1PKXA 5L3GA 3TXQA 1F51A 4JZGA 1L0LH 4F4LA 1U97A 4IHJB 4XDKA 1FYJA 4DW1A 3Q4HA 5B1OA 3SYCA 5A2QN 2EJRA 4N21A 3DTUB 4X20A 4DV0B 3J81N 4IYHA 4JI5B 4QPKA 3OGCC 1HNZO 3JASA 3K3WA 2RNBA 2BOCC 4NTXA 5IYZA 1AR4A 3P32A 3VBBA 2WLNA 4IIJB 3E86A 2BSKA 4LF8O 4TSFG 1K3EA 4DV7O 1GN3A 5IE9A 3APQA 4GT1A 5IJ0A 3L71H 5JCOA 4LWSA 1FD9A 4X1IA 4DV6O 1K97A 4QIWF 1Q6UA 2EINB 5B1AB 4DR7O 4DRXA 1N33B 2F4VB 1GN6A 2DWDC 2AXTZ 2X7RB 3ABKB 2DOSA 1QLNA 3JD4A 2H3OA 1XMQO 3R66A 2WLKA 1AILA 1HR0O 1XQ8A 4LFAB 3OGIB 4FLVA 2Q0AA 2GTSA 5LHHA 4RUFA 3K57A 1KU9A
chains in the Genus database with same CATH topology
1XUQA 3QVNA 1QNMA 1Y67A 1B06A 3BFRA 1MSDA 1AP6A 1LUWA 4FFKA 1MNGA 1N0JA 4YIOA 1MMMA 1XILA 2CDYA 3EVKA 3CEIA 2QKAA 1ZSPA 5A9GA 1WB8A 3MDSA 1EN4A 1PL4A 1ZUQA 3AK1A 1IXBA 3AK3A 2CE4A 1D5NA 4JZGA 1ZLZA 2ADPA 3LSUA 1KKCA 1BS3A 1AR5A 1IDSA 2GDSA 1AP5A 1GN2A 1ZTEA 2ADQB 3KDRA 3DC6A 3AK2A 1EN5A 1MA1A 4GUNA 1PM9A 3OT7A 2AW9A 1N0NA 4YIPA 1AR4A 1GN4A 1JA8A 1EN6A 3C3SA 3RN4A 1EM1A 4E4EA 4BR6A 4JYYA 2P4KA 1GN3A 1I0HA 2QKCA 5AG2A 1XREA 1AVMA 1XDCA 3K9SA 3DC5A 1WB7A 1IX9A 1P7GA 2RCVA 4F6EA 4JZ2A 4C7UA 1VARA 1LUVA 1GN6A 1SZXA 1I08A 1VEWA 3KKYA 1BSMA 1BT8A 3IC9A 1JR9A 3C3TA 4X9QA 3TJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XUQ A;  3QVN A;  1QNM A;  1Y67 A;  1B06 A;  3BFR A;  1MSD A;  1AP6 A;  1LUW A;  4FFK A;  1MNG A;  1N0J A;  4YIO A;  1MMM A;  1XIL A;  2CDY A;  3EVK A;  3CEI A;  2QKA A;  1ZSP A;  5A9G A;  1WB8 A;  3MDS A;  1EN4 A;  1PL4 A;  1ZUQ A;  3AK1 A;  1IXB A;  3AK3 A;  2CE4 A;  1D5N A;  4JZG A;  1ZLZ A;  2ADP A;  3LSU A;  1KKC A;  1BS3 A;  1AR5 A;  1IDS A;  2GDS A;  1AP5 A;  1GN2 A;  1ZTE A;  2ADQ B;  3DC6 A;  3AK2 A;  1EN5 A;  1MA1 A;  4GUN A;  1PM9 A;  3OT7 A;  2AW9 A;  1N0N A;  4YIP A;  1AR4 A;  1GN4 A;  1JA8 A;  1EN6 A;  3C3S A;  3RN4 A;  1EM1 A;  4E4E A;  4BR6 A;  4JYY A;  2P4K A;  1GN3 A;  1I0H A;  2QKC A;  5AG2 A;  1XRE A;  1AVM A;  1XDC A;  3K9S A;  3DC5 A;  1WB7 A;  1IX9 A;  1P7G A;  2RCV A;  4F6E A;  4JZ2 A;  4C7U A;  1VAR A;  1LUV A;  1GN6 A;  1SZX A;  1I08 A;  1VEW A;  3KKY A;  1BSM A;  1BT8 A;  3IC9 A;  1JR9 A;  3C3T A;  4X9Q A;  3TJT A; 
#chains in the Genus database with same CATH topology
 5CBG A;  5FPR A;  1YJN V;  3LDD A;  2LFR A;  5LXT B;  4FLU A;  1GKF A;  2HKO A;  3B2E E;  1XNQ B;  4EFB A;  1M1K W;  4K35 A;  4FFB B;  2F43 G;  3B8N A;  5KHK A;  5EBM C;  1OCO B;  3H01 A;  5LBQ A;  1M56 B;  1IBK O;  4NXM O;  2V4D A;  1VF6 A;  2FYU H;  1PD3 A;  3SPG A;  1V9P A;  5JJE B;  4WFB V;  3JAT A;  1KKC A;  3CJH A;  3BAA A;  4U3J B;  4CH3 A;  1PNM A;  1BQZ A;  5LMN O;  4I7Z B;  5B3S C;  1KKD A;  1EN5 A;  1VQ6 V;  3H1K H;  1Q7Y W;  1KD1 W;  2WLI B;  4X65 O;  3THO A;  4DV4 O;  1VQL V;  2CGN A;  4J10 A;  1VQ7 V;  1XL4 A;  1COW G;  4TV9 B;  3ZJZ A;  3K9A A;  4JYA B;  1H2S B;  3OEE G;  4WFF A;  3BAB A;  1M9N A;  1QCE A;  1KP3 A;  1XDC A;  5LOV B;  1ZL8 A;  2YIA A;  2NR5 A;  2QWP B;  4H13 B;  2HVJ C;  2XT9 A;  1BMF G;  2RJZ A;  3OE7 G;  3MHH C;  4JV5 B;  2Y4T A;  1NR7 A;  5IDJ A;  3OTO O;  3EXA A;  1BT8 A;  2F66 C;  2OIG A;  1WPB A;  1NZ6 A;  1XUQ A;  3AG2 C;  5JCO C;  1Y4M A;  3ZRS A;  4QNH B;  4O2B A;  3WFV A;  3UO2 A;  4QPJ A;  4LF5 O;  1MNG A;  4MVQ A;  2HP8 A;  3K79 A;  5D5Q A;  4MVS A;  1ZAU A;  4JI2 O;  5B1B B;  5C8Y A;  3C90 A;  5TIS Z;  2X6C A;  2Q5Z A;  2N04 A;  1KEC A;  3E22 A;  4WFG A;  1YVW A;  3RGB A;  2HG5 C;  1QR9 A;  4RO2 A;  1BS3 A;  1TVK A;  2YXY A;  4JI7 O;  1FOU A;  2P6J A;  2GDS A;  3SJC C;  4O4I B;  2D2C B;  5K1P A;  4X8A A;  1YIJ V;  1JJO A;  1TGO A;  4NXN O;  1KP2 A;  1VIB A;  1PV0 A;  4AQY O;  4OX9 B;  2JVD A;  1NI8 A;  4MTX A;  1HNX B;  4LFB B;  2EUL A;  4UV9 A;  4CS2 A;  3GWK C;  1YDX A;  1VF6 C;  1NKD A;  3VOU A;  1XEQ A;  1JA8 A;  3CCQ V;  3P3N A;  1EFR G;  3SJQ C;  1OV9 A;  3F5T A;  2GTA A;  2OT5 A;  4UXN A;  5J9P C;  3R65 A;  2VQE O;  3SYO A;  3JD3 A;  3FAV A;  4L8J A;  3BEH A;  2Q69 A;  2CH7 B;  2IW5 A;  2UU9 B;  5DED A;  4WCE V;  3FX7 A;  1NTK H;  4ASU G;  4K0K B;  2A06 H;  3RYH B;  2Y0I A;  5BR8 B;  4DV2 B;  2EIJ B;  2ZCE A;  1I94 O;  3A0H Z;  5IY5 C;  4LF7 B;  2E5L B;  2OYQ A;  2CAZ C;  3G6B A;  5GTH Z;  4DUY B;  4TOI A;  1VQK V;  2WWW A;  4FZ0 A;  2PY5 A;  1FFT B;  2WLH A;  2ARH A;  4FLY A;  2UXX A;  3UKM A;  4B3R O;  3SR2 C;  4PA3 A;  3T1H O;  1P49 A;  1B06 A;  4DV5 O;  5LL6 Y;  3RVY A;  3VQY A;  2P06 A;  4QGP A;  3ZMU A;  1PPJ H;  1WLE A;  1MMM A;  1S3J A;  3E2E A;  1V55 C;  4CS4 A;  3FB5 C;  1QLE B;  3CP1 A;  2EIM C;  2CGO A;  1M93 A;  2H94 A;  4D7T A;  1K5S A;  4X64 B;  5CBH A;  2N74 A;  1JFF A;  2Y69 C;  1L1F A;  2ZE8 A;  2Z0A A;  2QWN B;  2R72 A;  2R9R B;  3CE2 A;  4X62 B;  4TWK A;  3AG1 B;  4FZ1 A;  2PGG A;  2R9A A;  1SES A;  2RN9 A;  3OFN G;  5L3D A;  2ZDI A;  4ICG A;  3B4S A;  1XNR B;  1VQN V;  3DXR B;  3P3P A;  1MA1 A;  1XHX A;  4JI6 O;  1RP3 B;  3K5M A;  5KUK A;  1AI7 A;  2DW4 A;  4J11 A;  1M5I A;  3SJB C;  1F7Y A;  4GKJ O;  5KX5 B;  1UFI A;  4NR1 A;  2NLJ C;  3ABM C;  4JYB A;  2L6L A;  1UJW B;  2KG7 B;  1IBL B;  1JCH A;  3K0G A;  1WJZ A;  1HDJ A;  4FIP C;  3JAL B;  4LF6 O;  5LYJ B;  4RUE A;  5DN6 G;  5KUM A;  3AG4 C;  3D3Q A;  4DR6 O;  4FK5 C;  1J5E B;  1DF4 A;  4IGG A;  1IUR A;  1JOY A;  4KUM A;  3T1Y O;  4B3M O;  1U96 A;  3HKE A;  4PDM A;  4GKK B;  3ASO B;  1NT2 B;  1S72 V;  1LUW A;  4OPA A;  1CXZ B;  2R9I A;  4YIO A;  5JVD B;  2LFS A;  4F6R B;  4RQE A;  1URF A;  4DR4 B;  2Q7E A;  5KMG B;  3IGA C;  4GYC B;  4DR1 O;  4XDL A;  5JJN B;  1R3L C;  4I5S A;  4N23 A;  3UM7 A;  3ZCC A;  3X2Q B;  3SYA A;  3RYF A;  1D5N A;  1V54 B;  2ADP A;  2HLD G;  3FD9 A;  1N8R W;  4JI4 O;  3RT3 C;  3CSX A;  5LGN A;  4I50 B;  4GZR B;  1AP5 A;  4R6Z A;  1F4N A;  1TUB A;  4ZBM A;  2F23 A;  2QA4 V;  2OCC B;  1YJW V;  3DC6 A;  3ABU A;  2DYS C;  5H6Q A;  3CC7 V;  1Q81 W;  3J7A U;  1K4C C;  2XAJ A;  1H2K A;  4JTD B;  3A2F A;  4CBC A;  2YSU B;  2HJD A;  1SET A;  1OCC C;  4MVR A;  3J80 N;  5JJJ B;  1B6Q A;  3IJ4 A;  4UCS A;  2W6J G;  1SQF A;  2JGD A;  5LMN B;  4IL6 Z;  1FXK B;  2ZNJ A;  2O57 A;  5LA6 B;  1IX9 A;  2ZDI C;  1SZT A;  1PNL A;  3TCU A;  3CB2 A;  5JH7 B;  3OUS A;  3CCU V;  1LUV A;  2LW7 A;  4ZOL A;  3B09 A;  2IH1 C;  3ZMT A;  4B3T B;  1ORQ C;  2F93 B;  1MZE A;  2DQ0 A;  4G2K A;  4I4T B;  1YF2 A;  2H8P C;  1H38 A;  3K5N A;  3G4S V;  2LJ2 A;  2ZM6 O;  4X1Y A;  3BCC H;  3JAW A;  3HKD B;  5LHG A;  2ZXW B;  2FKX A;  1MAB G;  5LGT A;  1BCC H;  1SF9 A;  4GX1 A;  4KFM A;  3OR7 C;  2ZR2 A;  4I9Q A;  3OEH G;  5L3E A;  3G67 A;  2BE3 A;  2QKA A;  2LGQ A;  4YY3 O;  4LCU C;  4J42 A;  2QDO A;  1YEW A;  2YUA A;  1FJG B;  4DV3 O;  3WG7 B;  2QTO A;  1W0K G;  3T4Z A;  1Z2G A;  1BE3 H;  3PJS K;  4TV8 A;  2Q6A A;  4JAV A;  3UO3 A;  5EIB C;  5EK0 A;  1Y74 B;  2GUZ A;  4W4K A;  2DE0 X;  4I9W A;  3BRC A;  1W0J G;  2M7W A;  5J2T B;  1SC5 B;  4J9Y B;  1N34 O;  3F5W C;  2E76 B;  2K1E A;  4J41 A;  3W7U A;  5IYC O;  2LW1 A;  1P84 F;  1YI2 V;  4R50 A;  4XBF A;  3QNE A;  1BHB A;  2EIN C;  4JAA A;  2OIE A;  3F7V C;  3ABK C;  5L3C A;  5EC2 C;  1FS0 G;  5C93 A;  5IWA B;  1NVP B;  2JJ2 G;  3E8G A;  2EZP A;  2FB5 A;  5BMV B;  4OPH A;  5KHH A;  2UUC B;  2E75 B;  5FNV B;  4F6E A;  3HR0 A;  1Q82 W;  3WB0 A;  2IU0 A;  3JSN A;  4FVM A;  4O4L B;  1W2B U;  4YJ2 B;  4ABM A;  3N2G A;  3ETD A;  2EX3 A;  5CB4 A;  2CTP A;  3E35 A;  2UUA O;  3BVO A;  1R3J C;  3LDE A;  5JQG A;  1XMO O;  2NN4 A;  4B08 A;  2VQF O;  1Y67 A;  4H37 A;  1CPY A;  3ETG A;  3CCL V;  2Q68 A;  4PHZ A;  4WBN B;  2W6I G;  5LP6 B;  3CCE V;  1FFX A;  4DO2 A;  4LFC B;  3L74 H;  3CRR A;  5A9G A;  1VQ4 V;  1S0V A;  1WA8 A;  3CCM V;  2DYR C;  1SRY A;  2PUS A;  2Q4P A;  3JD1 A;  1EZJ A;  1R6T A;  3HKC B;  3UQ8 A;  1QR8 A;  2Y4U A;  3KZI Z;  1H5W A;  1AJP A;  3SPI A;  5IJ9 B;  1AJN A;  1ZTE A;  4MTF A;  2UUB B;  3FB6 C;  4KHP B;  5EBL C;  3ML0 A;  2DMX A;  2WPD G;  3AG3 B;  1HW7 A;  4NKG B;  1VQO V;  4P30 A;  1A32 A;  4JI8 B;  2ZIO A;  1AI6 A;  3QTC A;  3MHS C;  3DGE A;  1GN4 A;  3SPJ A;  4X66 O;  5E79 Z;  5BY1 A;  1KYO F;  3SDL A;  2WA4 A;  1Y6X A;  1OZ0 A;  4GX5 A;  5ITZ B;  2HFE C;  1HNW O;  4DR3 B;  4OGQ B;  1PP9 H;  1NBM G;  2QE7 G;  1P7G A;  4AI8 A;  1TA8 A;  1G8M A;  4C7U A;  1AB3 A;  2WLJ A;  4HBN A;  1L8D A;  1Q43 A;  3D36 A;  4O4J B;  4JI3 B;  2N05 A;  3OTF A;  1D5A A;  2JK5 C;  3LSQ A;  4W4L A;  3GB7 C;  4HNA A;  4PA4 A;  3O65 A;  1K34 A;  4DW0 A;  5KA6 A;  5B1B C;  2Z3Y A;  2KB1 A;  5DM6 V;  4LF6 B;  3HKB B;  1WNS A;  2Z5U A;  2BTO A;  5EZY B;  3NR7 A;  1H2N A;  1AP6 A;  1AI4 A;  4LNU A;  1VQ9 V;  2JS5 A;  2A9H A;  3ZMZ A;  3LNM B;  3EVK A;  1QBZ A;  2FML A;  1SA0 B;  4U7O A;  1P7B A;  1K8A W;  4IT5 A;  3LSS A;  4Z2W A;  4DV1 B;  4DR2 B;  4J7K A;  4ZKI A;  3CC2 V;  3AK1 A;  3CPW U;  2JJ1 G;  5CA1 A;  2XAG A;  5LYJ A;  3CMA V;  2ZT9 B;  2YS8 A;  4NVP A;  3BA8 A;  4DR5 O;  1X59 A;  1DGS A;  1N32 B;  3ZN0 A;  1R3K C;  1S5J A;  5B3S B;  4LF9 O;  2X6A A;  4JTC B;  4ZHQ B;  1H2G A;  4HZ3 A;  4TUY A;  3KDR A;  1K33 A;  3G80 A;  2BTQ B;  2PYL A;  3AK2 A;  2UXC O;  3EFF K;  4JI1 O;  4I0X A;  2AZ0 A;  1Y76 A;  4I55 B;  3UT5 B;  3B40 A;  3FB7 C;  4YIP A;  3QO7 A;  1H2M A;  2VWJ A;  1OCZ C;  1S5H C;  3OD4 A;  3Q4H B;  1NR1 A;  4DUZ B;  3JCZ A;  2PZS A;  1O9G A;  1GO3 F;  1Q5O A;  3SYP A;  5LMU B;  4X20 B;  2Q0O C;  1DK1 A;  2HHH O;  3DC5 A;  2KSD A;  1QU7 A;  1XL6 A;  3ZS8 C;  3IFX A;  3OMA B;  3CC4 V;  4YHH B;  5IYZ B;  2CTW A;  5CMU A;  4PEL A;  3RWR D;  5HFL A;  2BSK B;  1CEZ A;  4I50 A;  4D6T H;  4FLW A;  4CH5 A;  1ROP A;  1IBM B;  2WA3 A;  1RSO A;  3CX5 F;  4DV0 O;  3VQV A;  1S5L Z;  2G38 A;  4JPR A;  5IJ0 B;  4LWS B;  4JI5 O;  3E8F A;  3CYO A;  3KCX A;  4X1I B;  5EYP A;  2YXL A;  3S3X A;  4EFE A;  4B7E A;  2XUM A;  4YJ3 B;  4UCU A;  3ZN1 A;  3H1I H;  1SQG A;  2P4V A;  5LGU A;  1YTF D;  1XIL A;  4MS2 A;  4ZIB A;  2EIK C;  5LA6 A;  1IVS A;  3D36 C;  4JI0 B;  3RYC B;  2UXD B;  1YJ9 V;  1WAZ A;  4H44 B;  4BW9 A;  1SKV A;  1SQV H;  3ZHV A;  3ETQ A;  1JNB A;  1BL8 A;  1OCR B;  4Z1V A;  4RQF A;  1E79 G;  4B3S O;  2QM4 A;  4EEQ A;  1N33 O;  2F4V O;  1YTF B;  1OHH G;  4PJ0 Z;  3QO5 A;  2EZO A;  3ZMV A;  3ZHR A;  5HFM A;  5GON A;  2HEP A;  1NTM H;  3HKD A;  4LFA O;  1R3I C;  3STL C;  4MVU A;  4O4H A;  3SJA C;  1T5E A;  3U0Z A;  3W7S A;  1NH2 D;  3A0R A;  3I5D A;  3JAT B;  3N2K A;  3JAK A;  4O2A A;  3CJH B;  4PDR A;  2PI4 A;  3TXS A;  2WLL A;  2YIB A;  4EB6 B;  3W7X A;  2JEU A;  4HAM A;  2RQ6 A;  1GTO A;  2OTJ V;  4PD4 F;  1M57 C;  1NH2 B;  1PNK A;  5IY5 B;  1B04 A;  2MW2 B;  1QHT A;  4P9O A;  2CK3 G;  3JSL A;  4CZZ A;  4ZI7 A;  4GLX A;  4LH6 A;  3KCY A;  2B1I A;  1NS1 A;  3I55 V;  2AHZ A;  1HNZ B;  2MK3 A;  4FLX A;  2A79 B;  2QWO B;  3P30 A;  4UCT A;  2Q67 A;  3QVN A;  2ITC C;  2A3Q A;  1DF5 A;  5EC1 C;  2UXN A;  1V55 B;  5CA0 B;  4IHJ A;  4LF8 B;  2EIM B;  4DYL A;  4DV7 B;  2UUA B;  4JYA O;  1WP8 A;  2P90 A;  1KUQ A;  4DV6 B;  2OCC C;  3CS5 A;  1ZUQ A;  2QWR B;  3M99 B;  2CE4 A;  4DR7 B;  1Q6I A;  4AIL C;  5IYB O;  5EBW C;  1BHA A;  4IIJ A;  1NQT A;  3FYE B;  2QKS A;  3ABL C;  3BHP A;  3LDC A;  3W7W A;  1XMQ B;  4KL1 A;  4JV5 O;  1MOF A;  1HR0 B;  1BQ0 A;  3SYQ A;  5IYD O;  2YEV B;  3ASN B;  4NTY A;  1GM7 A;  4NTW A;  1Q3E A;  1N4C A;  1RPO A;  1YSC A;  4K3A A;  2YC0 A;  4PA7 A;  4AHC A;  3ZHT A;  3E22 B;  4FM2 A;  2JRI A;  3ABM B;  1PL0 A;  1TVK B;  1IXM A;  2XOK G;  5FL7 G;  1SQB H;  2CUG A;  3CXC U;  4PV1 B;  2ZIN A;  1IBK B;  4NXM B;  4X1K B;  2OCH A;  2IU3 A;  3OAA G;  5AG2 A;  2P22 C;  3A0B Z;  3BY6 A;  1WB7 A;  3N27 A;  3S3W A;  5LXT A;  1GMG A;  3WB2 A;  3AG4 B;  4H0L B;  2EBO A;  1G4Y B;  3VQX A;  2W0X A;  4FFB A;  5DEC A;  2VRZ A;  1JMK C;  1AI5 A;  1Q6H A;  2F95 B;  1JR9 A;  4K8Z A;  5KHI A;  1K5Q A;  3FAV B;  4MT8 A;  2EIL C;  3OMI B;  1YZB A;  4FLT A;  2YI9 A;  4PDL A;  5H6R A;  4X65 B;  4OX9 O;  1HNX O;  4DV4 B;  2GV9 A;  4LFB O;  2WAM A;  3BFR A;  1MSD A;  3RYI B;  2VWK A;  2K9P A;  1RM1 C;  4U3J A;  5ITZ A;  3CEI A;  2HJF C;  3H1L H;  3CME V;  1QQC A;  4H33 A;  2LO1 A;  2UU9 O;  2F1M A;  2WLI A;  4K0K O;  4BAY A;  1CP9 A;  5E1A C;  5H5N A;  5BR8 O;  4DV2 O;  1VQ5 V;  1GM9 A;  3M8A A;  1SQX H;  3OTO B;  4TV9 A;  3JAM N;  1N36 O;  4LF7 O;  4DXW A;  1QVG U;  1H8E G;  1R1B A;  4U7N A;  1Q8I A;  4DUY O;  2DYS B;  5LOV A;  3JD0 A;  3HKB A;  3JAR B;  1OCC B;  4LF5 B;  2DWE C;  1KQS U;  3ZHQ A;  3HPL C;  1IJG A;  4L87 A;  2XAH A;  5GW7 A;  2XAS A;  4JI2 B;  3B8M A;  5CBF A;  4JI1 B;  1AVM A;  3K04 A;  4QE9 A;  4X64 O;  4WFE A;  1YCI A;  2XAF A;  2IH3 C;  4JI7 B;  3F7Y C;  3L70 H;  4JTA B;  2PI5 A;  4MW3 A;  4X62 O;  4A5U B;  1E1R G;  3CCJ V;  3QG5 A;  4PA9 A;  1FPO A;  5B1A C;  1O9H A;  1D2D A;  1BSM A;  2HHH B;  1WPX A;  1HWY A;  2L35 A;  4NXN B;  4WFA V;  4AQY B;  4UCO A;  2IM9 A;  1XNR O;  2ZE7 A;  4UVA A;  1Z5W A;  2DJV A;  2LGW A;  1YHQ V;  1ENV A;  4TQD A;  2QGN A;  1R6N A;  1G6U A;  2VQE B;  1NU1 H;  4O4I A;  5EIB D;  4GCZ A;  1MSW D;  3L72 H;  4J7Z A;  4G27 B;  1VQM V;  5FPO A;  1ZSP A;  4FPP A;  1OCO C;  3E83 A;  1IBL O;  3MDS A;  1VQP V;  5B5E Z;  2YDE A;  1I7F A;  1M56 C;  1TUE B;  2QM8 A;  3OR6 C;  3ZHS A;  3HKE B;  3AG3 C;  1IXB A;  1Q86 W;  3MAQ A;  1I94 B;  2PYJ A;  3G71 V;  1P4R A;  1I5Y A;  2QTS A;  4MVO A;  3G6E V;  1J5E O;  4J80 A;  4U3F H;  3SPC A;  3DSQ A;  3NXS A;  2CH7 A;  2IJI A;  4IYI A;  4B3R B;  3T1H B;  4GUN A;  3E8H A;  3PN1 A;  4YJ3 A;  3RYH A;  2FL4 A;  4HYO A;  4DV5 B;  4B3S B;  3UCS C;  4GKK O;  3RYF B;  3RN4 A;  1EM1 A;  3EHB B;  4E4E A;  4CC6 A;  4BR6 A;  2OTL V;  1ZX3 A;  2P4K A;  1JJ2 U;  4DR4 O;  1I0H A;  1TUB B;  3RYC A;  1XI1 A;  4QE7 A;  4PDV A;  1XRE A;  2LQT A;  2Q73 A;  2ZE6 A;  1R6K A;  1XBL A;  1B3Q A;  2DN9 A;  4JZ2 A;  5CA3 A;  1GAX A;  4JAS A;  2Q7H A;  4BIZ A;  3SGI A;  2WLM A;  5KLV H;  3KKY A;  4RWU A;  1W59 A;  4WF9 V;  2JGD B;  1TAE A;  1GK9 A;  2HVK C;  2CTR A;  3JYC A;  1Q90 D;  3IC7 A;  4JI6 B;  3ZMS A;  4UCR A;  4GKJ B;  2M6Y A;  4FFK A;  1YIT V;  5BXZ A;  5B66 Z;  2EJ7 A;  4ZOL B;  1Z5V A;  1FXV A;  1JX9 A;  4NYK A;  3FFQ A;  4B7K A;  4EB6 A;  5KA5 A;  1F23 A;  1J95 A;  1QVF U;  4EKW A;  4JGS A;  2QR4 A;  3DXR A;  3RW0 A;  2DYR B;  2KQX A;  4X1Y B;  3JAW B;  1SQQ H;  1IZ3 A;  4LR3 A;  2B5U A;  2XHB A;  2QM7 A;  1M4U A;  3MD0 A;  5KX5 A;  3WB1 A;  4DR6 B;  1JQ0 A;  4CC5 A;  5BZB A;  1KMI Z;  1WN7 A;  4P2Z A;  1SQP H;  1SS3 A;  4B3T O;  1VF5 B;  2KG7 A;  3T1Y B;  3TK1 A;  3ZX6 A;  4CH6 A;  1THZ A;  1WP7 A;  4B3M B;  2UXB O;  3JAL A;  2YIC A;  3ZRW B;  1X4T A;  4KP4 A;  2E3C A;  3OT7 A;  4JF3 A;  4Q20 A;  3CCR V;  5CA0 A;  1EN6 A;  3ZBH A;  1JPX A;  4TV8 B;  1HP8 A;  1GM8 A;  3BPZ A;  4WFH A;  1Y66 A;  3AG7 A;  4DR1 B;  5J2U B;  1VMG A;  3D3I A;  2GUZ B;  3LNN A;  1XOU A;  4UVB A;  3K08 A;  2OWO A;  1EZV H;  1FJG O;  4JI4 B;  5JVD A;  3D8C A;  4F6R A;  5IT9 N;  2YEV A;  3KG2 A;  2EIJ C;  3T2M A;  3K06 A;  4LF4 O;  5KMG A;  3APO A;  1LNQ A;  5KHG A;  3K5L A;  4UB6 Z;  3JAS B;  2P7T C;  4PI2 A;  2JGU A;  3H9V A;  2YID A;  4UVC A;  1N0J A;  4BIO A;  4K8X A;  1OCR C;  2P67 A;  1JVM A;  4X1K A;  3N2G B;  5CB4 B;  1QLE C;  3AG2 B;  4FJC C;  5IWA O;  2BCC H;  4UUJ C;  5JQG B;  1K4D C;  3ICX A;  2B9Z A;  2BOB C;  2UUC O;  2AGA A;  2IJJ A;  2QSA A;  3H1J H;  3CHX A;  2LP7 A;  4X89 A;  1AR5 A;  4DRX B;  4CS3 A;  1IDS A;  1MZF A;  4E2L A;  3AG1 C;  4TQF A;  1FXK A;  2ZM6 B;  1FFX B;  4LP8 A;  4UCV A;  3RVZ A;  2ODM A;  3K0D A;  2ZQM A;  5LHI A;  3ZHU A;  1WA8 B;  3FKS G;  1VP7 A;  3O9O A;  5F2V O;  5JH7 A;  1S76 D;  1N0N A;  2GSM B;  3RYI A;  4NB5 A;  1OCZ B;  3ZRV A;  3OW2 U;  1E1Q G;  4UV8 A;  3CWB H;  3CRQ A;  1N36 B;  2IJK A;  4CH4 A;  2XTA A;  4I4T A;  1GRJ A;  2NNU A;  3IAY A;  2XND G;  4PA6 A;  4YY3 B;  4UFZ A;  4LFC O;  2ITD C;  4DV3 B;  2CTQ A;  1F4M A;  4R8C A;  1RPR A;  2IBZ H;  4MW8 A;  1DTO A;  1ZWI C;  1XNQ O;  5KAI Z;  1SZX A;  1I08 A;  3SPH A;  1YXB A;  3C3T A;  4R7C A;  2AZ2 A;  1N34 B;  4D7S A;  1RFY A;  2UUB O;  4GX2 A;  4KHP O;  3JAR A;  2IJH A;  1LR1 A;  4JI8 O;  1H2L A;  2Q7G A;  3T4D A;  2GBO A;  1K73 W;  3ASO C;  4FMT A;  1KC8 W;  1KBH A;  1M90 W;  2EIK B;  5H9C A;  5JWP A;  1K9M W;  3OUF A;  1Y74 A;  1I5X A;  3FB8 C;  2V1D A;  4GX0 A;  4KXR A;  5J2T A;  4HNA B;  3ASN C;  4DR3 O;  2A0L A;  2B1G A;  4J7J A;  2JDI G;  4G28 B;  3CD6 V;  1ZL8 B;  4DK0 A;  3L73 H;  3H1H H;  2Q8V A;  2ILM A;  3OMN B;  3ZED A;  2W0F C;  3X2Q C;  4LNU B;  5GTI Z;  1V54 C;  2V7Q G;  3TET A;  2AHY A;  1GN2 A;  4JI3 O;  3ETE A;  2ZIM A;  1NTZ H;  2ADQ B;  5BMV A;  1MG1 A;  2ZE5 A;  4J9Z B;  2Y69 B;  3E89 A;  2JEX A;  1XMO B;  3RFR A;  4XDJ A;  1PM9 A;  4TT3 G;  2VQF B;  5FNV A;  4BIU A;  4MTG A;  5CA1 B;  4LBE C;  2QJ1 A;  4O2B B;  1K92 A;  3JCU Z;  3C3S A;  1R73 A;  1VQ8 V;  4MVM A;  4O4L A;  3ZIA G;  5B1N A;  4YJ2 A;  2ZNI A;  2RDC A;  2PF4 E;  2VS0 A;  2QKC A;  2ATK C;  4TUY B;  3K9S A;  1M57 B;  2JIZ G;  3OM3 B;  5CN0 A;  1FXK C;  5C8Y B;  2ZKO A;  4DK1 A;  4I0X B;  4DV1 O;  1H8H G;  1Y76 B;  2JS3 A;  4DR2 O;  4X88 A;  4YXW G;  3JD2 A;  3I56 V;  3CCV V;  3ABT A;  2A7W A;  2YI8 A;  1K7D A;  1VF7 A;  5L3F A;  3LUT B;  4WBN A;  1ARO P;  5LP6 A;  1VEW A;  3BA9 A;  3M7M X;  1FXH A;  2HR3 A;  5H2F Z;  4QJF B;  1N32 O;  3IC9 A;  1EBO A;  1L0N H;  3CRM A;  3QF7 A;  5KAF Z;  2YXH A;  4FM1 A;  3T1C A;  2DQ3 A;  3E8B A;  4BW5 A;  2ZXW C;  4X66 B;  4LC1 A;  3CRC A;  3CXH F;  5D5P A;  3HKC A;  4UB8 Z;  2FTK A;  1FKA O;  2C2A A;  3A8T A;  3K5O A;  5KHJ A;  3CRA A;  1G1X B;  2XAQ A;  3ZRX A;  5IJ9 A;  4P9P A;  4MSW C;  3HB3 B;  4DUZ O;  2R70 A;  2D3O W;  2PTM A;  1HNW B;  1RSO B;  5LMU O;  2Y0P A;  3L9D A;  1EN4 A;  5EYP B;  1PL4 A;  3AK3 A;  3ABL B;  1AR1 B;  1ZLZ A;  3LSU A;  4YHH O;  2QWQ B;  3WG7 C;  1AJQ A;  4MTO A;  1S77 D;  4FLZ A;  1KB9 F;  3FYI B;  4RAI A;  1IBM O;  3AEI A;  3VQW A;  3K03 A;  2GHY A;  4MVZ A;  1US6 A;  1BZK A;  4OXS A;  2AW9 A;  1GH6 A;  4Z1M G;  4BWA A;  4O4J A;  4JAU A;  4JYY A;  2ZR3 A;  2E5L O;  4FM0 A;  2UXB B;  2YIB D;  2ZD9 A;  5GON B;  1OJH A;  4JI0 O;  3QO8 A;  4O4H B;  2X6B A;  3WU2 Z;  2UXD O;  2ETN A;  1FAF A;  5EZY A;  3CCS V;  1JFF B;  2P5O A;  2RCV A;  4PI0 A;  2X0L A;  3TGU H;  5L3B A;  4DR5 B;  1VAR A;  2QEX V;  2WSS G;  3N2K B;  3JAK B;  4O2A B;  2RMK B;  4LF9 B;  2EIL B;  4LH7 A;  1SA0 A;  2WLL B;  3B77 A;  2UXC B;  4X9Q A;  3TJT A;  1SER A;  4Q6G A;  3ZRW A;  3L75 H;  1DLB A;  3STZ C;  5FLX N;  3U10 A;  3GWO A;  1BGY H;  1QNM A;  2KKW A;  1RM1 B;  5K1X A;  4LF4 B;  1UPG A;  4ZI7 B;  2CDY A;  3K59 A;  5J2U A;  3K58 A;  1XHZ A;  4ZHQ A;  2Y48 A;  2E74 B;  4JYC A;  5LP6 C;  2BTQ A;  1NVP D;  3W7T A;  3RBZ A;  3U11 A;  1WB8 A;  1NJI W;  4I55 A;  3UT5 A;  2Q9L A;  3GVM A;  1PKX A;  5L3G A;  3TXQ A;  1F51 A;  4JZG A;  1L0L H;  4F4L A;  1U97 A;  4IHJ B;  4XDK A;  1FYJ A;  4DW1 A;  3Q4H A;  5B1O A;  3SYC A;  5A2Q N;  2EJR A;  4N21 A;  3DTU B;  4X20 A;  4DV0 B;  3J81 N;  4IYH A;  4JI5 B;  4QPK A;  3OGC C;  1HNZ O;  3JAS A;  3K3W A;  2RNB A;  2BOC C;  4NTX A;  5IYZ A;  1AR4 A;  3P32 A;  3VBB A;  2WLN A;  4IIJ B;  3E86 A;  2BSK A;  4LF8 O;  4TSF G;  1K3E A;  4DV7 O;  1GN3 A;  5IE9 A;  3APQ A;  4GT1 A;  5IJ0 A;  3L71 H;  5JCO A;  4LWS A;  1FD9 A;  4X1I A;  4DV6 O;  1K97 A;  4QIW F;  1Q6U A;  2EIN B;  5B1A B;  4DR7 O;  4DRX A;  1N33 B;  2F4V B;  1GN6 A;  2DWD C;  2AXT Z;  2X7R B;  3ABK B;  2DOS A;  1QLN A;  3JD4 A;  2H3O A;  1XMQ O;  3R66 A;  2WLK A;  1AIL A;  1HR0 O;  1XQ8 A;  4LFA B;  3OGI B;  4FLV A;  2Q0A A;  2GTS A;  5LHH A;  4RUF A;  3K57 A;  1KU9 A; 
#chains in the Genus database with same CATH homology
 1XUQ A;  3QVN A;  1QNM A;  1Y67 A;  1B06 A;  3BFR A;  1MSD A;  1AP6 A;  1LUW A;  4FFK A;  1MNG A;  1N0J A;  4YIO A;  1MMM A;  1XIL A;  2CDY A;  3EVK A;  3CEI A;  2QKA A;  1ZSP A;  5A9G A;  1WB8 A;  3MDS A;  1EN4 A;  1PL4 A;  1ZUQ A;  3AK1 A;  1IXB A;  3AK3 A;  2CE4 A;  1D5N A;  4JZG A;  1ZLZ A;  2ADP A;  3LSU A;  1KKC A;  1BS3 A;  1AR5 A;  1IDS A;  2GDS A;  1AP5 A;  1GN2 A;  1ZTE A;  2ADQ B;  3KDR A;  3DC6 A;  3AK2 A;  1EN5 A;  1MA1 A;  4GUN A;  1PM9 A;  3OT7 A;  2AW9 A;  1N0N A;  4YIP A;  1AR4 A;  1GN4 A;  1JA8 A;  1EN6 A;  3C3S A;  3RN4 A;  1EM1 A;  4E4E A;  4BR6 A;  4JYY A;  2P4K A;  1GN3 A;  1I0H A;  2QKC A;  5AG2 A;  1XRE A;  1AVM A;  1XDC A;  3K9S A;  3DC5 A;  1WB7 A;  1IX9 A;  1P7G A;  2RCV A;  4F6E A;  4JZ2 A;  4C7U A;  1VAR A;  1LUV A;  1GN6 A;  1SZX A;  1I08 A;  1VEW A;  3KKY A;  1BSM A;  1BT8 A;  3IC9 A;  1JR9 A;  3C3T A;  4X9Q A;  3TJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...