2QKAA

Structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKANGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Structural and kinetic study of differences between human and Escherichia coli manganese superoxide dismutases.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 71
structure length 196
sequence length 196
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2qkaA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2qkaA02
2CE4A 1WB8A 1ZLZA 2CDYA 1ZSPA 4YIOA 3EVKA 1XILA 1AP5A 3AK2A 3KKYA 1I0HA 4YIPA 4GUNA 3AK3A 1N0JA 1XDCA 3OT7A 1B06A 1WB7A 1IX9A 3K9SA 4FFKA 3TJTA 1SZXA 3DC6A 1XREA 1GN2A 1VEWA 1ZUQA 2QKCA 1GN4A 4BR6A 4JZGA 4JYYA 1JA8A 1PL4A 4X9QA 1AR5A 1LUVA 2AW9A 1D5NA 3C3TA 1EN6A 2GDSA 1PM9A 3CEIA 1IDSA 1EM1A 1MA1A 1Y67A 1XUQA 3DC5A 1EN5A 5AG2A 4F6EA 1VARA 1BSMA 2ADQB 1AVMA 3IC9A 1MNGA 1BS3A 3QVNA 2RCVA 2ADPA 3MDSA 1I08A 1LUWA 1JR9A 1QNMA 1ZTEA 3RN4A 1IXBA 1BT8A 1GN3A 1AP6A 5A9GA 1KKCA 4JZ2A 1EN4A 2QKAA 4E4EA 3C3SA 1P7GA 3LSUA 2P4KA 1AR4A 3AK1A 3BFRA 1N0NA 4C7UA 1MMMA 1GN6A 1MSDA
chains in the Genus database with same CATH superfamily
2CE4A 2MW2B 1ZLZA 3GWKC 1WAZA 1RP3B 1YXBA 5IWAO 4R7CA 1Q3EA 4DV2B 2E74B 2XOKG 4JYAB 4MTGA 5GTIZ 1G6UA 4HNAB 1SQFA 1F7YA 4DR1O 3CJHB 5KHHA 2AXTZ 4X8AA 3Q4HB 4GX0A 2QR4A 4WFFA 4CC5A 3H1JH 5B1AB 4CBCA 1YZBA 4KL1A 2Q68A 4ZI7A 4J42A 1H2MA 3RFRA 1Y66A 4UVAA 2JDIG 3FB8C 5IYZA 5DEDA 2QKCA 2X7RB 2KKWA 1PL4A 2RJZA 4LFBB 3LDDA 4G2KA 4LF9O 1FXKC 1D5NA 5B1OA 1XBLA 3NR7A 4FJCC 3K57A 2A06H 3E86A 4LH7A 3LUTB 4DV0B 4DV5B 3N2GA 4RO2A 1NS1A 2PYJA 1J95A 2WLLB 5DN6G 1NT2B 5B1NA 4O4IA 2F1MA 2A79B 3WG7C 1XMOB 3J81N 2Q73A 4DV1O 3ZHVA 4JI3O 5IDJA 3RYHA 4LF5B 2PI4A 2EINB 3IC7A 3TCUA 5BY1A 5IYBO 2ADPA 3TETA 2ITDC 3MDSA 5KA6A 1JFFA 2PUSA 3L9DA 1M57C 1WP8A 2QM8A 3B4SA 1YJ9V 5LXTA 3OMNB 1TVKA 5A9GA 2QSAA 1LNQA 4FLZA 4LWSB 5IYCO 2LW1A 5D5PA 3C90A 1NZ6A 1WP7A 3OW2U 4BWAA 4B3RO 4PI2A 4JTCB 2HFEC 1YJWV 1VQ8V 4PHZA 4TT3G 3CMAV 4O2BA 4QIWF 4YIOA 3SJBC 3LSSA 1X4TA 4HYOA 2N74A 5KX5B 2ZKOA 2HKOA 3GWOA 4IT5A 3H1IH 4RUFA 3WFVA 2EIJB 1F4NA 4XBFA 2D3OW 2Y4TA 1XDCA 5KUKA 1WB7A 2R70A 5B1AC 3SYQA 1P84F 1FXKA 1GN2A 5LMUO 3RYCB 1G8MA 4JI0O 4QPJA 1JA8A 1BQZA 3D3QA 3W7WA 1LUVA 2LO1A 1NKDA 1UPGA 2MK3A 1VIBA 4IIJA 4RQEA 4X64O 3CEIA 1PD3A 4NB5A 4UCTA 2X6CA 2WAMA 3SJQC 2P6JA 4X1YB 3L71H 3BCCH 2YICA 3W7UA 3WB1A 4DR7B 3U11A 4JI6O 2UXDO 1B6QA 3GB7C 3HKDA 3QNEA 3CXHF 4LF7O 5H6RA 2UXNA 2Q0AA 4AI8A 2EINC 1U97A 1HNWB 2QTSA 2C2AA 1V54B 3CCLV 5LGUA 4PDMA 1AP6A 4UCVA 4R50A 4JZ2A 3ZS8C 5FPOA 2VQEO 2B9ZA 4YJ2B 1KYOF 4I4TB 1XL6A 1P7GA 3L75H 3DTUB 1OHHG 4DK0A 3D36C 4IL6Z 1S3JA 2CK3G 4C7UA 4HAMA 2G38A 2IU0A 1SETA 1FS0G 3M7MX 1PKXA 3D8CA 4PV1B 4HNAA 3CJHA 2JK5C 1MSWD 2Q69A 4JI5B 3Q4HA 5JH7A 2WA3A 4JI2B 2ZQMA 2PY5A 2YS8A 4PA9A 3FKSG 4CS4A 4K35A 1SQGA 4I0XB 3UCSC 1TUEB 1FJGB 1VQKV 2RDCA 4B3MO 5EIBC 3K59A 2V4DA 2R9RB 2ZE5A 2EIJC 4MVZA 4DR5O 4U3FH 1UFIA 2WPDG 1XHZA 2R9AA 2UXCO 5LYJB 3CMEV 3AG4B 1Q86W 1FD9A 1I7FA 2EZOA 1TA8A 1VQ9V 1QR8A 1W59A 1F23A 1FFXB 2WLLA 3ZHQA 1HNXO 3I56V 2QM7A 4J7ZA 4I9WA 3RYIB 3T1YB 4NXNO 5IYDO 4HZ3A 1OJHA 2YEVB 1N34B 2E76B 3QTCA 2RCVA 4CH3A 3KDRA 3N27A 5C93A 1A32A 4GT1A 1YI2V 5BZBA 4ASUG 3CB2A 5B1BB 3D36A 1IBMO 3ZX6A 2ZCEA 1JOYA 4BIUA 4LWSA 5IT9N 3SYPA 2B1GA 3RWRD 4H37A 1I94O 2QWOB 3LSUA 4KHPO 3ETEA 2XAHA 5LHGA 5CBHA 4DV3B 3CPWU 1K5SA 3JCZA 2EJ7A 3JAMN 5LOVB 3HB3B 5H6QA 1MABG 3HKEA 2DYSB 2OIEA 1SQBH 1N33O 4RUEA 1Y4MA 5KX5A 2ODMA 1N36B 3UQ8A 2DOSA 4QE9A 4F6RB 1I0HA 5KUMA 4GUNA 1MZEA 1L0LH 2YXLA 4B3TB 4KXRA 3CC7V 5CB4B 4PI0A 4O4HB 3JARB 1IX9A 4IGGA 3A0BZ 4IYHA 4J41A 5J2UA 2PGGA 1V9PA 2KG7B 3RYCA 3L70H 3BRCA 4FIPC 2BTOA 3B77A 1WJZA 3KG2A 1NVPD 1PNLA 1XL4A 1VQLV 2WLNA 1L8DA 4LFAO 3IJ4A 4JAVA 4DR6O 1EBOA 1PM9A 1FAFA 1SF9A 2L6LA 4QGPA 4ZI7B 3APQA 5KHGA 3AG4C 1MA1A 4X1YA 2IW5A 1KU9A 1S5HC 5AG2A 4H13B 4AILC 4X66O 2DWDC 4XDJA 5LP6B 3IC9A 2OCHA 1WN7A 2XAFA 3F7VC 2B5UA 3CCUV 1XNQO 3CCEV 2VWJA 1I08A 3UT5B 2QM4A 1NR7A 1I5XA 1VQ5V 1QNMA 3G4SV 1COWG 2DJVA 4LF6B 3EXAA 1JVMA 4I4TA 1KC8W 4G28B 1Q82W 5B1BC 3ZHSA 4EEQA 2DYRB 5FLXN 4MT8A 2P5OA 3X2QB 3ZMVA 1NTMH 1DF5A 4MVRA 1K3EA 2UUCB 3OTOB 2CDYA 4TUYB 1XOUA 4PDLA 4CC6A 2Q0OC 4Z1VA 4GYCB 4QNHB 2CH7B 4RAIA 1FKAO 1VF5B 2PI5A 5IY5B 2DYSC 2Q6AA 4I0XA 4DR4O 4G27B 2HLDG 5JJEB 3PJSK 4LC1A 1RPRA 3L74H 1UJWB 1SZXA 4JI7O 4O2BB 1GN4A 4BR6A 4FZ1A 3SPCA 1BMFG 2V1DA 3QO5A 5EZYB 3AG3B 5LYJA 1KP3A 5F2VO 1AR1B 1GAXA 4DUYB 4J10A 3M8AA 2IH3C 1GH6A 2VQFB 1FFXA 1GTOA 1HR0B 5J9PC 2X0LA 2YIBD 3EFFK 2HP8A 5GTHZ 1US6A 3RYIA 4X62B 3M99B 1DK1A 2YEVA 5CA3A 4DV2O 4B7EA 1K92A 4XDLA 1L0NH 3IAYA 2QWQB 1YITV 1R3KC 5LP6C 2LQTA 4PD4F 1L1FA 4DV6B 4MVUA 3ZRSA 3ZRXA 1IVSA 3CYOA 4AHCA 1K34A 4NVPA 4JASA 5L3GA 5GONB 3T1HO 2FL4A 3CC4V 2YI8A 2XTAA 4LR3A 2BOCC 3A2FA 1IZ3A 1WA8B 3AK1A 4OXSA 1KUQA 1SKVA 2YDEA 4X1KB 4YHHB 3O9OA 5KMGB 1TUBA 5LOVA 3BABA 4DUZB 4WFGA 2DYRC 3HKDB 4LFBO 2O57A 4MSWC 2M7WA 3FYIB 3LDCA 2M6YA 1H8HG 4AQYB 1H2SB 2P06A 4LFCB 3K5NA 4DV0O 4DV5O 3SPIA 1GMGA 1HNZO 4F6RA 2PF4E 1Q8IA 1VQ7V 4DR2O 1THZA 2ZE6A 3LNMB 5L3EA 3B09A 1PNKA 5CB4A 4UB8Z 1N0JA 4O4HA 1W0JG 2YIBA 3JARA 5IY5C 1K8AW 2ZR2A 3JD3A 2KG7A 2GBOA 2XHBA 2ZE7A 1SQXH 3DC6A 1R3JC 4I5SA 3TXSA 1BZKA 1R6NA 3JD1A 1S76D 5JH7B 4DV7O 2XAJA 1AJQA 4KP4A 3AG3C 3U10A 5J2TA 1GM8A 1QLEC 4LNUB 3JATA 1R3LC 1XMQB 2CTWA 5CBGA 2BSKA 4P30A 4F6EA 4DV4B 5LP6A 3B8NA 3BA8A 2VS0A 4WBNA 1NTZH 1FXHA 3CCRV 4JI8O 4MTFA 3UT5A 5BR8B 4YY3B 3ZN1A 1H2LA 2XASA 4Z2WA 1GK9A 3BAAA 5H9CA 3FFQA 3P3PA 3SPHA 1OCZB 4GCZA 2VWKA 3JD4A 2HHHO 2LP7A 1IJGA 3HR0A 1W0KG 1SZTA 4ZHQA 2EBOA 3H9VA 4Q6GA 1BL8A 3SYOA 1N32B 2CTRA 3N2KB 1IBKB 4DW0A 4TUYA 2PZSA 2ZIMA 2UXBB 4ABMA 5JCOC 2EIKB 2OTJV 4EB6A 2CH7A 2HVKC 5A2QN 3OMAB 2UUBO 1WNSA 2QWNB 4WFHA 2ETNA 1PNMA 2CGNA 2F43G 5IJ9B 4GX5A 2ZD9A 5HFLA 2N04A 2DE0X 3AG7A 4DR1B 3TJTA 3HKEB 1JPXA 1ZUQA 5EZYA 3OE7G 2UUAB 1HNWO 2FTKA 4ZOLB 4JYYA 3OTFA 3MHSC 3E22A 1CP9A 1NU1H 3QF7A 2DQ3A 3VBBA 3B40A 5J2UB 2X6AA 2QEXV 2UXXA 4OPHA 4LF9B 4FFBB 1SA0B 3STZC 3ZMZA 2IBZH 1RPOA 4GKJB 3E2EA 3FX7A 2E5LO 1LR1A 2A7WA 3SYCA 1HDJA 2YC0A 4GX1A 3VQWA 5FNVB 1KECA 3K9AA 1AI7A 1WPXA 1M56B 1R73A 2QE7G 1BT8A 5GONA 1S72V 1DTOA 3DGEA 1QCEA 1R6KA 4YJ3B 3C3SA 1WA8A 1PPJH 5JCOA 3BHPA 4X1KA 1OCZC 3K58A 5KMGA 2F4VO 5JQGB 5KA5A 2Y69B 1Z2GA 4LF8O 4B7KA 5B3SB 4GX2A 4DR3B 2ITCC 4F4LA 1NTKH 4X20B 1YTFD 3IFXA 2ZNIA 2EIKC 4U3JB 4B3RB 4MVMA 4YIPA 1NR1A 3AK3A 1SRYA 3T1YO 3ZMSA 4FZ0A 1J5EO 1H5WA 5LHIA 2WSSG 3BY6A 1GRJA 2OWOA 3P3NA 2W0FC 1VF6C 4LF4O 3ICXA 4JPRA 2JJ2G 4UB6Z 5K1PA 4QPKA 1QQCA 2CTPA 1AJPA 2IJIA 1NVPB 1XNRB 4JV5O 4DRXB 3JALB 4FLWA 2QWRB 1YVWA 3JCUZ 4LNUA 1JNBA 2YIAA 1BHBA 5LMUB 4FM1A 2HR3A 4MTOA 5IJ0B 3ZBHA 2IJHA 2XAGA 4BIZA 4DV3O 4FLVA 4Z1MG 3HKCB 4GLXA 1Y6XA 1JCHA 3QG5A 4MVSA 1K33A 3ZRVA 2WLMA 4JAUA 1BS3A 1N36O 2PYLA 1JX9A 4P9PA 4UXNA 1GN3A 2FB5A 4JI6B 1IBLB 2Q7GA 3OEEG 4UCSA 4ZKIA 2XAQA 3ASOB 1M56C 2UU9O 1VQOV 1JMKC 3TK1A 1EFRG 3FD9A 3N2KA 4OX9O 1SQVH 1MMMA 3OD4A 4TWKA 2IJKA 2IH1C 3RW0A 4EFEA 5LHHA 1M4UA 3OM3B 3CE2A 1MZFA 2Y69C 5EK0A 1YJNV 1QR9A 5IJ9A 2KQXA 5B3SC 3VQVA 3ZJZA 3JYCA 1VF6A 1RM1B 4K0KO 4NXMB 2N05A 4CS3A 3STLC 4DO2A 2FKXA 2ZNJA 1GM7A 4PDRA 3UM7A 3ETDA 1B06A 1TUBB 2D2CB 2HEPA 4JTDB 2XNDG 2DWEC 3OUSA 1VEWA 3APOA 3RVZA 4ZOLA 4O4JB 3S3WA 4GKKO 3CXCU 1YDXA 1BQ0A 4LF6O 3SR2C 2ATKC 1NJIW 2GSMB 4B3SO 1KKDA 4B3MB 2A3QA 3QO7A 4J9ZB 1D2DA 3K03A 5JWPA 1IDSA 2P7TC 3W7TA 2F95B 3K5LA 3RYFB 1H38A 4FFBA 1AI4A 4NYKA 3JD0A 1SA0A 5H5NA 2UXCB 3JSNA 1RSOB 4J80A 3DC5A 1X59A 3FAVA 2Q9LA 5LMNO 3OGCC 4TV9A 2AZ0A 2ADQB 1KQSU 2Z5UA 2LGQA 1VQMV 1VMGA 2Q7EA 1HW7A 3CCVV 3A0RA 1HNXB 3E8BA 5FNVA 3K5OA 4X65B 2NN4A 1XEQA 4QJFB 4JI4B 3RN4A 5JJJB 5J2TB 2H94A 1IXBA 4BW5A 3B2EE 1O9HA 3ZHTA 4YJ3A 2Q67A 3JATB 2RQ6A 1IXMA 3IGAC 2QKAA 5CA1A 3CRCA 4E4EA 2BSKB 2OIGA 4J9YB 3CD6V 2HJFC 1O9GA 5JQGA 2HVJC 1IBMB 3CRAA 4N21A 4WBNB 1VF7A 3ASOC 4JI1O 2W6IG 3AEIA 3RGBA 1FOUA 3B8MA 1I94B 5CMUA 1ZSPA 4X20A 2RMKB 2F93B 2ZM6O 4U3JA 1OZ0A 3KKYA 1N4CA 4X62O 1Z5WA 1Q43A 4ZHQB 1E1RG 2EJRA 2P90A 1RM1C 3OFNG 4UCUA 4OPAA 2KSDA 1Q6UA 2XUMA 1YF2A 2E75B 3OAAG 4UUJC 3OGIB 1BE3H 5BXZA 1E1QG 4EB6B 4DRXA 1NQTA 3JALA 1QVGU 2B1IA 1MG1A 1YSCA 3RBZA 3H1KH 4WF9V 5IJ0A 1I5YA 4RQFA 4K3AA 1AJNA 1YEWA 3OR6C 4YHHO 3THOA 3HKCA 3FB7C 4FLXA 4ICGA 4LFAB 4FK5C 1EN5A 2EILB 4DR6B 2H3OA 3CCSV 2F23A 4LP8A 4CH5A 4LFCO 1QLEB 2HG5C 4JF3A 5KHKA 3HPLC 3E22B 1QLNA 3K0GA 3WB0A 2Y0PA 4X66B 3ZCCA 4KUMA 4UCRA 5LL6Y 1SERA 4UV9A 1B3QA 1KKCA 1XNQB 1Y74A 1F4MA 5EBLC 2KB1A 4MTXA 2P4KA 4JYAO 1VQ6V 4X1IB 1ORQC 3TGUH 2RNBA 4PA4A 2WWWA 3AG1B 4IYIA 2LJ2A 1OCRB 3SGIA 3ABUA 4GZRB 1N8RW 3CSXA 1NBMG 4UVCA 2LFSA 4PJ0Z 4JYBA 5K1XA 2Q4PA 1H2GA 4N23A 1NH2D 3ZMUA 1TGOA 3SPJA 5BR8O 4YY3O 3K3WA 4Q20A 4TV8B 4O4JA 4DR4B 2GV9A 2BCCH 4A5UB 3KCYA 1PP9H 2AHZA 2BE3A 1ROPA 4TOIA 4D7TA 2Q5ZA 3OUFA 4FM2A 5JJNB 2YSUB 1SC5B 1PL0A 4JI7B 2DN9A 3FB6C 2Z0AA 2JRIA 1XMOO 4P2ZA 2IM9A 1M9NA 3RYFA 4NTYA 4LF5O 1N32O 1RSOA 3G80A 4O4LB 1IBKO 3JAWB 4JYCA 1FYJA 4I50B 2WLJA 1YHQV 1R6TA 1MNGA 2EILC 2NLJC 4H0LB 1KBHA 4J7KA 1G4YB 4I55B 2QJ1A 5KAFZ 1ZWIC 4R6ZA 1H2NA 2IJJA 4ZIBA 1XHXA 5E79Z 1ENVA 2IU3A 3LNNA 1FXVA 1BGYH 2UUAO 1S0VA 5LA6A 4O2AB 2QKSA 4MW3A 3T1HB 2CUGA 5LGNA 2QWPB 3DSQA 3F5TA 3ZRWB 4W4LA 2JIZG 3L73H 2OYQA 3AG1C 1YTFB 1OV9A 1OCRC 2Y4UA 1AP5A 4BW9A 3DXRA 3E8HA 2ZR3A 3UKMA 3HKBB 1M5IA 4GKJO 4IHJB 1MOFA 5KAIZ 3O65A 4NTXA 2HJDA 4WFEA 1HNZB 4DR2B 4FMTA 2EZPA 2YIDA 1B04A 1KMIZ 1BCCH 1GKFA 4CZZA 4JZGA 1OCOB 4FVMA 5C8YB 3G6BA 4X9QA 4EFBA 1RFYA 1EN6A 2F66C 5IWAB 1QU7A 1Q81W 4DR7O 1K4CC 2DW4A 1T5EA 3JAKA 4K8XA 1EM1A 1ZL8A 1IURA 1Y67A 5JVDB 1DGSA 4PELA 5L3DA 4DV7B 1WPBA 4ZBMA 3LSQA 4X89A 1Y76A 4DR3O 2ZXWB 2WLIB 5TISZ 3MHHC 1W2BU 3QVNA 3K06A 3ZHRA 3LDEA 3F7YC 1G1XB 3JASB 1ZX3A 2YXHA 5EYPB 1AI5A 4X88A 3G71V 2A9HA 1JR9A 1K9MW 1JQ0A 4TSFG 3ZN0A 2FYUH 3E83A 3S3XA 2XT9A 4JI8B 3KZIZ 3FAVB 5E1AC 1AR4A 3BFRA 4TV9B 4X1IA 1N0NA 2P22C 4UFZA 4JI5O 1GN6A 3K08A 1XNRO 1S77D 4JI2O 4U7NA 2EX3A 5LGTA 1MSDA 3AG2B 5CA0B 2JEXA 1Z5VA 2QTOA 2LGWA 3CCQV 2ZT9B 4UV8A 3SYAA 2HHHB 4H33A 2ZINA 4DV1B 1H2KA 4JI3B 2BTQB 1FJGO 5BMVB 4PDVA 4L8JA 1K7DA 5ITZB 5CA1B 1SQQH 3VQXA 2H8PC 1S5LZ 3SJCC 2OCCB 4NTWA 2UUBB 4KFMA 3ETGA 4TV8A 2GUZB 4FFKA 2NR5A 2Q8VA 5DM6V 3OMIB 1Q90D 3GVMA 4TQFA 4CH6A 2QDOA 2QA4V 1IBLO 3CHXA 3CX5F 3ML0A 4MVOA 3C3TA 4D7SA 1OCOC 1N34O 1SS3A 3MAQA 4O4LA 4PA3A 3JAWA 4I50A 3SDLA 4RWUA 1EZVH 3UO3A 4FLUA 3J7AU 2P4VA 2ZXWC 1U96A 4U7OA 4NXMO 4I55A 1VQNV 3BEHA 3D3IA 3E8GA 4JI0B 2ARHA 3K04A 5L3FA 2E5LB 3ETQA 4H44B 5EC1C 3KCXA 2Z3YA 4J7JA 2GTAA 5FPRA 1Q5OA 4X64B 1EZJA 2X6BA 2OT5A 3ABLB 4O2AA 2AZ2A 3SJAC 4DYLA 2P67A 1PV0A 1JJ2U 3ZRWA 2JGDB 1VQPV 4B3TO 5EBWC 4MS2A 1P4RA 3H1LH 4QE7A 3AG2C 2F4VB 1XILA 2PTMA 4I7ZB 4D6TH 2UXDB 1Q6IA 1TAEA 4LF8B 1M1KW 5DECA 1DF4A 3HKBA 3NXSA 5EBMC 4LF7B 4IHJA 1Y74B 5L3BA 5EIBD 3FB5C 1QBZA 2K9PA 1DLBA 2LFRA 3OT7A 3RVYA 3VOUA 2VQEB 1R3IC 5L3CA 4X65O 2OCCC 1XREA 2JS5A 1GM9A 3ZMTA 4JI4O 5C8YA 1J5EB 2EULA 3SPGA 1P7BA 4LF4B 2K1EA 2NNUA 2YUAA 1XQ8A 4LH6A 3ZEDA 2R9IA 1M93A 3K0DA 3T4ZA 5JVDA 4JV5B 4HBNA 1FPOA 1KP2A 3R65A 2CTQA 3T1CA 3J80N 3G6EV 4FLYA 3CRRA 2WLIA 1BSMA 1V54C 3JASA 4DW1A 5EYPA 5KLVH 1AB3A 2R72A 2WA4A 4DR5B 5B66Z 4W4KA 4L87A 1OCCB 2UUCO 3CRQA 3OTOO 4WFBV 3UO2A 2ZIOA 4DK1A 1R1BA 1E79G 4LCUC 1D5AA 5CA0A 2Y0IA 3ABTA 1SESA 2JS3A 1K4DC 2UU9B 3ABLC 1S5JA 2CGOA 3CP1A 3CS5A 4NKGB 4NXNB 2BTQA 2Y48A 3EVKA 5BMVA 4JGSA 3WU2Z 5ITZA 4OX9B 4I9QA 1CXZB 2BOBC 3AK2A 4LBEC 3QO8A 2YXYA 3CC2V 3MD0A 3G67A 1K5QA 3E89A 3A0HZ 1P49A 5HFMA 1JJOA 2EIMB 3ABKB 2W6JG 2GUZA 5LA6B 4E2LA 1BHAA 1NH2B 1HWYA 2E3CA 3BA9A 3K9SA 2JGUA 4DUYO 5IE9A 4PA6A 4K0KB 1H8EG 5LBQA 3TXQA 4EKWA 2VQFO 4KHPB 1WLEA 1HR0O 5KHIA 3P30A 1NI8A 5IYZB 4MVQA 3JSLA 5FL7G 3DXRB 1AR5A 2OTLV 2QGNA 3CCJV 3ASNB 3I5DA 2VRZA 2GDSA 1N33B 2WLHA 3CRMA 4GKKB 1V55B 3E8FA 1QHTA 2V7QG 3N2GB 3ABMB 4B3SB 1K73W 5H2FZ 2AHYA 1XUQA 3BPZA 3CWBH 4YJ2A 3K5MA 3L72H 3H1HH 2DMXA 4DV6O 1Q7YW 4XDKA 4O4IB 1AVMA 4B08A 3PN1A 4YXWG 3RYHB 4TQDA 4OGQB 3U0ZA 4FM0A 1LUWA 5LMNB 1VQ4V 1JFFB 1XI1A 3A8TA 2A0LA 3K79A 2JEUA 3JAKB 4DUZO 1AILA 2WLKA 1ZL8B 1M90W 5LXTB 1EN4A 1TVKB 4AQYO 4CS2A 1AI6A 2JVDA 1Y76B 1OCCC 3OEHG 1F51A 4P9OA 4UVBA 3E35A 1WB8A 2ZE8A 2JGDA 1AROP 1FFTB 1KB9F 2W0XA 3W7XA 2ZDIC 3RT3C 4NR1A 1SQPH 4JI1B 4J11A 5B5EZ 1HP8A 1KD1W 1YCIA 2GTSA 2ZM6B 4FPPA 1YIJV 4PA7A 3W7SA 2EIMC 5CN0A 3ABKC 2Q7HA 3ZIAG 1FXKB 5CBFA 2L35A 3JD2A 3EHBB 1XMQO 4BAYA 1ZAUA 2AW9A 3VQYA 4DV4O 1GO3F 2ILMA 2FMLA 3WB2A 3BVOA 4IIJB 1K97A 4K8ZA 3WG7B 1URFA 3ASNC 2YI9A 1QVFU 4BIOA 4DXWA 4JTAB 1CPYA 4UCOA 5KHJA 1VARA 1V55C 3T2MA 3ABMC 2CAZC 4FLTA 3FYEB 2GHYA 3OR7C 1M57B 2LW7A 2AGAA 3R66A 3X2QC 1VP7A 5D5QA 1ZTEA 2JJ1G 5GW7A 2RN9A 4R8CA 4JAAA 4MW8A 3H01A 1CEZA 3P32A 1Q6HA 5EC2C 2UXBO 4WFAV 3T4DA 3I55V 4CH4A 3F5WC 2ZDIA 4WCEV 3ZHUA 3CCMV 2DQ0A
chains in the Genus database with same CATH topology
2CE4A 1WB8A 1ZLZA 2CDYA 1ZSPA 4YIOA 3EVKA 1XILA 1AP5A 3AK2A 3KKYA 1I0HA 4YIPA 4GUNA 3AK3A 1N0JA 1XDCA 3OT7A 1B06A 1WB7A 1IX9A 3K9SA 4FFKA 3TJTA 1SZXA 3DC6A 1XREA 1GN2A 1VEWA 1ZUQA 2QKCA 1GN4A 4BR6A 4JZGA 4JYYA 1JA8A 1PL4A 4X9QA 1AR5A 1LUVA 2AW9A 1D5NA 3C3TA 1EN6A 2GDSA 1PM9A 3CEIA 1IDSA 1EM1A 1MA1A 1Y67A 1XUQA 3DC5A 1EN5A 5AG2A 4F6EA 1VARA 1BSMA 2ADQB 1AVMA 3IC9A 1MNGA 1BS3A 3QVNA 2RCVA 2ADPA 3KDRA 3MDSA 1I08A 1LUWA 1JR9A 1QNMA 1ZTEA 3RN4A 1IXBA 1BT8A 1GN3A 1AP6A 5A9GA 1KKCA 4JZ2A 1EN4A 2QKAA 4E4EA 3C3SA 1P7GA 3LSUA 2P4KA 1AR4A 3AK1A 3BFRA 1N0NA 4C7UA 1MMMA 1GN6A 1MSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CE4 A;  1WB8 A;  1ZLZ A;  2CDY A;  1ZSP A;  4YIO A;  3EVK A;  1XIL A;  1AP5 A;  3AK2 A;  3KKY A;  1I0H A;  4YIP A;  4GUN A;  3AK3 A;  1N0J A;  1XDC A;  3OT7 A;  1B06 A;  1WB7 A;  1IX9 A;  3K9S A;  4FFK A;  3TJT A;  1SZX A;  3DC6 A;  1XRE A;  1GN2 A;  1VEW A;  1ZUQ A;  2QKC A;  1GN4 A;  4BR6 A;  4JZG A;  4JYY A;  1JA8 A;  1PL4 A;  4X9Q A;  1AR5 A;  1LUV A;  2AW9 A;  1D5N A;  3C3T A;  1EN6 A;  2GDS A;  1PM9 A;  3CEI A;  1IDS A;  1EM1 A;  1MA1 A;  1Y67 A;  1XUQ A;  3DC5 A;  1EN5 A;  5AG2 A;  4F6E A;  1VAR A;  1BSM A;  2ADQ B;  1AVM A;  3IC9 A;  1MNG A;  1BS3 A;  3QVN A;  2RCV A;  2ADP A;  3MDS A;  1I08 A;  1LUW A;  1JR9 A;  1QNM A;  1ZTE A;  3RN4 A;  1IXB A;  1BT8 A;  1GN3 A;  1AP6 A;  5A9G A;  1KKC A;  4JZ2 A;  1EN4 A;  2QKA A;  4E4E A;  3C3S A;  1P7G A;  3LSU A;  2P4K A;  1AR4 A;  3AK1 A;  3BFR A;  1N0N A;  4C7U A;  1MMM A;  1GN6 A;  1MSD A; 
#chains in the Genus database with same CATH topology
 2CE4 A;  2MW2 B;  1ZLZ A;  3GWK C;  1WAZ A;  1RP3 B;  1YXB A;  5IWA O;  4R7C A;  1Q3E A;  4DV2 B;  2E74 B;  2XOK G;  4JYA B;  4MTG A;  5GTI Z;  1G6U A;  4HNA B;  1SQF A;  1F7Y A;  4DR1 O;  3CJH B;  5KHH A;  2AXT Z;  4X8A A;  3Q4H B;  4GX0 A;  2QR4 A;  4WFF A;  4CC5 A;  3H1J H;  5B1A B;  4CBC A;  1YZB A;  4KL1 A;  2Q68 A;  4ZI7 A;  4J42 A;  1H2M A;  3RFR A;  1Y66 A;  4UVA A;  2JDI G;  3FB8 C;  5IYZ A;  5DED A;  2QKC A;  2X7R B;  2KKW A;  1PL4 A;  2RJZ A;  4LFB B;  3LDD A;  4G2K A;  4LF9 O;  1FXK C;  1D5N A;  5B1O A;  1XBL A;  3NR7 A;  4FJC C;  3K57 A;  2A06 H;  3E86 A;  4LH7 A;  3LUT B;  4DV0 B;  4DV5 B;  3N2G A;  4RO2 A;  1NS1 A;  2PYJ A;  1J95 A;  2WLL B;  5DN6 G;  1NT2 B;  5B1N A;  4O4I A;  2F1M A;  2A79 B;  3WG7 C;  1XMO B;  3J81 N;  2Q73 A;  4DV1 O;  3ZHV A;  4JI3 O;  5IDJ A;  3RYH A;  4LF5 B;  2PI4 A;  2EIN B;  3IC7 A;  3TCU A;  5BY1 A;  5IYB O;  2ADP A;  3TET A;  2ITD C;  3MDS A;  5KA6 A;  1JFF A;  2PUS A;  3L9D A;  1M57 C;  1WP8 A;  2QM8 A;  3B4S A;  1YJ9 V;  5LXT A;  3OMN B;  1TVK A;  5A9G A;  2QSA A;  1LNQ A;  4FLZ A;  4LWS B;  5IYC O;  2LW1 A;  5D5P A;  3C90 A;  1NZ6 A;  1WP7 A;  3OW2 U;  4BWA A;  4B3R O;  4PI2 A;  4JTC B;  2HFE C;  1YJW V;  1VQ8 V;  4PHZ A;  4TT3 G;  3CMA V;  4O2B A;  4QIW F;  4YIO A;  3SJB C;  3LSS A;  1X4T A;  4HYO A;  2N74 A;  5KX5 B;  2ZKO A;  2HKO A;  3GWO A;  4IT5 A;  3H1I H;  4RUF A;  3WFV A;  2EIJ B;  1F4N A;  4XBF A;  2D3O W;  2Y4T A;  1XDC A;  5KUK A;  1WB7 A;  2R70 A;  5B1A C;  3SYQ A;  1P84 F;  1FXK A;  1GN2 A;  5LMU O;  3RYC B;  1G8M A;  4JI0 O;  4QPJ A;  1JA8 A;  1BQZ A;  3D3Q A;  3W7W A;  1LUV A;  2LO1 A;  1NKD A;  1UPG A;  2MK3 A;  1VIB A;  4IIJ A;  4RQE A;  4X64 O;  3CEI A;  1PD3 A;  4NB5 A;  4UCT A;  2X6C A;  2WAM A;  3SJQ C;  2P6J A;  4X1Y B;  3L71 H;  3BCC H;  2YIC A;  3W7U A;  3WB1 A;  4DR7 B;  3U11 A;  4JI6 O;  2UXD O;  1B6Q A;  3GB7 C;  3HKD A;  3QNE A;  3CXH F;  4LF7 O;  5H6R A;  2UXN A;  2Q0A A;  4AI8 A;  2EIN C;  1U97 A;  1HNW B;  2QTS A;  2C2A A;  1V54 B;  3CCL V;  5LGU A;  4PDM A;  1AP6 A;  4UCV A;  4R50 A;  4JZ2 A;  3ZS8 C;  5FPO A;  2VQE O;  2B9Z A;  4YJ2 B;  1KYO F;  4I4T B;  1XL6 A;  1P7G A;  3L75 H;  3DTU B;  1OHH G;  4DK0 A;  3D36 C;  4IL6 Z;  1S3J A;  2CK3 G;  4C7U A;  4HAM A;  2G38 A;  2IU0 A;  1SET A;  1FS0 G;  3M7M X;  1PKX A;  3D8C A;  4PV1 B;  4HNA A;  3CJH A;  2JK5 C;  1MSW D;  2Q69 A;  4JI5 B;  3Q4H A;  5JH7 A;  2WA3 A;  4JI2 B;  2ZQM A;  2PY5 A;  2YS8 A;  4PA9 A;  3FKS G;  4CS4 A;  4K35 A;  1SQG A;  4I0X B;  3UCS C;  1TUE B;  1FJG B;  1VQK V;  2RDC A;  4B3M O;  5EIB C;  3K59 A;  2V4D A;  2R9R B;  2ZE5 A;  2EIJ C;  4MVZ A;  4DR5 O;  4U3F H;  1UFI A;  2WPD G;  1XHZ A;  2R9A A;  2UXC O;  5LYJ B;  3CME V;  3AG4 B;  1Q86 W;  1FD9 A;  1I7F A;  2EZO A;  1TA8 A;  1VQ9 V;  1QR8 A;  1W59 A;  1F23 A;  1FFX B;  2WLL A;  3ZHQ A;  1HNX O;  3I56 V;  2QM7 A;  4J7Z A;  4I9W A;  3RYI B;  3T1Y B;  4NXN O;  5IYD O;  4HZ3 A;  1OJH A;  2YEV B;  1N34 B;  2E76 B;  3QTC A;  2RCV A;  4CH3 A;  3KDR A;  3N27 A;  5C93 A;  1A32 A;  4GT1 A;  1YI2 V;  5BZB A;  4ASU G;  3CB2 A;  5B1B B;  3D36 A;  1IBM O;  3ZX6 A;  2ZCE A;  1JOY A;  4BIU A;  4LWS A;  5IT9 N;  3SYP A;  2B1G A;  3RWR D;  4H37 A;  1I94 O;  2QWO B;  3LSU A;  4KHP O;  3ETE A;  2XAH A;  5LHG A;  5CBH A;  4DV3 B;  3CPW U;  1K5S A;  3JCZ A;  2EJ7 A;  3JAM N;  5LOV B;  3HB3 B;  5H6Q A;  1MAB G;  3HKE A;  2DYS B;  2OIE A;  1SQB H;  1N33 O;  4RUE A;  1Y4M A;  5KX5 A;  2ODM A;  1N36 B;  3UQ8 A;  2DOS A;  4QE9 A;  4F6R B;  1I0H A;  5KUM A;  4GUN A;  1MZE A;  1L0L H;  2YXL A;  4B3T B;  4KXR A;  3CC7 V;  5CB4 B;  4PI0 A;  4O4H B;  3JAR B;  1IX9 A;  4IGG A;  3A0B Z;  4IYH A;  4J41 A;  5J2U A;  2PGG A;  1V9P A;  2KG7 B;  3RYC A;  3L70 H;  3BRC A;  4FIP C;  2BTO A;  3B77 A;  1WJZ A;  3KG2 A;  1NVP D;  1PNL A;  1XL4 A;  1VQL V;  2WLN A;  1L8D A;  4LFA O;  3IJ4 A;  4JAV A;  4DR6 O;  1EBO A;  1PM9 A;  1FAF A;  1SF9 A;  2L6L A;  4QGP A;  4ZI7 B;  3APQ A;  5KHG A;  3AG4 C;  1MA1 A;  4X1Y A;  2IW5 A;  1KU9 A;  1S5H C;  5AG2 A;  4H13 B;  4AIL C;  4X66 O;  2DWD C;  4XDJ A;  5LP6 B;  3IC9 A;  2OCH A;  1WN7 A;  2XAF A;  3F7V C;  2B5U A;  3CCU V;  1XNQ O;  3CCE V;  2VWJ A;  1I08 A;  3UT5 B;  2QM4 A;  1NR7 A;  1I5X A;  1VQ5 V;  1QNM A;  3G4S V;  1COW G;  2DJV A;  4LF6 B;  3EXA A;  1JVM A;  4I4T A;  1KC8 W;  4G28 B;  1Q82 W;  5B1B C;  3ZHS A;  4EEQ A;  2DYR B;  5FLX N;  4MT8 A;  2P5O A;  3X2Q B;  3ZMV A;  1NTM H;  1DF5 A;  4MVR A;  1K3E A;  2UUC B;  3OTO B;  2CDY A;  4TUY B;  1XOU A;  4PDL A;  4CC6 A;  2Q0O C;  4Z1V A;  4GYC B;  4QNH B;  2CH7 B;  4RAI A;  1FKA O;  1VF5 B;  2PI5 A;  5IY5 B;  2DYS C;  2Q6A A;  4I0X A;  4DR4 O;  4G27 B;  2HLD G;  5JJE B;  3PJS K;  4LC1 A;  1RPR A;  3L74 H;  1UJW B;  1SZX A;  4JI7 O;  4O2B B;  1GN4 A;  4BR6 A;  4FZ1 A;  3SPC A;  1BMF G;  2V1D A;  3QO5 A;  5EZY B;  3AG3 B;  5LYJ A;  1KP3 A;  5F2V O;  1AR1 B;  1GAX A;  4DUY B;  4J10 A;  3M8A A;  2IH3 C;  1GH6 A;  2VQF B;  1FFX A;  1GTO A;  1HR0 B;  5J9P C;  2X0L A;  2YIB D;  3EFF K;  2HP8 A;  5GTH Z;  1US6 A;  3RYI A;  4X62 B;  3M99 B;  1DK1 A;  2YEV A;  5CA3 A;  4DV2 O;  4B7E A;  1K92 A;  4XDL A;  1L0N H;  3IAY A;  2QWQ B;  1YIT V;  1R3K C;  5LP6 C;  2LQT A;  4PD4 F;  1L1F A;  4DV6 B;  4MVU A;  3ZRS A;  3ZRX A;  1IVS A;  3CYO A;  4AHC A;  1K34 A;  4NVP A;  4JAS A;  5L3G A;  5GON B;  3T1H O;  2FL4 A;  3CC4 V;  2YI8 A;  2XTA A;  4LR3 A;  2BOC C;  3A2F A;  1IZ3 A;  1WA8 B;  3AK1 A;  4OXS A;  1KUQ A;  1SKV A;  2YDE A;  4X1K B;  4YHH B;  3O9O A;  5KMG B;  1TUB A;  5LOV A;  3BAB A;  4DUZ B;  4WFG A;  2DYR C;  3HKD B;  4LFB O;  2O57 A;  4MSW C;  2M7W A;  3FYI B;  3LDC A;  2M6Y A;  1H8H G;  4AQY B;  1H2S B;  2P06 A;  4LFC B;  3K5N A;  4DV0 O;  4DV5 O;  3SPI A;  1GMG A;  1HNZ O;  4F6R A;  2PF4 E;  1Q8I A;  1VQ7 V;  4DR2 O;  1THZ A;  2ZE6 A;  3LNM B;  5L3E A;  3B09 A;  1PNK A;  5CB4 A;  4UB8 Z;  1N0J A;  4O4H A;  1W0J G;  2YIB A;  3JAR A;  5IY5 C;  1K8A W;  2ZR2 A;  3JD3 A;  2KG7 A;  2GBO A;  2XHB A;  2ZE7 A;  1SQX H;  3DC6 A;  1R3J C;  4I5S A;  3TXS A;  1BZK A;  1R6N A;  3JD1 A;  1S76 D;  5JH7 B;  4DV7 O;  2XAJ A;  1AJQ A;  4KP4 A;  3AG3 C;  3U10 A;  5J2T A;  1GM8 A;  1QLE C;  4LNU B;  3JAT A;  1R3L C;  1XMQ B;  2CTW A;  5CBG A;  2BSK A;  4P30 A;  4F6E A;  4DV4 B;  5LP6 A;  3B8N A;  3BA8 A;  2VS0 A;  4WBN A;  1NTZ H;  1FXH A;  3CCR V;  4JI8 O;  4MTF A;  3UT5 A;  5BR8 B;  4YY3 B;  3ZN1 A;  1H2L A;  2XAS A;  4Z2W A;  1GK9 A;  3BAA A;  5H9C A;  3FFQ A;  3P3P A;  3SPH A;  1OCZ B;  4GCZ A;  2VWK A;  3JD4 A;  2HHH O;  2LP7 A;  1IJG A;  3HR0 A;  1W0K G;  1SZT A;  4ZHQ A;  2EBO A;  3H9V A;  4Q6G A;  1BL8 A;  3SYO A;  1N32 B;  2CTR A;  3N2K B;  1IBK B;  4DW0 A;  4TUY A;  2PZS A;  2ZIM A;  2UXB B;  4ABM A;  5JCO C;  2EIK B;  2OTJ V;  4EB6 A;  2CH7 A;  2HVK C;  5A2Q N;  3OMA B;  2UUB O;  1WNS A;  2QWN B;  4WFH A;  2ETN A;  1PNM A;  2CGN A;  2F43 G;  5IJ9 B;  4GX5 A;  2ZD9 A;  5HFL A;  2N04 A;  2DE0 X;  3AG7 A;  4DR1 B;  3TJT A;  3HKE B;  1JPX A;  1ZUQ A;  5EZY A;  3OE7 G;  2UUA B;  1HNW O;  2FTK A;  4ZOL B;  4JYY A;  3OTF A;  3MHS C;  3E22 A;  1CP9 A;  1NU1 H;  3QF7 A;  2DQ3 A;  3VBB A;  3B40 A;  5J2U B;  2X6A A;  2QEX V;  2UXX A;  4OPH A;  4LF9 B;  4FFB B;  1SA0 B;  3STZ C;  3ZMZ A;  2IBZ H;  1RPO A;  4GKJ B;  3E2E A;  3FX7 A;  2E5L O;  1LR1 A;  2A7W A;  3SYC A;  1HDJ A;  2YC0 A;  4GX1 A;  3VQW A;  5FNV B;  1KEC A;  3K9A A;  1AI7 A;  1WPX A;  1M56 B;  1R73 A;  2QE7 G;  1BT8 A;  5GON A;  1S72 V;  1DTO A;  3DGE A;  1QCE A;  1R6K A;  4YJ3 B;  3C3S A;  1WA8 A;  1PPJ H;  5JCO A;  3BHP A;  4X1K A;  1OCZ C;  3K58 A;  5KMG A;  2F4V O;  5JQG B;  5KA5 A;  2Y69 B;  1Z2G A;  4LF8 O;  4B7K A;  5B3S B;  4GX2 A;  4DR3 B;  2ITC C;  4F4L A;  1NTK H;  4X20 B;  1YTF D;  3IFX A;  2ZNI A;  2EIK C;  4U3J B;  4B3R B;  4MVM A;  4YIP A;  1NR1 A;  3AK3 A;  1SRY A;  3T1Y O;  3ZMS A;  4FZ0 A;  1J5E O;  1H5W A;  5LHI A;  2WSS G;  3BY6 A;  1GRJ A;  2OWO A;  3P3N A;  2W0F C;  1VF6 C;  4LF4 O;  3ICX A;  4JPR A;  2JJ2 G;  4UB6 Z;  5K1P A;  4QPK A;  1QQC A;  2CTP A;  1AJP A;  2IJI A;  1NVP B;  1XNR B;  4JV5 O;  4DRX B;  3JAL B;  4FLW A;  2QWR B;  1YVW A;  3JCU Z;  4LNU A;  1JNB A;  2YIA A;  1BHB A;  5LMU B;  4FM1 A;  2HR3 A;  4MTO A;  5IJ0 B;  3ZBH A;  2IJH A;  2XAG A;  4BIZ A;  4DV3 O;  4FLV A;  4Z1M G;  3HKC B;  4GLX A;  1Y6X A;  1JCH A;  3QG5 A;  4MVS A;  1K33 A;  3ZRV A;  2WLM A;  4JAU A;  1BS3 A;  1N36 O;  2PYL A;  1JX9 A;  4P9P A;  4UXN A;  1GN3 A;  2FB5 A;  4JI6 B;  1IBL B;  2Q7G A;  3OEE G;  4UCS A;  4ZKI A;  2XAQ A;  3ASO B;  1M56 C;  2UU9 O;  1VQO V;  1JMK C;  3TK1 A;  1EFR G;  3FD9 A;  3N2K A;  4OX9 O;  1SQV H;  1MMM A;  3OD4 A;  4TWK A;  2IJK A;  2IH1 C;  3RW0 A;  4EFE A;  5LHH A;  1M4U A;  3OM3 B;  3CE2 A;  1MZF A;  2Y69 C;  5EK0 A;  1YJN V;  1QR9 A;  5IJ9 A;  2KQX A;  5B3S C;  3VQV A;  3ZJZ A;  3JYC A;  1VF6 A;  1RM1 B;  4K0K O;  4NXM B;  2N05 A;  4CS3 A;  3STL C;  4DO2 A;  2FKX A;  2ZNJ A;  1GM7 A;  4PDR A;  3UM7 A;  3ETD A;  1B06 A;  1TUB B;  2D2C B;  2HEP A;  4JTD B;  2XND G;  2DWE C;  3OUS A;  1VEW A;  3APO A;  3RVZ A;  4ZOL A;  4O4J B;  3S3W A;  4GKK O;  3CXC U;  1YDX A;  1BQ0 A;  4LF6 O;  3SR2 C;  2ATK C;  1NJI W;  2GSM B;  4B3S O;  1KKD A;  4B3M B;  2A3Q A;  3QO7 A;  4J9Z B;  1D2D A;  3K03 A;  5JWP A;  1IDS A;  2P7T C;  3W7T A;  2F95 B;  3K5L A;  3RYF B;  1H38 A;  4FFB A;  1AI4 A;  4NYK A;  3JD0 A;  1SA0 A;  5H5N A;  2UXC B;  3JSN A;  1RSO B;  4J80 A;  3DC5 A;  1X59 A;  3FAV A;  2Q9L A;  5LMN O;  3OGC C;  4TV9 A;  2AZ0 A;  2ADQ B;  1KQS U;  2Z5U A;  2LGQ A;  1VQM V;  1VMG A;  2Q7E A;  1HW7 A;  3CCV V;  3A0R A;  1HNX B;  3E8B A;  5FNV A;  3K5O A;  4X65 B;  2NN4 A;  1XEQ A;  4QJF B;  4JI4 B;  3RN4 A;  5JJJ B;  5J2T B;  2H94 A;  1IXB A;  4BW5 A;  3B2E E;  1O9H A;  3ZHT A;  4YJ3 A;  2Q67 A;  3JAT B;  2RQ6 A;  1IXM A;  3IGA C;  2QKA A;  5CA1 A;  3CRC A;  4E4E A;  2BSK B;  2OIG A;  4J9Y B;  3CD6 V;  2HJF C;  1O9G A;  5JQG A;  2HVJ C;  1IBM B;  3CRA A;  4N21 A;  4WBN B;  1VF7 A;  3ASO C;  4JI1 O;  2W6I G;  3AEI A;  3RGB A;  1FOU A;  3B8M A;  1I94 B;  5CMU A;  1ZSP A;  4X20 A;  2RMK B;  2F93 B;  2ZM6 O;  4U3J A;  1OZ0 A;  3KKY A;  1N4C A;  4X62 O;  1Z5W A;  1Q43 A;  4ZHQ B;  1E1R G;  2EJR A;  2P90 A;  1RM1 C;  3OFN G;  4UCU A;  4OPA A;  2KSD A;  1Q6U A;  2XUM A;  1YF2 A;  2E75 B;  3OAA G;  4UUJ C;  3OGI B;  1BE3 H;  5BXZ A;  1E1Q G;  4EB6 B;  4DRX A;  1NQT A;  3JAL A;  1QVG U;  2B1I A;  1MG1 A;  1YSC A;  3RBZ A;  3H1K H;  4WF9 V;  5IJ0 A;  1I5Y A;  4RQF A;  4K3A A;  1AJN A;  1YEW A;  3OR6 C;  4YHH O;  3THO A;  3HKC A;  3FB7 C;  4FLX A;  4ICG A;  4LFA B;  4FK5 C;  1EN5 A;  2EIL B;  4DR6 B;  2H3O A;  3CCS V;  2F23 A;  4LP8 A;  4CH5 A;  4LFC O;  1QLE B;  2HG5 C;  4JF3 A;  5KHK A;  3HPL C;  3E22 B;  1QLN A;  3K0G A;  3WB0 A;  2Y0P A;  4X66 B;  3ZCC A;  4KUM A;  4UCR A;  5LL6 Y;  1SER A;  4UV9 A;  1B3Q A;  1KKC A;  1XNQ B;  1Y74 A;  1F4M A;  5EBL C;  2KB1 A;  4MTX A;  2P4K A;  4JYA O;  1VQ6 V;  4X1I B;  1ORQ C;  3TGU H;  2RNB A;  4PA4 A;  2WWW A;  3AG1 B;  4IYI A;  2LJ2 A;  1OCR B;  3SGI A;  3ABU A;  4GZR B;  1N8R W;  3CSX A;  1NBM G;  4UVC A;  2LFS A;  4PJ0 Z;  4JYB A;  5K1X A;  2Q4P A;  1H2G A;  4N23 A;  1NH2 D;  3ZMU A;  1TGO A;  3SPJ A;  5BR8 O;  4YY3 O;  3K3W A;  4Q20 A;  4TV8 B;  4O4J A;  4DR4 B;  2GV9 A;  2BCC H;  4A5U B;  3KCY A;  1PP9 H;  2AHZ A;  2BE3 A;  1ROP A;  4TOI A;  4D7T A;  2Q5Z A;  3OUF A;  4FM2 A;  5JJN B;  2YSU B;  1SC5 B;  1PL0 A;  4JI7 B;  2DN9 A;  3FB6 C;  2Z0A A;  2JRI A;  1XMO O;  4P2Z A;  2IM9 A;  1M9N A;  3RYF A;  4NTY A;  4LF5 O;  1N32 O;  1RSO A;  3G80 A;  4O4L B;  1IBK O;  3JAW B;  4JYC A;  1FYJ A;  4I50 B;  2WLJ A;  1YHQ V;  1R6T A;  1MNG A;  2EIL C;  2NLJ C;  4H0L B;  1KBH A;  4J7K A;  1G4Y B;  4I55 B;  2QJ1 A;  5KAF Z;  1ZWI C;  4R6Z A;  1H2N A;  2IJJ A;  4ZIB A;  1XHX A;  5E79 Z;  1ENV A;  2IU3 A;  3LNN A;  1FXV A;  1BGY H;  2UUA O;  1S0V A;  5LA6 A;  4O2A B;  2QKS A;  4MW3 A;  3T1H B;  2CUG A;  5LGN A;  2QWP B;  3DSQ A;  3F5T A;  3ZRW B;  4W4L A;  2JIZ G;  3L73 H;  2OYQ A;  3AG1 C;  1YTF B;  1OV9 A;  1OCR C;  2Y4U A;  1AP5 A;  4BW9 A;  3DXR A;  3E8H A;  2ZR3 A;  3UKM A;  3HKB B;  1M5I A;  4GKJ O;  4IHJ B;  1MOF A;  5KAI Z;  3O65 A;  4NTX A;  2HJD A;  4WFE A;  1HNZ B;  4DR2 B;  4FMT A;  2EZP A;  2YID A;  1B04 A;  1KMI Z;  1BCC H;  1GKF A;  4CZZ A;  4JZG A;  1OCO B;  4FVM A;  5C8Y B;  3G6B A;  4X9Q A;  4EFB A;  1RFY A;  1EN6 A;  2F66 C;  5IWA B;  1QU7 A;  1Q81 W;  4DR7 O;  1K4C C;  2DW4 A;  1T5E A;  3JAK A;  4K8X A;  1EM1 A;  1ZL8 A;  1IUR A;  1Y67 A;  5JVD B;  1DGS A;  4PEL A;  5L3D A;  4DV7 B;  1WPB A;  4ZBM A;  3LSQ A;  4X89 A;  1Y76 A;  4DR3 O;  2ZXW B;  2WLI B;  5TIS Z;  3MHH C;  1W2B U;  3QVN A;  3K06 A;  3ZHR A;  3LDE A;  3F7Y C;  1G1X B;  3JAS B;  1ZX3 A;  2YXH A;  5EYP B;  1AI5 A;  4X88 A;  3G71 V;  2A9H A;  1JR9 A;  1K9M W;  1JQ0 A;  4TSF G;  3ZN0 A;  2FYU H;  3E83 A;  3S3X A;  2XT9 A;  4JI8 B;  3KZI Z;  3FAV B;  5E1A C;  1AR4 A;  3BFR A;  4TV9 B;  4X1I A;  1N0N A;  2P22 C;  4UFZ A;  4JI5 O;  1GN6 A;  3K08 A;  1XNR O;  1S77 D;  4JI2 O;  4U7N A;  2EX3 A;  5LGT A;  1MSD A;  3AG2 B;  5CA0 B;  2JEX A;  1Z5V A;  2QTO A;  2LGW A;  3CCQ V;  2ZT9 B;  4UV8 A;  3SYA A;  2HHH B;  4H33 A;  2ZIN A;  4DV1 B;  1H2K A;  4JI3 B;  2BTQ B;  1FJG O;  5BMV B;  4PDV A;  4L8J A;  1K7D A;  5ITZ B;  5CA1 B;  1SQQ H;  3VQX A;  2H8P C;  1S5L Z;  3SJC C;  2OCC B;  4NTW A;  2UUB B;  4KFM A;  3ETG A;  4TV8 A;  2GUZ B;  4FFK A;  2NR5 A;  2Q8V A;  5DM6 V;  3OMI B;  1Q90 D;  3GVM A;  4TQF A;  4CH6 A;  2QDO A;  2QA4 V;  1IBL O;  3CHX A;  3CX5 F;  3ML0 A;  4MVO A;  3C3T A;  4D7S A;  1OCO C;  1N34 O;  1SS3 A;  3MAQ A;  4O4L A;  4PA3 A;  3JAW A;  4I50 A;  3SDL A;  4RWU A;  1EZV H;  3UO3 A;  4FLU A;  3J7A U;  2P4V A;  2ZXW C;  1U96 A;  4U7O A;  4NXM O;  4I55 A;  1VQN V;  3BEH A;  3D3I A;  3E8G A;  4JI0 B;  2ARH A;  3K04 A;  5L3F A;  2E5L B;  3ETQ A;  4H44 B;  5EC1 C;  3KCX A;  2Z3Y A;  4J7J A;  2GTA A;  5FPR A;  1Q5O A;  4X64 B;  1EZJ A;  2X6B A;  2OT5 A;  3ABL B;  4O2A A;  2AZ2 A;  3SJA C;  4DYL A;  2P67 A;  1PV0 A;  1JJ2 U;  3ZRW A;  2JGD B;  1VQP V;  4B3T O;  5EBW C;  4MS2 A;  1P4R A;  3H1L H;  4QE7 A;  3AG2 C;  2F4V B;  1XIL A;  2PTM A;  4I7Z B;  4D6T H;  2UXD B;  1Q6I A;  1TAE A;  4LF8 B;  1M1K W;  5DEC A;  1DF4 A;  3HKB A;  3NXS A;  5EBM C;  4LF7 B;  4IHJ A;  1Y74 B;  5L3B A;  5EIB D;  3FB5 C;  1QBZ A;  2K9P A;  1DLB A;  2LFR A;  3OT7 A;  3RVY A;  3VOU A;  2VQE B;  1R3I C;  5L3C A;  4X65 O;  2OCC C;  1XRE A;  2JS5 A;  1GM9 A;  3ZMT A;  4JI4 O;  5C8Y A;  1J5E B;  2EUL A;  3SPG A;  1P7B A;  4LF4 B;  2K1E A;  2NNU A;  2YUA A;  1XQ8 A;  4LH6 A;  3ZED A;  2R9I A;  1M93 A;  3K0D A;  3T4Z A;  5JVD A;  4JV5 B;  4HBN A;  1FPO A;  1KP2 A;  3R65 A;  2CTQ A;  3T1C A;  3J80 N;  3G6E V;  4FLY A;  3CRR A;  2WLI A;  1BSM A;  1V54 C;  3JAS A;  4DW1 A;  5EYP A;  5KLV H;  1AB3 A;  2R72 A;  2WA4 A;  4DR5 B;  5B66 Z;  4W4K A;  4L87 A;  1OCC B;  2UUC O;  3CRQ A;  3OTO O;  4WFB V;  3UO2 A;  2ZIO A;  4DK1 A;  1R1B A;  1E79 G;  4LCU C;  1D5A A;  5CA0 A;  2Y0I A;  3ABT A;  1SES A;  2JS3 A;  1K4D C;  2UU9 B;  3ABL C;  1S5J A;  2CGO A;  3CP1 A;  3CS5 A;  4NKG B;  4NXN B;  2BTQ A;  2Y48 A;  3EVK A;  5BMV A;  4JGS A;  3WU2 Z;  5ITZ A;  4OX9 B;  4I9Q A;  1CXZ B;  2BOB C;  3AK2 A;  4LBE C;  3QO8 A;  2YXY A;  3CC2 V;  3MD0 A;  3G67 A;  1K5Q A;  3E89 A;  3A0H Z;  1P49 A;  5HFM A;  1JJO A;  2EIM B;  3ABK B;  2W6J G;  2GUZ A;  5LA6 B;  4E2L A;  1BHA A;  1NH2 B;  1HWY A;  2E3C A;  3BA9 A;  3K9S A;  2JGU A;  4DUY O;  5IE9 A;  4PA6 A;  4K0K B;  1H8E G;  5LBQ A;  3TXQ A;  4EKW A;  2VQF O;  4KHP B;  1WLE A;  1HR0 O;  5KHI A;  3P30 A;  1NI8 A;  5IYZ B;  4MVQ A;  3JSL A;  5FL7 G;  3DXR B;  1AR5 A;  2OTL V;  2QGN A;  3CCJ V;  3ASN B;  3I5D A;  2VRZ A;  2GDS A;  1N33 B;  2WLH A;  3CRM A;  4GKK B;  1V55 B;  3E8F A;  1QHT A;  2V7Q G;  3N2G B;  3ABM B;  4B3S B;  1K73 W;  5H2F Z;  2AHY A;  1XUQ A;  3BPZ A;  3CWB H;  4YJ2 A;  3K5M A;  3L72 H;  3H1H H;  2DMX A;  4DV6 O;  1Q7Y W;  4XDK A;  4O4I B;  1AVM A;  4B08 A;  3PN1 A;  4YXW G;  3RYH B;  4TQD A;  4OGQ B;  3U0Z A;  4FM0 A;  1LUW A;  5LMN B;  1VQ4 V;  1JFF B;  1XI1 A;  3A8T A;  2A0L A;  3K79 A;  2JEU A;  3JAK B;  4DUZ O;  1AIL A;  2WLK A;  1ZL8 B;  1M90 W;  5LXT B;  1EN4 A;  1TVK B;  4AQY O;  4CS2 A;  1AI6 A;  2JVD A;  1Y76 B;  1OCC C;  3OEH G;  1F51 A;  4P9O A;  4UVB A;  3E35 A;  1WB8 A;  2ZE8 A;  2JGD A;  1ARO P;  1FFT B;  1KB9 F;  2W0X A;  3W7X A;  2ZDI C;  3RT3 C;  4NR1 A;  1SQP H;  4JI1 B;  4J11 A;  5B5E Z;  1HP8 A;  1KD1 W;  1YCI A;  2GTS A;  2ZM6 B;  4FPP A;  1YIJ V;  4PA7 A;  3W7S A;  2EIM C;  5CN0 A;  3ABK C;  2Q7H A;  3ZIA G;  1FXK B;  5CBF A;  2L35 A;  3JD2 A;  3EHB B;  1XMQ O;  4BAY A;  1ZAU A;  2AW9 A;  3VQY A;  4DV4 O;  1GO3 F;  2ILM A;  2FML A;  3WB2 A;  3BVO A;  4IIJ B;  1K97 A;  4K8Z A;  3WG7 B;  1URF A;  3ASN C;  2YI9 A;  1QVF U;  4BIO A;  4DXW A;  4JTA B;  1CPY A;  4UCO A;  5KHJ A;  1VAR A;  1V55 C;  3T2M A;  3ABM C;  2CAZ C;  4FLT A;  3FYE B;  2GHY A;  3OR7 C;  1M57 B;  2LW7 A;  2AGA A;  3R66 A;  3X2Q C;  1VP7 A;  5D5Q A;  1ZTE A;  2JJ1 G;  5GW7 A;  2RN9 A;  4R8C A;  4JAA A;  4MW8 A;  3H01 A;  1CEZ A;  3P32 A;  1Q6H A;  5EC2 C;  2UXB O;  4WFA V;  3T4D A;  3I55 V;  4CH4 A;  3F5W C;  2ZDI A;  4WCE V;  3ZHU A;  3CCM V;  2DQ0 A; 
#chains in the Genus database with same CATH homology
 2CE4 A;  1WB8 A;  1ZLZ A;  2CDY A;  1ZSP A;  4YIO A;  3EVK A;  1XIL A;  1AP5 A;  3AK2 A;  3KKY A;  1I0H A;  4YIP A;  4GUN A;  3AK3 A;  1N0J A;  1XDC A;  3OT7 A;  1B06 A;  1WB7 A;  1IX9 A;  3K9S A;  4FFK A;  3TJT A;  1SZX A;  3DC6 A;  1XRE A;  1GN2 A;  1VEW A;  1ZUQ A;  2QKC A;  1GN4 A;  4BR6 A;  4JZG A;  4JYY A;  1JA8 A;  1PL4 A;  4X9Q A;  1AR5 A;  1LUV A;  2AW9 A;  1D5N A;  3C3T A;  1EN6 A;  2GDS A;  1PM9 A;  3CEI A;  1IDS A;  1EM1 A;  1MA1 A;  1Y67 A;  1XUQ A;  3DC5 A;  1EN5 A;  5AG2 A;  4F6E A;  1VAR A;  1BSM A;  2ADQ B;  1AVM A;  3IC9 A;  1MNG A;  1BS3 A;  3QVN A;  2RCV A;  2ADP A;  3KDR A;  3MDS A;  1I08 A;  1LUW A;  1JR9 A;  1QNM A;  1ZTE A;  3RN4 A;  1IXB A;  1BT8 A;  1GN3 A;  1AP6 A;  5A9G A;  1KKC A;  4JZ2 A;  1EN4 A;  2QKA A;  4E4E A;  3C3S A;  1P7G A;  3LSU A;  2P4K A;  1AR4 A;  3AK1 A;  3BFR A;  1N0N A;  4C7U A;  1MMM A;  1GN6 A;  1MSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...