2QKAA

Structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKANGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and kinetic study of differences between human and Escherichia coli manganese superoxide dismutases.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 71
structure length 196
sequence length 196
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2qkaA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2qkaA02
2QKAA 1GN4A 1N0NA 1Y67A 1XUQA 1AP5A 1I0HA 1LUVA 1PL4A 3TJTA 1QNMA 1IXBA 2RCVA 1AR4A 1IDSA 4FFKA 1JR9A 1ZLZA 3BFRA 3C3SA 1JA8A 1GN3A 1B06A 3AK1A 1AR5A 1BT8A 2CDYA 3CEIA 2ADPA 4GUNA 3DC6A 4E4EA 1MSDA 1VEWA 3K9SA 1XILA 1ZTEA 1I08A 3KKYA 1MA1A 5AG2A 3DC5A 4BR6A 1SZXA 3MDSA 4YIPA 4JYYA 2ADQB 3AK3A 5A9GA 1GN2A 1MNGA 1AVMA 1BSMA 2AW9A 1KKCA 3QVNA 1WB7A 4X9QA 4YIOA 1D5NA 2GDSA 1LUWA 1EN6A 2P4KA 2CE4A 1VARA 1P7GA 1XDCA 1ZSPA 4JZ2A 1AP6A 3OT7A 4JZGA 1IX9A 1GN6A 1EM1A 1BS3A 3EVKA 1MMMA 2QKCA 1EN5A 1EN4A 1XREA 4F6EA 3LSUA 1ZUQA 3IC9A 1WB8A 1PM9A 1N0JA 3RN4A 4C7UA 3AK2A 3C3TA
chains in the Genus database with same CATH superfamily
2DYSB 3W7TA 4UVAA 1R73A 4JAAA 1XQ8A 4BIUA 1SRYA 1X4TA 4BIOA 3M7MX 4OXSA 1I5XA 4KUMA 2X7RB 2Q73A 1J5EO 3OAAG 4O4IA 2ZR2A 2WLKA 3NR7A 3W7SA 5EK0A 3SPCA 2XOKG 4DK1A 4JI3B 4LFAB 1UPGA 4FM2A 3DTUB 3HKDB 4UCRA 4JI7O 2ETNA 3ZMUA 4DV6O 3JSLA 3KCYA 4FM0A 4H33A 3U10A 1TA8A 2DWEC 5JCOC 3OMAB 4GUNA 1OV9A 3DC6A 4J42A 2FKXA 2Q4PA 1A32A 3JARB 4XDJA 3FKSG 4UCUA 4O4JB 3GWOA 1SQVH 1B6QA 3RYIB 2JS5A 4NTWA 1FKAO 4I0XB 1P84F 4MTGA 4TT3G 2Q0AA 1AJQA 1RM1B 3K9AA 3QNEA 4B7KA 1EN6A 1ENVA 5L3GA 1BHBA 1PNMA 1H8EG 4JI6O 1GAXA 1ZX3A 4GKJO 4B08A 4X66B 1H2SB 2PTMA 3ZMVA 1OHHG 4E2LA 4AQYO 2QKCA 4X62B 1GO3F 4LF6B 3LDCA 3LNNA 3ZRWA 2ZE5A 1PKXA 2IM9A 4RQEA 4FLXA 4NR1A 4WFFA 3C3TA 2W6IG 3CRCA 3CHXA 2IH3C 2UXBO 3H1KH 1AP5A 4J7JA 3SR2C 3HKCA 4MW3A 3ABKC 1KU9A 1MZEA 3WU2Z 4NTYA 5CBGA 3Q4HB 4JTDB 1EZJA 4K8ZA 2YIDA 1NJIW 1S3JA 2B9ZA 4IGGA 1H38A 3BA9A 1IDSA 3HKEA 1W0JG 4DR6B 4R50A 1HNXO 2PY5A 2GV9A 1RSOB 3WB2A 1OCZB 4ZBMA 1OCRC 1Z5WA 4E4EA 2A79B 1KP3A 4GX1A 1S5JA 4UFZA 1IXMA 5EBLC 2ZD9A 5FLXN 5CBFA 5CA3A 3RVZA 2DQ0A 4B7EA 1SZXA 4B3SB 3TXQA 4PA7A 1Q82W 3FB7C 4JI1B 3ABMB 3IAYA 2KSDA 4JAUA 1R3JC 5JWPA 1K34A 1I7FA 2AW9A 4A5UB 2HJFC 3AG3B 3UT5A 5IYCO 3OMNB 2VWKA 1VARA 1HW7A 4JV5O 3CJHA 3WFVA 3ETEA 1HNWB 1XNQO 3ETQA 4WFEA 4LC1A 3GVMA 3FAVB 3E8BA 2N74A 5K1PA 1MMMA 3QF7A 1RPRA 1P49A 1GM7A 4X64O 3FAVA 5E1AC 3A0RA 1FXKA 5LBQA 2R72A 2ITCC 4G28B 1IURA 4LBEC 4X20A 2ZXWB 3X2QB 2XAJA 5KLVH 2UXCO 2UUCB 4PI0A 4DUYB 3E8GA 4I7ZB 1FS0G 4AI8A 1RPOA 4X1KB 2AGAA 3TK1A 3L70H 4FLZA 4DR1O 1AJNA 3MD0A 5LHHA 3JAWA 3ABUA 4O4LB 1Y76B 1K9MW 2XUMA 4LWSA 1NR1A 4DV3O 3IC7A 1IJGA 1P4RA 3BABA 3D36C 1WA8A 5LGTA 2AHZA 5CA0A 3RGBA 1Y74B 1K5SA 1ZL8A 1YITV 3JSNA 5LOVA 2PYJA 2CTWA 1IBKB 3CXHF 2OCCB 2YI8A 4BIZA 1AI7A 1K4DC 4TWKA 5J9PC 1OCCC 3DC5A 1WP8A 1WPXA 3MDSA 1NTKH 4HBNA 4WBNB 1NQTA 4UB6Z 4PHZA 2GSMB 2F4VB 1XL4A 3R65A 3THOA 4X89A 4I4TB 4JYBA 3CCVV 4DV4B 2JJ2G 5KX5A 5IT9N 2G38A 1U96A 3P30A 2RDCA 5FNVA 3D3IA 1PD3A 1XNRO 3O65A 3ZJZA 2DYRC 1L8DA 2Y4UA 1XMOO 1G6UA 2YIBA 3JASB 1SESA 4JI2O 3UO3A 1QLEB 1Y66A 5H6QA 4ABMA 2UUBO 1XREA 3JASA 1IVSA 4HAMA 3E22A 4KXRA 2BSKB 1ZUQA 1VF5B 1AB3A 4B3MO 3ZMSA 2E74B 3B2EE 2QWOB 3ABLC 1NBMG 3N2GB 5J2UB 3CS5A 4UCSA 5BZBA 2R9RB 1Y67A 4N23A 1YDXA 1V9PA 2FMLA 1DGSA 2DW4A 1GH6A 1KUQA 4J9ZB 2OIGA 2QM8A 1BZKA 4DV7B 4G2KA 5KHIA 2OYQA 3L73H 2E76B 1GTOA 2W6JG 3CYOA 1OJHA 2HG5C 3E83A 4ZHQB 2DJVA 3B4SA 1J95A 2ZXWC 4KFMA 1BE3H 4JTCB 2PYLA 1S76D 1SQGA 1VEWA 2CTQA 1NS1A 2WLIB 4X62O 1K8AW 4LF6O 1ZWIC 4JI3O 4LFAO 3OEEG 2ZINA 1Q6IA 3H1JH 2OCHA 3T2MA 3D8CA 5CA1B 3ZHVA 1N4CA 1JOYA 1WB7A 3K5MA 3LUTB 4O2BB 4P9OA 5B1OA 1HWYA 1R3IC 4UVCA 1NKDA 1X59A 2Q8VA 3OT7A 1WPBA 3OM3B 1GRJA 4UB8Z 3CCEV 2LP7A 1GN6A 4GX0A 2EJ7A 1EM1A 1B3QA 4DV0B 1EN5A 5LMUB 4GKKO 2IJJA 2VQEB 5J2TB 1BQ0A 4NXMB 1HNXB 1F7YA 1R1BA 4GCZA 4FMTA 3CRRA 2QDOA 4ICGA 2XT9A 2JJ1G 2FL4A 1O9GA 5F2VO 1SQQH 5FL7G 4B3MB 4CBCA 1I0HA 1F51A 4DR6O 5LP6B 1JFFB 5GONA 3ASOB 4U7NA 5JVDA 4B3TB 3K58A 4I55B 4CC5A 1VQOV 1NH2D 2ILMA 1JCHA 2RQ6A 2D3OW 1VQ8V 1GN3A 4FIPC 5CB4B 4O2AB 4QIWF 1BT8A 1E1QG 4FFBA 1HDJA 4I5SA 3JCZA 2ADPA 3OD4A 4JI1O 3T4DA 1GM9A 2IJHA 3QG5A 4NTXA 3H9VA 3OFNG 4FLVA 1XI1A 2YEVB 4DR2O 1I94O 2QE7G 1SS3A 1XOUA 3RT3C 1M56B 2FTKA 2EIJC 2YEVA 5DEDA 1GN2A 4QPJA 1K92A 4MSWC 4FLYA 5C8YA 3QVNA 3BPZA 5B3SB 4JI4O 4DUYO 1LUWA 3K3WA 1IBLB 4LF8B 1SZTA 1P7GA 5KHKA 1PL0A 2N05A 4EFBA 3JD4A 3SPHA 2QTOA 5HFMA 2ATKC 1YZBA 1V55C 4IT5A 4CH4A 3FYIB 3AG7A 1LNQA 3P3NA 2X6AA 4TQDA 1J5EB 3TCUA 3ZHRA 1GN4A 3KCXA 1QHTA 2RN9A 2CTPA 4P30A 2GHYA 3ABKB 3VQXA 5IJ9A 1IBKO 4X8AA 4DV3B 3TETA 1KQSU 4K0KB 1KC8W 2V1DA 1IZ3A 1CXZB 4LP8A 4JASA 3E89A 1OCOB 4PDLA 2Q6AA 1WLEA 4NXNO 4J41A 2Y4TA 3JAWB 2VQEO 1YTFB 2F1MA 3C3SA 2BE3A 2DYSC 3SJBC 1F23A 1HP8A 3ZCCA 4PA4A 4DRXB 2F66C 2A9HA 4J9YB 2PZSA 1AILA 2ZIMA 4EB6B 1JPXA 3SPIA 2ZNJA 2Q7GA 4ZOLB 1VQPV 4DV5B 1SQFA 1HR0O 3CRMA 2YICA 3ZRWB 2CAZC 4WFHA 1Q8IA 5LOVB 3CD6V 1MA1A 1N36B 1H2LA 5LMNO 3FB6C 1KP2A 4CH3A 1YJ9V 2BTQB 3N27A 3SPGA 1XMQB 2UUAO 1MG1A 2CH7A 3KDRA 2F93B 3JCUZ 2EINB 2CH7B 3SPJA 1US6A 4FZ0A 4CH5A 5TISZ 4LR3A 5LGNA 3AG2C 5GONB 4DR5O 4FM1A 1FOUA 4X65B 3A2FA 1S5HC 5JH7B 4QE9A 4PDMA 4CS2A 2V7QG 2EZOA 1SA0B 5IWAB 2NNUA 4TV8B 5LP6C 4DV7O 1IBLO 1R6KA 4MVMA 1TVKB 1YF2A 4LF8O 1K7DA 1S0VA 2EIKB 2VQFB 5LYJB 1JMKC 2GUZA 1KBHA 3JAMN 5D5QA 5H9CA 4DUZO 2LQTA 3RYFA 5IJ0A 4UUJC 2P22C 4F6RA 1URFA 5IY5C 2JGDB 4TUYB 4DV4O 3E86A 1OCRB 5J2UA 2IBZH 4FPPA 2YS8A 2WA3A 4QJFB 2QSAA 3F5TA 4UV9A 3G6BA 4FZ1A 4LF7B 4ASUG 4IIJA 4U3JA 4K8XA 1KKDA 3ABTA 2NN4A 2IJKA 2JRIA 3K5NA 4D7SA 3CX5F 1K4CC 2CGOA 5KUKA 4MVSA 4FFKA 3K5LA 3A8TA 2P5OA 3ETGA 2FYUH 1AI4A 3C90A 3CP1A 3RYCB 5LHGA 1DTOA 1BL8A 1FPOA 5DM6V 4ZIBA 3HKBB 2QM7A 1XHXA 3M99B 2DOSA 3TGUH 4CC6A 1OZ0A 1JNBA 2PGGA 4JYYA 2Y48A 3MAQA 4YY3B 4NXMO 2W0FC 4J7KA 5KMGA 4DV1B 1YVWA 1NH2B 3VOUA 4JAVA 4NB5A 5JQGB 5IYDO 3BHPA 4I9QA 1BGYH 2UUAB 2P4KA 2P7TC 3RYIA 2L6LA 1FD9A 2XAGA 1N34B 3OUSA 5C93A 1QVGU 2M7WA 3RWRD 4JZGA 4P9PA 1K73W 5B1AB 2ZT9B 1H2KA 2UUCO 2JVDA 5LMNB 5EC2C 4DRXA 4YJ2A 3T1CA 3JALB 1Z5VA 3JAKB 4JI0B 4GYCB 4MTFA 3H01A 4YJ2B 1PM9A 3U11A 5FPRA 1RM1C 5B1BC 5IE9A 1Y74A 1XUQA 1YCIA 3ZX6A 1QU7A 2Z5UA 1WJZA 3ZEDA 2Q68A 4CH6A 3TJTA 2W0XA 2PF4E 4DV0O 2YIAA 4TV9B 5LMUO 3J80N 4NKGB 3DSQA 1OCOC 1XEQA 1FYJA 4PA9A 1NTMH 3BFRA 4LF7O 2HR3A 5JH7A 1VQNV 2X6BA 4OGQB 4JI4B 1WAZA 1Q3EA 1HNZO 3NXSA 2E5LB 5CB4A 2K1EA 2ZDIA 5L3BA 3WG7B 4L87A 2JEXA 3DXRA 2BSKA 2P4VA 1JQ0A 3F7VC 2WLLA 3DXRB 3H1IH 2Q9LA 3FYEB 4YIPA 2WPDG 3JD1A 1MABG 2Q7HA 1YTFD 4G27B 5BXZA 2A7WA 4JI2B 5IY5B 5EIBD 2YIBD 3RFRA 4H37A 3KZIZ 4JZ2A 3CWBH 2RJZA 3K59A 3CCSV 4Z1MG 3AG4C 3SGIA 4PA3A 1NT2B 5EBWC 1L0LH 3SYCA 1VQ7V 4PA6A 4PDRA 4U7OA 4YHHB 1SQPH 4JI6B 2HEPA 4ZI7B 3WB0A 2EIMC 2B1GA 1NVPD 2OT5A 4MVUA 4IHJB 4YXWG 1M9NA 4ZKIA 1HR0B 5LXTA 2Q67A 2XTAA 3BAAA 4X20B 3E8HA 1FAFA 2RNBA 1RFYA 2XASA 1RSOA 3D36A 4UVBA 5JQGA 2ZR3A 2Y0IA 2QWQB 4L8JA 1ZLZA 4GLXA 5CA1A 3ASNC 4I50B 3CCMV 2DQ3A 3O9OA 5EYPB 4JF3A 1XBLA 2HP8A 3EFFK 3JD0A 1TGOA 2CTRA 4K3AA 3FFQA 4EFEA 1OCZC 4MVQA 3ZMTA 3OE7G 3KKYA 2Y69C 4CS4A 1ROPA 1CPYA 1S5LZ 1F4NA 2E3CA 3N2KB 3R66A 4DV2B 3X2QC 1PV0A 1MNGA 1S77D 5GW7A 3CCQV 2HVJC 4IL6Z 3HKDA 1DF5A 2EX3A 2IH1C 4DUZB 2IU3A 2UXNA 3OGIB 4LF9B 1N33B 4X9QA 2LJ2A 3CRAA 3OTOO 2EIKC 3I55V 5LP6A 1L0NH 4PDVA 2XAHA 3CMEV 5LA6A 3CSXA 1VQ9V 2E5LO 1MSWD 3F7YC 1AR1B 4IYIA 4Z2WA 1AP6A 3OR6C 3JD3A 1K97A 1I5YA 4LF4O 1IX9A 1U97A 3BRCA 1QLNA 2EINC 1KB9F 2P06A 2N04A 3LSQA 4I55A 2YSUB 4AILC 1PNLA 2JEUA 2CK3G 2LFSA 3RN4A 2WSSG 5BR8B 1LR1A 5B1BB 4X65O 2ZM6O 4UCTA 4YHHO 4MW8A 3B09A 1G4YB 2B1IA 1WA8B 2UXCB 5CA0B 2QGNA 4QGPA 2QA4V 1JJ2U 2O57A 5A2QN 1CEZA 3W7WA 2ZE7A 3B40A 4WCEV 3ASNB 1Q5OA 3SJCC 3CCLV 3BEHA 4MTXA 2JK5C 3E35A 3IGAC 1SF9A 3AK1A 1AR5A 4P2ZA 2OTLV 1YJNV 3L71H 1I94B 4YJ3A 3B8NA 5CN0A 2XHBA 1MSDA 4YJ3B 4GKJB 1N8RW 4PV1B 1GKFA 1FJGO 1WNSA 1GK9A 2R9AA 2P90A 4DR3O 4JYAB 5AG2A 4D7TA 1M57C 2ZCEA 1R3KC 4GX5A 5A9GA 4KHPB 2X0LA 1DK1A 1Y4MA 4PJ0Z 4X88A 4D6TH 3K5OA 3ICXA 3JARA 3W7UA 1H2MA 1VQ5V 1SQBH 4AQYB 4OX9O 2LGWA 1NU1H 4LFBO 4LNUA 2WWWA 1KD1W 2EJRA 1DLBA 2WA4A 1VQMV 4I0XA 2GTAA 2EILC 2Q69A 5H6RA 3OTOB 2Q7EA 1W2BU 2HVKC 1EN4A 2ZE6A 2R9IA 2IU0A 1Y76A 4J11A 3J81N 4GT1A 4DV2O 1XMOB 1WB8A 1Q6UA 1BCCH 2PI5A 1XHZA 2HKOA 4FLWA 2HHHB 4UCOA 1FXVA 1S72V 4JPRA 4MTOA 1M1KW 4OPAA 3SYQA 5JCOA 4CZZA 2FB5A 1PL4A 4ZHQA 2QKSA 1QBZA 1FFXA 4J7ZA 1TUBB 2RCVA 2YI9A 2ZM6B 1HNZB 5B66Z 4LH6A 2AZ2A 2NR5A 4JI0O 1TUBA 1JA8A 1M57B 4W4LA 3S3XA 3L9DA 1K5QA 4I4TA 5KX5B 1B04A 3L72H 3G6EV 5K1XA 3FX7A 5GTHZ 2QWPB 1E1RG 1QR8A 2EBOA 1MZFA 4RUFA 3RYHA 1VMGA 2IJIA 4O2BA 4X64B 1YI2V 4MS2A 2EILB 5LYJA 1VF6A 4JV5B 5KAIZ 3ZN1A 2KQXA 3VQYA 1BMFG 2WAMA 1AVMA 1Q6HA 3PJSK 5IWAO 3AEIA 2AHYA 1D5NA 3RYFB 3CMAV 1NI8A 4HNAA 1AI6A 2XNDG 2CE4A 2VQFO 4KHPO 5J2TA 3AG3C 3W7XA 4GZRB 4JI8O 3E2EA 1NTZH 3OEHG 1R3LC 5C8YB 2BTOA 1BS3A 1N32B 3HPLC 3K03A 1VP7A 3FD9A 3GWKC 4OX9B 1COWG 2A0LA 2ODMA 1GM8A 3IFXA 4LFBB 3FB8C 1D2DA 2QTSA 3P3PA 4QE7A 5IYZA 3IC9A 1YIJV 3U0ZA 5IYZB 4IYHA 1THZA 3UQ8A 5JVDB 3STLC 4BW9A 1TUEB 5EBMC 4HZ3A 3CC2V 3K0GA 3B77A 1KECA 3PN1A 1FXKB 3HR0A 3HKEB 5DN6G 2K9PA 5KHJA 3KG2A 2UXDB 4KL1A 4DR7O 3JD2A 2VRZA 2KG7B 2MW2B 2HHHO 3SJAC 3ETDA 2F23A 3CRQA 2KG7A 3E22B 4GKKB 3D3QA 5LGUA 1AR4A 3FB5C 2ZKOA 3T1YB 5KMGB 4U3FH 4FJCC 2V4DA 3VQVA 3A0BZ 4O4HA 3LDEA 3LNMB 2AXTZ 2YXHA 3CCUV 1F4MA 4UXNA 2WLHA 2Q0OC 2XAFA 4B3RO 4H13B 1XILA 2H8PC 2Z3YA 3ML0A 2DE0X 1PP9H 2OCCC 3BVOA 3K04A 2LO1A 1AJPA 3K79A 5JJJB 2Z0AA 3G4SV 3HB3B 4DYLA 4ZOLA 1IBMO 2XAQA 5LL6Y 1QQCA 2JIZG 1YSCA 4X1YB 2GDSA 2DMXA 3H1HH 4DR2B 2KKWA 2BTQA 2HJDA 4W4KA 1KMIZ 4RAIA 2YXLA 3VQWA 3MHSC 4WBNA 5BMVA 2RMKB 3ZRXA 5KHHA 1JFFA 1Y6XA 1V55B 3EVKA 4JI5B 4X1KA 2UU9B 1R6TA 1VQ6V 4FK5C 3LSUA 3OMIB 4JI8B 1OCCB 5BY1A 4C7UA 5HFLA 1FFTB 4I9WA 1N33O 3AK2A 1PPJH 1SQXH 2QKAA 4O4LA 2UXXA 1VIBA 4DO2A 2BOBC 3QO7A 4AHCA 5GTIZ 2OIEA 1AROP 3K0DA 1FJGB 1M90W 4TUYA 3S3WA 3EHBB 5EIBC 3K06A 3I5DA 1JR9A 4NYKA 4LH7A 1L1FA 2QJ1A 4Q6GA 2C2AA 2LW7A 3L75H 4N21A 1VF6C 3SDLA 1B06A 1YEWA 4DXWA 3ABMC 4DR3B 5BR8O 4WF9V 5B3SC 3DGEA 3STZC 1FXHA 1BQZA 3K57A 2E75B 2WLNA 1UFIA 1V54C 3P32A 1XL6A 3T4ZA 1PNKA 3AG1B 2R70A 4K0KO 2UXDO 4JGSA 5IDJA 1JX9A 5KAFZ 4MVOA 2AZ0A 5L3DA 3JYCA 5FNVB 1YHQV 3AK3A 3K08A 2PI4A 1FXKC 3HKBA 4QPKA 1K3EA 4DR4B 4ZI7A 2DN9A 2LW1A 3H1LH 4O2AA 4R7CA 3RVYA 4B3SO 1M93A 1NR7A 1XDCA 2EIMB 2ITDC 4B3RB 4RO2A 2DYRB 2JS3A 2LFRA 2DWDC 1H5WA 4F6RB 1Q90D 4DR5B 3M8AA 5KHGA 1NVPB 4JYAO 1N36O 4RWUA 4X1IA 5EYPA 1XNQB 4O4HB 4MVZA 1SC5B 1EBOA 4LFCO 4XDLA 1RP3B 4HYOA 2EULA 4CS3A 4DW0A 5JJNB 2UU9O 4B3TO 1M5IA 4PD4F 2VS0A 3CPWU 1Q7YW 4K35A 2HFEC 4O4IB 5L3EA 1Q86W 3SYAA 5ITZA 3ZHUA 3CJHB 4JI5O 2ZQMA 2YUAA 5ITZB 2CUGA 4MT8A 2QR4A 4FLTA 1FFXB 3GB7C 2A06H 1JVMA 2LGQA 3L74H 3ZHTA 5BMVB 2IW5A 3BY6A 3G67A 2CDYA 2KB1A 3A0HZ 2JGUA 1V54B 5IJ9B 3RBZA 5EZYA 3TXSA 4UV8A 4LF5B 3K9SA 1SA0A 4JI7B 1YXBA 3OTFA 3SYPA 2NLJC 1SKVA 1TVKA 3CE2A 4GX2A 4H44B 4TOIA 3ASOC 2OTJV 3ZRSA 4TSFG 1H2GA 2JDIG 1H8HG 3T1HB 4YIOA 4DV6B 1GMGA 2WLLB 1VQLV 1ZL8B 2Y69B 1ZAUA 1ZSPA 4DV1O 3EXAA 2ZIOA 1BHAA 1Z2GA 3CC7V 1XNRB 4DK0A 1T5EA 3MHHC 3UCSC 1W0KG 2F95B 2GTSA 3BA8A 5CMUA 4X66O 1SERA 2EIJB 3AG1C 3AG2B 1QR9A 4OPHA 2QWRB 2UUBB 4XBFA 3HKCB 1N0NA 2M6YA 1Q81W 5DECA 4FLUA 1ORQC 5L3FA 4NXNB 2GBOA 4RUEA 2ARHA 1QCEA 4BWAA 5EC1C 3UO2A 4WFBV 4PELA 4TQFA 1UJWB 1QNMA 5KUMA 3QTCA 1N32O 1K33A 4MVRA 2L35A 1XMQO 1G1XB 3CB2A 1IBMB 3ZRVA 2GUZB 4DV5O 1QVFU 4LNUB 4FVMA 3N2GA 1SETA 1O9HA 5H2FZ 2Y0PA 2JGDA 3APOA 4JYCA 3CEIA 1VQKV 3AG4B 4R8CA 2UXBB 1HNWO 3ZMZA 2WLJA 3IJ4A 4XDKA 3UM7A 1G8MA 3J7AU 1TAEA 1I08A 4DR7B 2BOCC 3UKMA 2HLDG 3WG7C 1E79G 1VQ4V 4BR6A 5B1NA 1W59A 3JAKA 3JALA 4KP4A 4LF5O 1Q43A 1M56C 1EZVH 3JATB 3CXCU 3T1YO 4JTAB 2ZNIA 1KKCA 3UT5B 2YDEA 3JATA 2H94A 2X6CA 3ZBHA 3APQA 3N2KA 2Q5ZA 4X1YA 2B5UA 3QO5A 2D2CB 2VWJA 2F43G 3VBBA 3I56V 1QLEC 4F6EA 4H0LB 2QWNB 5LXTB 1N0JA 4O4JA 3G71V 2WLIA 1CP9A 5EZYB 4RQFA 3T1HO 1D5AA 3QO8A 5KA6A 4EEQA 4BAYA 1NZ6A 4NVPA 4PI2A 1LUVA 5B1AC 2YXYA 2MK3A 3ZS8C 1WP7A 5E79Z 4I50A 1IXBA 1EFRG 3RYHB 4BW5A 4QNHB 5B5EZ 3CCRV 4EB6A 4LWSB 2P67A 4DW1A 4HNAB 2A3QA 3F5WC 4J10A 5L3CA 2CGNA 3SYOA 5IYBO 2EZPA 3BCCH 4IIJB 4U3JB 3ZHQA 4WFAV 5JJEB 2WLMA 3ZIAG 2OWOA 1MOFA 3OR7C 5FPOA 3LSSA 4YY3O 1YJWV 1N34O 3E8FA 3OW2U 3LDDA 3CCJV 2ZDIC 4LCUC 1ZTEA 4J80A 4DR1B 5D5PA 3SJQC 4EKWA 4TV9A 3RYCA 5LA6B 2ADQB 3ZN0A 3ABLB 4Q20A 1WN7A 4LFCB 4Z1VA 5CBHA 3Q4HA 4UCVA 2QM4A 1BSMA 4TV8A 5H5NA 2P6JA 3G80A 2ZE8A 4IHJA 1VF7A 3OGCC 1KYOF 5KA5A 3CC4V 4R6ZA 1AI5A 4F4LA 2F4VO 1DF4A 2PUSA 4LF9O 4FFBB 3B8MA 5IJ0B 4WFGA 3RW0A 1R6NA 2YC0A 3OUFA 1JJOA 5LHIA 2H3OA 1H2NA 2QEXV 1M4UA 4DR4O 4X1IB 2BCCH 1P7BA 4LF4B 3WB1A 3ZHSA
chains in the Genus database with same CATH topology
2QKAA 1GN4A 1N0NA 1Y67A 1XUQA 1AP5A 1I0HA 1LUVA 1PL4A 3TJTA 1QNMA 1IXBA 2RCVA 1AR4A 1IDSA 4FFKA 1JR9A 1ZLZA 3BFRA 3C3SA 1JA8A 1GN3A 1B06A 3AK1A 1AR5A 1BT8A 2CDYA 3CEIA 2ADPA 4GUNA 3DC6A 4E4EA 1MSDA 1VEWA 3K9SA 1XILA 1ZTEA 1I08A 3KKYA 1MA1A 5AG2A 3DC5A 4BR6A 1SZXA 3MDSA 4YIPA 4JYYA 2ADQB 3AK3A 3KDRA 5A9GA 1GN2A 1MNGA 1AVMA 1BSMA 2AW9A 1KKCA 3QVNA 1WB7A 4X9QA 4YIOA 1D5NA 2GDSA 1LUWA 1EN6A 2P4KA 2CE4A 1VARA 1P7GA 1XDCA 1ZSPA 4JZ2A 1AP6A 3OT7A 4JZGA 1IX9A 1GN6A 1EM1A 1BS3A 3EVKA 1MMMA 2QKCA 1EN5A 1EN4A 1XREA 4F6EA 3LSUA 1ZUQA 3IC9A 1WB8A 1PM9A 1N0JA 3RN4A 4C7UA 3AK2A 3C3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKA A;  1GN4 A;  1N0N A;  1Y67 A;  1XUQ A;  1AP5 A;  1I0H A;  1LUV A;  1PL4 A;  3TJT A;  1QNM A;  1IXB A;  2RCV A;  1AR4 A;  1IDS A;  4FFK A;  1JR9 A;  1ZLZ A;  3BFR A;  3C3S A;  1JA8 A;  1GN3 A;  1B06 A;  3AK1 A;  1AR5 A;  1BT8 A;  2CDY A;  3CEI A;  2ADP A;  4GUN A;  3DC6 A;  4E4E A;  1MSD A;  1VEW A;  3K9S A;  1XIL A;  1ZTE A;  1I08 A;  3KKY A;  1MA1 A;  5AG2 A;  3DC5 A;  4BR6 A;  1SZX A;  3MDS A;  4YIP A;  4JYY A;  2ADQ B;  3AK3 A;  5A9G A;  1GN2 A;  1MNG A;  1AVM A;  1BSM A;  2AW9 A;  1KKC A;  3QVN A;  1WB7 A;  4X9Q A;  4YIO A;  1D5N A;  2GDS A;  1LUW A;  1EN6 A;  2P4K A;  2CE4 A;  1VAR A;  1P7G A;  1XDC A;  1ZSP A;  4JZ2 A;  1AP6 A;  3OT7 A;  4JZG A;  1IX9 A;  1GN6 A;  1EM1 A;  1BS3 A;  3EVK A;  1MMM A;  2QKC A;  1EN5 A;  1EN4 A;  1XRE A;  4F6E A;  3LSU A;  1ZUQ A;  3IC9 A;  1WB8 A;  1PM9 A;  1N0J A;  3RN4 A;  4C7U A;  3AK2 A;  3C3T A; 
#chains in the Genus database with same CATH topology
 2DYS B;  3W7T A;  4UVA A;  1R73 A;  4JAA A;  1XQ8 A;  4BIU A;  1SRY A;  1X4T A;  4BIO A;  3M7M X;  4OXS A;  1I5X A;  4KUM A;  2X7R B;  2Q73 A;  1J5E O;  3OAA G;  4O4I A;  2ZR2 A;  2WLK A;  3NR7 A;  3W7S A;  5EK0 A;  3SPC A;  2XOK G;  4DK1 A;  4JI3 B;  4LFA B;  1UPG A;  4FM2 A;  3DTU B;  3HKD B;  4UCR A;  4JI7 O;  2ETN A;  3ZMU A;  4DV6 O;  3JSL A;  3KCY A;  4FM0 A;  4H33 A;  3U10 A;  1TA8 A;  2DWE C;  5JCO C;  3OMA B;  4GUN A;  1OV9 A;  3DC6 A;  4J42 A;  2FKX A;  2Q4P A;  1A32 A;  3JAR B;  4XDJ A;  3FKS G;  4UCU A;  4O4J B;  3GWO A;  1SQV H;  1B6Q A;  3RYI B;  2JS5 A;  4NTW A;  1FKA O;  4I0X B;  1P84 F;  4MTG A;  4TT3 G;  2Q0A A;  1AJQ A;  1RM1 B;  3K9A A;  3QNE A;  4B7K A;  1EN6 A;  1ENV A;  5L3G A;  1BHB A;  1PNM A;  1H8E G;  4JI6 O;  1GAX A;  1ZX3 A;  4GKJ O;  4B08 A;  4X66 B;  1H2S B;  2PTM A;  3ZMV A;  1OHH G;  4E2L A;  4AQY O;  2QKC A;  4X62 B;  1GO3 F;  4LF6 B;  3LDC A;  3LNN A;  3ZRW A;  2ZE5 A;  1PKX A;  2IM9 A;  4RQE A;  4FLX A;  4NR1 A;  4WFF A;  3C3T A;  2W6I G;  3CRC A;  3CHX A;  2IH3 C;  2UXB O;  3H1K H;  1AP5 A;  4J7J A;  3SR2 C;  3HKC A;  4MW3 A;  3ABK C;  1KU9 A;  1MZE A;  3WU2 Z;  4NTY A;  5CBG A;  3Q4H B;  4JTD B;  1EZJ A;  4K8Z A;  2YID A;  1NJI W;  1S3J A;  2B9Z A;  4IGG A;  1H38 A;  3BA9 A;  1IDS A;  3HKE A;  1W0J G;  4DR6 B;  4R50 A;  1HNX O;  2PY5 A;  2GV9 A;  1RSO B;  3WB2 A;  1OCZ B;  4ZBM A;  1OCR C;  1Z5W A;  4E4E A;  2A79 B;  1KP3 A;  4GX1 A;  1S5J A;  4UFZ A;  1IXM A;  5EBL C;  2ZD9 A;  5FLX N;  5CBF A;  5CA3 A;  3RVZ A;  2DQ0 A;  4B7E A;  1SZX A;  4B3S B;  3TXQ A;  4PA7 A;  1Q82 W;  3FB7 C;  4JI1 B;  3ABM B;  3IAY A;  2KSD A;  4JAU A;  1R3J C;  5JWP A;  1K34 A;  1I7F A;  2AW9 A;  4A5U B;  2HJF C;  3AG3 B;  3UT5 A;  5IYC O;  3OMN B;  2VWK A;  1VAR A;  1HW7 A;  4JV5 O;  3CJH A;  3WFV A;  3ETE A;  1HNW B;  1XNQ O;  3ETQ A;  4WFE A;  4LC1 A;  3GVM A;  3FAV B;  3E8B A;  2N74 A;  5K1P A;  1MMM A;  3QF7 A;  1RPR A;  1P49 A;  1GM7 A;  4X64 O;  3FAV A;  5E1A C;  3A0R A;  1FXK A;  5LBQ A;  2R72 A;  2ITC C;  4G28 B;  1IUR A;  4LBE C;  4X20 A;  2ZXW B;  3X2Q B;  2XAJ A;  5KLV H;  2UXC O;  2UUC B;  4PI0 A;  4DUY B;  3E8G A;  4I7Z B;  1FS0 G;  4AI8 A;  1RPO A;  4X1K B;  2AGA A;  3TK1 A;  3L70 H;  4FLZ A;  4DR1 O;  1AJN A;  3MD0 A;  5LHH A;  3JAW A;  3ABU A;  4O4L B;  1Y76 B;  1K9M W;  2XUM A;  4LWS A;  1NR1 A;  4DV3 O;  3IC7 A;  1IJG A;  1P4R A;  3BAB A;  3D36 C;  1WA8 A;  5LGT A;  2AHZ A;  5CA0 A;  3RGB A;  1Y74 B;  1K5S A;  1ZL8 A;  1YIT V;  3JSN A;  5LOV A;  2PYJ A;  2CTW A;  1IBK B;  3CXH F;  2OCC B;  2YI8 A;  4BIZ A;  1AI7 A;  1K4D C;  4TWK A;  5J9P C;  1OCC C;  3DC5 A;  1WP8 A;  1WPX A;  3MDS A;  1NTK H;  4HBN A;  4WBN B;  1NQT A;  4UB6 Z;  4PHZ A;  2GSM B;  2F4V B;  1XL4 A;  3R65 A;  3THO A;  4X89 A;  4I4T B;  4JYB A;  3CCV V;  4DV4 B;  2JJ2 G;  5KX5 A;  5IT9 N;  2G38 A;  1U96 A;  3P30 A;  2RDC A;  5FNV A;  3D3I A;  1PD3 A;  1XNR O;  3O65 A;  3ZJZ A;  2DYR C;  1L8D A;  2Y4U A;  1XMO O;  1G6U A;  2YIB A;  3JAS B;  1SES A;  4JI2 O;  3UO3 A;  1QLE B;  1Y66 A;  5H6Q A;  4ABM A;  2UUB O;  1XRE A;  3JAS A;  1IVS A;  4HAM A;  3E22 A;  4KXR A;  2BSK B;  1ZUQ A;  1VF5 B;  1AB3 A;  4B3M O;  3ZMS A;  2E74 B;  3B2E E;  2QWO B;  3ABL C;  1NBM G;  3N2G B;  5J2U B;  3CS5 A;  4UCS A;  5BZB A;  2R9R B;  1Y67 A;  4N23 A;  1YDX A;  1V9P A;  2FML A;  1DGS A;  2DW4 A;  1GH6 A;  1KUQ A;  4J9Z B;  2OIG A;  2QM8 A;  1BZK A;  4DV7 B;  4G2K A;  5KHI A;  2OYQ A;  3L73 H;  2E76 B;  1GTO A;  2W6J G;  3CYO A;  1OJH A;  2HG5 C;  3E83 A;  4ZHQ B;  2DJV A;  3B4S A;  1J95 A;  2ZXW C;  4KFM A;  1BE3 H;  4JTC B;  2PYL A;  1S76 D;  1SQG A;  1VEW A;  2CTQ A;  1NS1 A;  2WLI B;  4X62 O;  1K8A W;  4LF6 O;  1ZWI C;  4JI3 O;  4LFA O;  3OEE G;  2ZIN A;  1Q6I A;  3H1J H;  2OCH A;  3T2M A;  3D8C A;  5CA1 B;  3ZHV A;  1N4C A;  1JOY A;  1WB7 A;  3K5M A;  3LUT B;  4O2B B;  4P9O A;  5B1O A;  1HWY A;  1R3I C;  4UVC A;  1NKD A;  1X59 A;  2Q8V A;  3OT7 A;  1WPB A;  3OM3 B;  1GRJ A;  4UB8 Z;  3CCE V;  2LP7 A;  1GN6 A;  4GX0 A;  2EJ7 A;  1EM1 A;  1B3Q A;  4DV0 B;  1EN5 A;  5LMU B;  4GKK O;  2IJJ A;  2VQE B;  5J2T B;  1BQ0 A;  4NXM B;  1HNX B;  1F7Y A;  1R1B A;  4GCZ A;  4FMT A;  3CRR A;  2QDO A;  4ICG A;  2XT9 A;  2JJ1 G;  2FL4 A;  1O9G A;  5F2V O;  1SQQ H;  5FL7 G;  4B3M B;  4CBC A;  1I0H A;  1F51 A;  4DR6 O;  5LP6 B;  1JFF B;  5GON A;  3ASO B;  4U7N A;  5JVD A;  4B3T B;  3K58 A;  4I55 B;  4CC5 A;  1VQO V;  1NH2 D;  2ILM A;  1JCH A;  2RQ6 A;  2D3O W;  1VQ8 V;  1GN3 A;  4FIP C;  5CB4 B;  4O2A B;  4QIW F;  1BT8 A;  1E1Q G;  4FFB A;  1HDJ A;  4I5S A;  3JCZ A;  2ADP A;  3OD4 A;  4JI1 O;  3T4D A;  1GM9 A;  2IJH A;  3QG5 A;  4NTX A;  3H9V A;  3OFN G;  4FLV A;  1XI1 A;  2YEV B;  4DR2 O;  1I94 O;  2QE7 G;  1SS3 A;  1XOU A;  3RT3 C;  1M56 B;  2FTK A;  2EIJ C;  2YEV A;  5DED A;  1GN2 A;  4QPJ A;  1K92 A;  4MSW C;  4FLY A;  5C8Y A;  3QVN A;  3BPZ A;  5B3S B;  4JI4 O;  4DUY O;  1LUW A;  3K3W A;  1IBL B;  4LF8 B;  1SZT A;  1P7G A;  5KHK A;  1PL0 A;  2N05 A;  4EFB A;  3JD4 A;  3SPH A;  2QTO A;  5HFM A;  2ATK C;  1YZB A;  1V55 C;  4IT5 A;  4CH4 A;  3FYI B;  3AG7 A;  1LNQ A;  3P3N A;  2X6A A;  4TQD A;  1J5E B;  3TCU A;  3ZHR A;  1GN4 A;  3KCX A;  1QHT A;  2RN9 A;  2CTP A;  4P30 A;  2GHY A;  3ABK B;  3VQX A;  5IJ9 A;  1IBK O;  4X8A A;  4DV3 B;  3TET A;  1KQS U;  4K0K B;  1KC8 W;  2V1D A;  1IZ3 A;  1CXZ B;  4LP8 A;  4JAS A;  3E89 A;  1OCO B;  4PDL A;  2Q6A A;  1WLE A;  4NXN O;  4J41 A;  2Y4T A;  3JAW B;  2VQE O;  1YTF B;  2F1M A;  3C3S A;  2BE3 A;  2DYS C;  3SJB C;  1F23 A;  1HP8 A;  3ZCC A;  4PA4 A;  4DRX B;  2F66 C;  2A9H A;  4J9Y B;  2PZS A;  1AIL A;  2ZIM A;  4EB6 B;  1JPX A;  3SPI A;  2ZNJ A;  2Q7G A;  4ZOL B;  1VQP V;  4DV5 B;  1SQF A;  1HR0 O;  3CRM A;  2YIC A;  3ZRW B;  2CAZ C;  4WFH A;  1Q8I A;  5LOV B;  3CD6 V;  1MA1 A;  1N36 B;  1H2L A;  5LMN O;  3FB6 C;  1KP2 A;  4CH3 A;  1YJ9 V;  2BTQ B;  3N27 A;  3SPG A;  1XMQ B;  2UUA O;  1MG1 A;  2CH7 A;  3KDR A;  2F93 B;  3JCU Z;  2EIN B;  2CH7 B;  3SPJ A;  1US6 A;  4FZ0 A;  4CH5 A;  5TIS Z;  4LR3 A;  5LGN A;  3AG2 C;  5GON B;  4DR5 O;  4FM1 A;  1FOU A;  4X65 B;  3A2F A;  1S5H C;  5JH7 B;  4QE9 A;  4PDM A;  4CS2 A;  2V7Q G;  2EZO A;  1SA0 B;  5IWA B;  2NNU A;  4TV8 B;  5LP6 C;  4DV7 O;  1IBL O;  1R6K A;  4MVM A;  1TVK B;  1YF2 A;  4LF8 O;  1K7D A;  1S0V A;  2EIK B;  2VQF B;  5LYJ B;  1JMK C;  2GUZ A;  1KBH A;  3JAM N;  5D5Q A;  5H9C A;  4DUZ O;  2LQT A;  3RYF A;  5IJ0 A;  4UUJ C;  2P22 C;  4F6R A;  1URF A;  5IY5 C;  2JGD B;  4TUY B;  4DV4 O;  3E86 A;  1OCR B;  5J2U A;  2IBZ H;  4FPP A;  2YS8 A;  2WA3 A;  4QJF B;  2QSA A;  3F5T A;  4UV9 A;  3G6B A;  4FZ1 A;  4LF7 B;  4ASU G;  4IIJ A;  4U3J A;  4K8X A;  1KKD A;  3ABT A;  2NN4 A;  2IJK A;  2JRI A;  3K5N A;  4D7S A;  3CX5 F;  1K4C C;  2CGO A;  5KUK A;  4MVS A;  4FFK A;  3K5L A;  3A8T A;  2P5O A;  3ETG A;  2FYU H;  1AI4 A;  3C90 A;  3CP1 A;  3RYC B;  5LHG A;  1DTO A;  1BL8 A;  1FPO A;  5DM6 V;  4ZIB A;  3HKB B;  2QM7 A;  1XHX A;  3M99 B;  2DOS A;  3TGU H;  4CC6 A;  1OZ0 A;  1JNB A;  2PGG A;  4JYY A;  2Y48 A;  3MAQ A;  4YY3 B;  4NXM O;  2W0F C;  4J7K A;  5KMG A;  4DV1 B;  1YVW A;  1NH2 B;  3VOU A;  4JAV A;  4NB5 A;  5JQG B;  5IYD O;  3BHP A;  4I9Q A;  1BGY H;  2UUA B;  2P4K A;  2P7T C;  3RYI A;  2L6L A;  1FD9 A;  2XAG A;  1N34 B;  3OUS A;  5C93 A;  1QVG U;  2M7W A;  3RWR D;  4JZG A;  4P9P A;  1K73 W;  5B1A B;  2ZT9 B;  1H2K A;  2UUC O;  2JVD A;  5LMN B;  5EC2 C;  4DRX A;  4YJ2 A;  3T1C A;  3JAL B;  1Z5V A;  3JAK B;  4JI0 B;  4GYC B;  4MTF A;  3H01 A;  4YJ2 B;  1PM9 A;  3U11 A;  5FPR A;  1RM1 C;  5B1B C;  5IE9 A;  1Y74 A;  1XUQ A;  1YCI A;  3ZX6 A;  1QU7 A;  2Z5U A;  1WJZ A;  3ZED A;  2Q68 A;  4CH6 A;  3TJT A;  2W0X A;  2PF4 E;  4DV0 O;  2YIA A;  4TV9 B;  5LMU O;  3J80 N;  4NKG B;  3DSQ A;  1OCO C;  1XEQ A;  1FYJ A;  4PA9 A;  1NTM H;  3BFR A;  4LF7 O;  2HR3 A;  5JH7 A;  1VQN V;  2X6B A;  4OGQ B;  4JI4 B;  1WAZ A;  1Q3E A;  1HNZ O;  3NXS A;  2E5L B;  5CB4 A;  2K1E A;  2ZDI A;  5L3B A;  3WG7 B;  4L87 A;  2JEX A;  3DXR A;  2BSK A;  2P4V A;  1JQ0 A;  3F7V C;  2WLL A;  3DXR B;  3H1I H;  2Q9L A;  3FYE B;  4YIP A;  2WPD G;  3JD1 A;  1MAB G;  2Q7H A;  1YTF D;  4G27 B;  5BXZ A;  2A7W A;  4JI2 B;  5IY5 B;  5EIB D;  2YIB D;  3RFR A;  4H37 A;  3KZI Z;  4JZ2 A;  3CWB H;  2RJZ A;  3K59 A;  3CCS V;  4Z1M G;  3AG4 C;  3SGI A;  4PA3 A;  1NT2 B;  5EBW C;  1L0L H;  3SYC A;  1VQ7 V;  4PA6 A;  4PDR A;  4U7O A;  4YHH B;  1SQP H;  4JI6 B;  2HEP A;  4ZI7 B;  3WB0 A;  2EIM C;  2B1G A;  1NVP D;  2OT5 A;  4MVU A;  4IHJ B;  4YXW G;  1M9N A;  4ZKI A;  1HR0 B;  5LXT A;  2Q67 A;  2XTA A;  3BAA A;  4X20 B;  3E8H A;  1FAF A;  2RNB A;  1RFY A;  2XAS A;  1RSO A;  3D36 A;  4UVB A;  5JQG A;  2ZR3 A;  2Y0I A;  2QWQ B;  4L8J A;  1ZLZ A;  4GLX A;  5CA1 A;  3ASN C;  4I50 B;  3CCM V;  2DQ3 A;  3O9O A;  5EYP B;  4JF3 A;  1XBL A;  2HP8 A;  3EFF K;  3JD0 A;  1TGO A;  2CTR A;  4K3A A;  3FFQ A;  4EFE A;  1OCZ C;  4MVQ A;  3ZMT A;  3OE7 G;  3KKY A;  2Y69 C;  4CS4 A;  1ROP A;  1CPY A;  1S5L Z;  1F4N A;  2E3C A;  3N2K B;  3R66 A;  4DV2 B;  3X2Q C;  1PV0 A;  1MNG A;  1S77 D;  5GW7 A;  3CCQ V;  2HVJ C;  4IL6 Z;  3HKD A;  1DF5 A;  2EX3 A;  2IH1 C;  4DUZ B;  2IU3 A;  2UXN A;  3OGI B;  4LF9 B;  1N33 B;  4X9Q A;  2LJ2 A;  3CRA A;  3OTO O;  2EIK C;  3I55 V;  5LP6 A;  1L0N H;  4PDV A;  2XAH A;  3CME V;  5LA6 A;  3CSX A;  1VQ9 V;  2E5L O;  1MSW D;  3F7Y C;  1AR1 B;  4IYI A;  4Z2W A;  1AP6 A;  3OR6 C;  3JD3 A;  1K97 A;  1I5Y A;  4LF4 O;  1IX9 A;  1U97 A;  3BRC A;  1QLN A;  2EIN C;  1KB9 F;  2P06 A;  2N04 A;  3LSQ A;  4I55 A;  2YSU B;  4AIL C;  1PNL A;  2JEU A;  2CK3 G;  2LFS A;  3RN4 A;  2WSS G;  5BR8 B;  1LR1 A;  5B1B B;  4X65 O;  2ZM6 O;  4UCT A;  4YHH O;  4MW8 A;  3B09 A;  1G4Y B;  2B1I A;  1WA8 B;  2UXC B;  5CA0 B;  2QGN A;  4QGP A;  2QA4 V;  1JJ2 U;  2O57 A;  5A2Q N;  1CEZ A;  3W7W A;  2ZE7 A;  3B40 A;  4WCE V;  3ASN B;  1Q5O A;  3SJC C;  3CCL V;  3BEH A;  4MTX A;  2JK5 C;  3E35 A;  3IGA C;  1SF9 A;  3AK1 A;  1AR5 A;  4P2Z A;  2OTL V;  1YJN V;  3L71 H;  1I94 B;  4YJ3 A;  3B8N A;  5CN0 A;  2XHB A;  1MSD A;  4YJ3 B;  4GKJ B;  1N8R W;  4PV1 B;  1GKF A;  1FJG O;  1WNS A;  1GK9 A;  2R9A A;  2P90 A;  4DR3 O;  4JYA B;  5AG2 A;  4D7T A;  1M57 C;  2ZCE A;  1R3K C;  4GX5 A;  5A9G A;  4KHP B;  2X0L A;  1DK1 A;  1Y4M A;  4PJ0 Z;  4X88 A;  4D6T H;  3K5O A;  3ICX A;  3JAR A;  3W7U A;  1H2M A;  1VQ5 V;  1SQB H;  4AQY B;  4OX9 O;  2LGW A;  1NU1 H;  4LFB O;  4LNU A;  2WWW A;  1KD1 W;  2EJR A;  1DLB A;  2WA4 A;  1VQM V;  4I0X A;  2GTA A;  2EIL C;  2Q69 A;  5H6R A;  3OTO B;  2Q7E A;  1W2B U;  2HVK C;  1EN4 A;  2ZE6 A;  2R9I A;  2IU0 A;  1Y76 A;  4J11 A;  3J81 N;  4GT1 A;  4DV2 O;  1XMO B;  1WB8 A;  1Q6U A;  1BCC H;  2PI5 A;  1XHZ A;  2HKO A;  4FLW A;  2HHH B;  4UCO A;  1FXV A;  1S72 V;  4JPR A;  4MTO A;  1M1K W;  4OPA A;  3SYQ A;  5JCO A;  4CZZ A;  2FB5 A;  1PL4 A;  4ZHQ A;  2QKS A;  1QBZ A;  1FFX A;  4J7Z A;  1TUB B;  2RCV A;  2YI9 A;  2ZM6 B;  1HNZ B;  5B66 Z;  4LH6 A;  2AZ2 A;  2NR5 A;  4JI0 O;  1TUB A;  1JA8 A;  1M57 B;  4W4L A;  3S3X A;  3L9D A;  1K5Q A;  4I4T A;  5KX5 B;  1B04 A;  3L72 H;  3G6E V;  5K1X A;  3FX7 A;  5GTH Z;  2QWP B;  1E1R G;  1QR8 A;  2EBO A;  1MZF A;  4RUF A;  3RYH A;  1VMG A;  2IJI A;  4O2B A;  4X64 B;  1YI2 V;  4MS2 A;  2EIL B;  5LYJ A;  1VF6 A;  4JV5 B;  5KAI Z;  3ZN1 A;  2KQX A;  3VQY A;  1BMF G;  2WAM A;  1AVM A;  1Q6H A;  3PJS K;  5IWA O;  3AEI A;  2AHY A;  1D5N A;  3RYF B;  3CMA V;  1NI8 A;  4HNA A;  1AI6 A;  2XND G;  2CE4 A;  2VQF O;  4KHP O;  5J2T A;  3AG3 C;  3W7X A;  4GZR B;  4JI8 O;  3E2E A;  1NTZ H;  3OEH G;  1R3L C;  5C8Y B;  2BTO A;  1BS3 A;  1N32 B;  3HPL C;  3K03 A;  1VP7 A;  3FD9 A;  3GWK C;  4OX9 B;  1COW G;  2A0L A;  2ODM A;  1GM8 A;  3IFX A;  4LFB B;  3FB8 C;  1D2D A;  2QTS A;  3P3P A;  4QE7 A;  5IYZ A;  3IC9 A;  1YIJ V;  3U0Z A;  5IYZ B;  4IYH A;  1THZ A;  3UQ8 A;  5JVD B;  3STL C;  4BW9 A;  1TUE B;  5EBM C;  4HZ3 A;  3CC2 V;  3K0G A;  3B77 A;  1KEC A;  3PN1 A;  1FXK B;  3HR0 A;  3HKE B;  5DN6 G;  2K9P A;  5KHJ A;  3KG2 A;  2UXD B;  4KL1 A;  4DR7 O;  3JD2 A;  2VRZ A;  2KG7 B;  2MW2 B;  2HHH O;  3SJA C;  3ETD A;  2F23 A;  3CRQ A;  2KG7 A;  3E22 B;  4GKK B;  3D3Q A;  5LGU A;  1AR4 A;  3FB5 C;  2ZKO A;  3T1Y B;  5KMG B;  4U3F H;  4FJC C;  2V4D A;  3VQV A;  3A0B Z;  4O4H A;  3LDE A;  3LNM B;  2AXT Z;  2YXH A;  3CCU V;  1F4M A;  4UXN A;  2WLH A;  2Q0O C;  2XAF A;  4B3R O;  4H13 B;  1XIL A;  2H8P C;  2Z3Y A;  3ML0 A;  2DE0 X;  1PP9 H;  2OCC C;  3BVO A;  3K04 A;  2LO1 A;  1AJP A;  3K79 A;  5JJJ B;  2Z0A A;  3G4S V;  3HB3 B;  4DYL A;  4ZOL A;  1IBM O;  2XAQ A;  5LL6 Y;  1QQC A;  2JIZ G;  1YSC A;  4X1Y B;  2GDS A;  2DMX A;  3H1H H;  4DR2 B;  2KKW A;  2BTQ A;  2HJD A;  4W4K A;  1KMI Z;  4RAI A;  2YXL A;  3VQW A;  3MHS C;  4WBN A;  5BMV A;  2RMK B;  3ZRX A;  5KHH A;  1JFF A;  1Y6X A;  1V55 B;  3EVK A;  4JI5 B;  4X1K A;  2UU9 B;  1R6T A;  1VQ6 V;  4FK5 C;  3LSU A;  3OMI B;  4JI8 B;  1OCC B;  5BY1 A;  4C7U A;  5HFL A;  1FFT B;  4I9W A;  1N33 O;  3AK2 A;  1PPJ H;  1SQX H;  2QKA A;  4O4L A;  2UXX A;  1VIB A;  4DO2 A;  2BOB C;  3QO7 A;  4AHC A;  5GTI Z;  2OIE A;  1ARO P;  3K0D A;  1FJG B;  1M90 W;  4TUY A;  3S3W A;  3EHB B;  5EIB C;  3K06 A;  3I5D A;  1JR9 A;  4NYK A;  4LH7 A;  1L1F A;  2QJ1 A;  4Q6G A;  2C2A A;  2LW7 A;  3L75 H;  4N21 A;  1VF6 C;  3SDL A;  1B06 A;  1YEW A;  4DXW A;  3ABM C;  4DR3 B;  5BR8 O;  4WF9 V;  5B3S C;  3DGE A;  3STZ C;  1FXH A;  1BQZ A;  3K57 A;  2E75 B;  2WLN A;  1UFI A;  1V54 C;  3P32 A;  1XL6 A;  3T4Z A;  1PNK A;  3AG1 B;  2R70 A;  4K0K O;  2UXD O;  4JGS A;  5IDJ A;  1JX9 A;  5KAF Z;  4MVO A;  2AZ0 A;  5L3D A;  3JYC A;  5FNV B;  1YHQ V;  3AK3 A;  3K08 A;  2PI4 A;  1FXK C;  3HKB A;  4QPK A;  1K3E A;  4DR4 B;  4ZI7 A;  2DN9 A;  2LW1 A;  3H1L H;  4O2A A;  4R7C A;  3RVY A;  4B3S O;  1M93 A;  1NR7 A;  1XDC A;  2EIM B;  2ITD C;  4B3R B;  4RO2 A;  2DYR B;  2JS3 A;  2LFR A;  2DWD C;  1H5W A;  4F6R B;  1Q90 D;  4DR5 B;  3M8A A;  5KHG A;  1NVP B;  4JYA O;  1N36 O;  4RWU A;  4X1I A;  5EYP A;  1XNQ B;  4O4H B;  4MVZ A;  1SC5 B;  1EBO A;  4LFC O;  4XDL A;  1RP3 B;  4HYO A;  2EUL A;  4CS3 A;  4DW0 A;  5JJN B;  2UU9 O;  4B3T O;  1M5I A;  4PD4 F;  2VS0 A;  3CPW U;  1Q7Y W;  4K35 A;  2HFE C;  4O4I B;  5L3E A;  1Q86 W;  3SYA A;  5ITZ A;  3ZHU A;  3CJH B;  4JI5 O;  2ZQM A;  2YUA A;  5ITZ B;  2CUG A;  4MT8 A;  2QR4 A;  4FLT A;  1FFX B;  3GB7 C;  2A06 H;  1JVM A;  2LGQ A;  3L74 H;  3ZHT A;  5BMV B;  2IW5 A;  3BY6 A;  3G67 A;  2CDY A;  2KB1 A;  3A0H Z;  2JGU A;  1V54 B;  5IJ9 B;  3RBZ A;  5EZY A;  3TXS A;  4UV8 A;  4LF5 B;  3K9S A;  1SA0 A;  4JI7 B;  1YXB A;  3OTF A;  3SYP A;  2NLJ C;  1SKV A;  1TVK A;  3CE2 A;  4GX2 A;  4H44 B;  4TOI A;  3ASO C;  2OTJ V;  3ZRS A;  4TSF G;  1H2G A;  2JDI G;  1H8H G;  3T1H B;  4YIO A;  4DV6 B;  1GMG A;  2WLL B;  1VQL V;  1ZL8 B;  2Y69 B;  1ZAU A;  1ZSP A;  4DV1 O;  3EXA A;  2ZIO A;  1BHA A;  1Z2G A;  3CC7 V;  1XNR B;  4DK0 A;  1T5E A;  3MHH C;  3UCS C;  1W0K G;  2F95 B;  2GTS A;  3BA8 A;  5CMU A;  4X66 O;  1SER A;  2EIJ B;  3AG1 C;  3AG2 B;  1QR9 A;  4OPH A;  2QWR B;  2UUB B;  4XBF A;  3HKC B;  1N0N A;  2M6Y A;  1Q81 W;  5DEC A;  4FLU A;  1ORQ C;  5L3F A;  4NXN B;  2GBO A;  4RUE A;  2ARH A;  1QCE A;  4BWA A;  5EC1 C;  3UO2 A;  4WFB V;  4PEL A;  4TQF A;  1UJW B;  1QNM A;  5KUM A;  3QTC A;  1N32 O;  1K33 A;  4MVR A;  2L35 A;  1XMQ O;  1G1X B;  3CB2 A;  1IBM B;  3ZRV A;  2GUZ B;  4DV5 O;  1QVF U;  4LNU B;  4FVM A;  3N2G A;  1SET A;  1O9H A;  5H2F Z;  2Y0P A;  2JGD A;  3APO A;  4JYC A;  3CEI A;  1VQK V;  3AG4 B;  4R8C A;  2UXB B;  1HNW O;  3ZMZ A;  2WLJ A;  3IJ4 A;  4XDK A;  3UM7 A;  1G8M A;  3J7A U;  1TAE A;  1I08 A;  4DR7 B;  2BOC C;  3UKM A;  2HLD G;  3WG7 C;  1E79 G;  1VQ4 V;  4BR6 A;  5B1N A;  1W59 A;  3JAK A;  3JAL A;  4KP4 A;  4LF5 O;  1Q43 A;  1M56 C;  1EZV H;  3JAT B;  3CXC U;  3T1Y O;  4JTA B;  2ZNI A;  1KKC A;  3UT5 B;  2YDE A;  3JAT A;  2H94 A;  2X6C A;  3ZBH A;  3APQ A;  3N2K A;  2Q5Z A;  4X1Y A;  2B5U A;  3QO5 A;  2D2C B;  2VWJ A;  2F43 G;  3VBB A;  3I56 V;  1QLE C;  4F6E A;  4H0L B;  2QWN B;  5LXT B;  1N0J A;  4O4J A;  3G71 V;  2WLI A;  1CP9 A;  5EZY B;  4RQF A;  3T1H O;  1D5A A;  3QO8 A;  5KA6 A;  4EEQ A;  4BAY A;  1NZ6 A;  4NVP A;  4PI2 A;  1LUV A;  5B1A C;  2YXY A;  2MK3 A;  3ZS8 C;  1WP7 A;  5E79 Z;  4I50 A;  1IXB A;  1EFR G;  3RYH B;  4BW5 A;  4QNH B;  5B5E Z;  3CCR V;  4EB6 A;  4LWS B;  2P67 A;  4DW1 A;  4HNA B;  2A3Q A;  3F5W C;  4J10 A;  5L3C A;  2CGN A;  3SYO A;  5IYB O;  2EZP A;  3BCC H;  4IIJ B;  4U3J B;  3ZHQ A;  4WFA V;  5JJE B;  2WLM A;  3ZIA G;  2OWO A;  1MOF A;  3OR7 C;  5FPO A;  3LSS A;  4YY3 O;  1YJW V;  1N34 O;  3E8F A;  3OW2 U;  3LDD A;  3CCJ V;  2ZDI C;  4LCU C;  1ZTE A;  4J80 A;  4DR1 B;  5D5P A;  3SJQ C;  4EKW A;  4TV9 A;  3RYC A;  5LA6 B;  2ADQ B;  3ZN0 A;  3ABL B;  4Q20 A;  1WN7 A;  4LFC B;  4Z1V A;  5CBH A;  3Q4H A;  4UCV A;  2QM4 A;  1BSM A;  4TV8 A;  5H5N A;  2P6J A;  3G80 A;  2ZE8 A;  4IHJ A;  1VF7 A;  3OGC C;  1KYO F;  5KA5 A;  3CC4 V;  4R6Z A;  1AI5 A;  4F4L A;  2F4V O;  1DF4 A;  2PUS A;  4LF9 O;  4FFB B;  3B8M A;  5IJ0 B;  4WFG A;  3RW0 A;  1R6N A;  2YC0 A;  3OUF A;  1JJO A;  5LHI A;  2H3O A;  1H2N A;  2QEX V;  1M4U A;  4DR4 O;  4X1I B;  2BCC H;  1P7B A;  4LF4 B;  3WB1 A;  3ZHS A; 
#chains in the Genus database with same CATH homology
 2QKA A;  1GN4 A;  1N0N A;  1Y67 A;  1XUQ A;  1AP5 A;  1I0H A;  1LUV A;  1PL4 A;  3TJT A;  1QNM A;  1IXB A;  2RCV A;  1AR4 A;  1IDS A;  4FFK A;  1JR9 A;  1ZLZ A;  3BFR A;  3C3S A;  1JA8 A;  1GN3 A;  1B06 A;  3AK1 A;  1AR5 A;  1BT8 A;  2CDY A;  3CEI A;  2ADP A;  4GUN A;  3DC6 A;  4E4E A;  1MSD A;  1VEW A;  3K9S A;  1XIL A;  1ZTE A;  1I08 A;  3KKY A;  1MA1 A;  5AG2 A;  3DC5 A;  4BR6 A;  1SZX A;  3MDS A;  4YIP A;  4JYY A;  2ADQ B;  3AK3 A;  3KDR A;  5A9G A;  1GN2 A;  1MNG A;  1AVM A;  1BSM A;  2AW9 A;  1KKC A;  3QVN A;  1WB7 A;  4X9Q A;  4YIO A;  1D5N A;  2GDS A;  1LUW A;  1EN6 A;  2P4K A;  2CE4 A;  1VAR A;  1P7G A;  1XDC A;  1ZSP A;  4JZ2 A;  1AP6 A;  3OT7 A;  4JZG A;  1IX9 A;  1GN6 A;  1EM1 A;  1BS3 A;  3EVK A;  1MMM A;  2QKC A;  1EN5 A;  1EN4 A;  1XRE A;  4F6E A;  3LSU A;  1ZUQ A;  3IC9 A;  1WB8 A;  1PM9 A;  1N0J A;  3RN4 A;  4C7U A;  3AK2 A;  3C3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...