2QKAA

Structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKANGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
publication title Structural and kinetic study of differences between human and Escherichia coli manganese superoxide dismutases.
pubmed doi rcsb
total genus 71
structure length 196
sequence length 196
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2qkaA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2qkaA02
1B06A 3BFRA 3DC6A 1ZUQA 1GN3A 3K9SA 1ZTEA 2GDSA 1AVMA 1WB7A 1AR5A 3QVNA 4YIOA 3CEIA 4JYYA 3AK2A 1EN6A 1P7GA 4FFKA 5AG2A 1VEWA 1Y67A 3LSUA 1KKCA 1I08A 1BSMA 1I0HA 4X9QA 1XILA 3AK3A 1MSDA 1WB8A 2QKCA 3EVKA 3TJTA 1VARA 1XUQA 1GN6A 3KKYA 4BR6A 1GN4A 3OT7A 2ADQB 3C3TA 1AR4A 3AK1A 1SZXA 1MA1A 4YIPA 4C7UA 3RN4A 4JZGA 1IXBA 1N0JA 3C3SA 1EM1A 1PM9A 2RCVA 3MDSA 4F6EA 4GUNA 1IDSA 1XDCA 1BS3A 1JA8A 1PL4A 2P4KA 5A9GA 2CDYA 1IX9A 1ZSPA 2ADPA 1EN4A 3DC5A 1QNMA 2CE4A 1BT8A 1MNGA 4E4EA 1LUWA 2QKAA 1D5NA 1AP5A 1LUVA 1ZLZA 2AW9A 1EN5A 1AP6A 1MMMA 1N0NA 1GN2A 3IC9A 4JZ2A 1JR9A 1XREA
chains in the Genus database with same CATH superfamily
1B06A 3BFRA 1QQCA 2QWQB 4LFBB 1LNQA 3SYPA 5LBQA 2M6YA 4IIJA 2FYUH 4U7OA 1S77D 3AK2A 4DV0B 2RJZA 1W59A 3OMNB 1KBHA 1G4YB 1V9PA 1DGSA 4X1IB 5LGUA 1YXBA 2E75B 2EIKB 2V4DA 4DV5O 1Q6UA 1DF4A 2YIBD 3OM3B 5GW7A 4WFBV 1U97A 1AILA 2YSUB 1HNXO 3AK3A 2ZM6O 1ZL8A 1PL0A 4DO2A 1QHTA 1N34B 1WB8A 1KP2A 2R9RB 5HFMA 2V1DA 1PV0A 5IJ9B 3B40A 5JJJB 1VF6A 1KYOF 4JGSA 1NU1H 4EB6A 4LWSA 5L3DA 3G80A 4HZ3A 1NTKH 1NVPD 3O9OA 3MHHC 4ZHQB 5LXTA 2UUCO 1H2KA 3OD4A 2G38A 1EM1A 4MVQA 3CC4V 3CX5F 1DF5A 3RYIA 3L71H 2ZE6A 2YI8A 1GKFA 4XDJA 4JI3O 3I5DA 4G27B 2EIJC 3FYEB 1JQ0A 2WLIA 2GBOA 3F7YC 3JD0A 1XOUA 2ITCC 4P30A 2DWDC 2R9IA 3CRCA 2WLKA 3CXCU 2WAMA 3ZMZA 3ETDA 1XL4A 4MTFA 3U11A 2DYRC 4FIPC 5B5EZ 3OMIB 5BY1A 1RPOA 3JAMN 1IZ3A 1SQBH 3CRMA 2WWWA 3WFVA 2ODMA 2QM4A 1GK9A 2YXHA 4JI2B 3ABKC 3P3NA 2P06A 2X0LA 3HKBB 3EXAA 5H6QA 3H01A 4GKKB 2BE3A 4FLYA 3QO8A 2KSDA 2PTMA 1KKCA 1I08A 4HBNA 2LFSA 3L75H 3FX7A 2Y69B 1D5AA 1VQ8V 1YITV 1FXKB 4LBEC 3SJBC 1FKAO 1NVPB 4RUEA 3OW2U 4IT5A 4B3MB 2X7RB 1J5EB 4JI4B 1WP7A 2QM7A 5KX5A 3TJTA 4DV2B 2BTQA 1VQKV 2GSMB 1OJHA 3E89A 2X6AA 4MW3A 1JFFB 1V54C 4DW0A 3BCCH 2LW1A 4NKGB 1MA1A 4NTYA 2OIGA 2OTJV 1FYJA 3P30A 1S3JA 3JD2A 1VMGA 2EILB 4MVMA 2EJ7A 1AI4A 3OTOB 1Y74A 4DR4B 4PDMA 1Q81W 1SQXH 4DR7B 2XAGA 1TVKA 3JATB 4FLUA 4I55A 4QE9A 3U0ZA 4EFBA 4I50A 1SRYA 5JCOC 3SPCA 5KHKA 1BGYH 3O65A 3JAWA 1R3IC 2DQ0A 2Q4PA 3SDLA 5LL6Y 1BQZA 5IWAB 4X1YA 2OYQA 4PJ0Z 1P84F 1ZX3A 4B08A 1JNBA 2HVJC 1YDXA 2X6CA 2R70A 3ZX6A 3BAAA 1XREA 5KAFZ 5J2TA 2F4VB 1SZTA 2WA3A 4DV1O 1YJ9V 1VQ5V 4UCOA 1SS3A 1XL6A 4X88A 2YEVB 1CPYA 1GO3F 4P9PA 4UVBA 4DR6O 5IJ0B 1FFXB 4H44B 3RGBA 2QWNB 1J95A 4XDKA 3OAAG 1OCOB 5KA5A 1MSDA 2E5LO 1L0LH 2HJDA 2ZCEA 1XMOB 2Y48A 4K3AA 2VQEO 3FAVB 4ZI7A 2QWRB 5KLVH 4DR2B 5JCOA 3LUTB 3C3TA 4MT8A 3ASOB 4QE7A 5LP6B 3SPGA 1SC5B 4Q6GA 3LSSA 5IY5C 3ETGA 3C3SA 4LF7O 3U10A 2B1GA 3UT5B 3ZHVA 4O4JB 2WLLA 1IDSA 1MOFA 1BS3A 2HFEC 1V55C 4JI7O 1ZSPA 1IBKO 1EN4A 2PYJA 2HLDG 3CP1A 3K0GA 3RYCA 3ETQA 2WLHA 1W0KG 1IBLO 2CTRA 4X65O 2LGWA 1HP8A 4B3RB 5L3GA 5K1PA 3E22B 1SESA 2XAQA 1G6UA 3J81N 1HW7A 2XNDG 3AG3C 3IC9A 5LHHA 1HR0O 3D8CA 1HNWO 4DR1O 3ABMB 4X1IA 3THOA 3IJ4A 1M9NA 1M57B 2K1EA 2W0FC 5L3CA 2WA4A 2W6JG 3RVYA 4UFZA 3K59A 1VEWA 4WF9V 1Y67A 1L1FA 5BR8B 4JV5O 4R50A 1M1KW 4JI5O 4O4LA 2QTOA 2OT5A 1IBMO 4O4HB 1H38A 1VARA 1XUQA 5B1NA 2CTQA 3SR2C 2IJIA 4ZHQA 5F2VO 3CCJV 1VF5B 1K4CC 3F5WC 5EC1C 3J7AU 2W6IG 4DV6B 3AG4C 3C90A 2W0XA 1RM1C 2YS8A 1TUEB 3L9DA 2UXCO 2ZDIC 5JH7B 2LFRA 2Q7EA 1T5EA 3CMAV 1X59A 4EFEA 1TAEA 4DYLA 2QWOB 2AHYA 2QGNA 4YJ3B 2DWEC 1HR0B 1PNLA 5D5QA 4J7ZA 4X64B 5KUKA 1COWG 2ZIMA 4W4LA 3JARB 4MVZA 4B3TO 3ASNC 1S72V 1P4RA 4TV8B 1S5JA 2JJ2G 5LMNO 2OTLV 5HFLA 1XBLA 4LF8B 1PPJH 4JF3A 3E2EA 2VQFB 1KECA 1AP5A 3K03A 4FVMA 4GLXA 3JASB 1Q6IA 2YIBA 4JYBA 3LDDA 2RNBA 1YJNV 1AP6A 1GN2A 5CB4B 2RMKB 1JR9A 2UXDB 3HKBA 3DC6A 1N36O 2E3CA 4Z1MG 5L3BA 3JAKA 4FFBB 2HG5C 4WFHA 5CA1B 1L0NH 2CGOA 2FL4A 1S0VA 2BOBC 4FMTA 3CYOA 3ZMVA 3R65A 1FXKA 3OE7G 2L6LA 4RUFA 2FKXA 4J80A 1GTOA 3QF7A 3D36C 5IYCO 1IJGA 1DTOA 1XNRO 2YUAA 5CN0A 1QR9A 3Q4HB 3QTCA 3AG2B 4DR5O 3E86A 1JFFA 4HAMA 1K8AW 1FD9A 5FNVB 2M7WA 1HNZO 1FJGB 3RFRA 2DOSA 3KKYA 1K5SA 4BW5A 3L70H 4BR6A 1PNMA 5L3FA 2UUBB 3FFQA 2R9AA 3GB7C 1URFA 4YY3O 4MW8A 2ZNIA 2DN9A 3HKCB 3JATA 2KB1A 2PI4A 1NKDA 2Q68A 4UVAA 4GKJO 2PZSA 2B5UA 4TQDA 3VQWA 2Q0OC 3G6EV 3ZRWB 4CS2A 4O4IB 4UXNA 1H2LA 2ADPA 2AXTZ 1AJNA 5LP6C 3DC5A 2CE4A 4H33A 2CK3G 4ZOLB 2OWOA 4I0XB 1N32O 3T4ZA 4NXNO 4D7TA 4H13B 5B3SB 5ITZB 4Z2WA 5GTIZ 2IH3C 3KCYA 1JJ2U 2KQXA 2UU9B 1MSWD 4OX9B 4LFCO 4LF6O 2YEVA 1MMMA 2QWPB 5LYJB 5EIBD 2B1IA 4LFAB 4LF9B 3JD4A 3CXHF 1KD1W 3PJSK 2XUMA 3H1LH 1VP7A 3UO2A 1FAFA 3CCSV 1FFXA 4K0KB 4YIOA 4NTWA 4PI2A 1O9GA 4LNUB 4CZZA 2HEPA 4DK1A 4WBNB 2VRZA 1Q90D 4DUYB 1R6NA 4RO2A 3BHPA 5CA3A 3STZC 3FAVA 1Z2GA 3N2KA 3A2FA 1VQ9V 4X62O 3FB7C 5EK0A 4X9QA 5H9CA 1K9MW 3N2GB 4L8JA 4OPHA 2Y0PA 5IT9N 3T1HB 5LP6A 3CJHB 4J9ZB 3K58A 4NXMO 5FPRA 1VQ6V 3AEIA 3T1YO 4LR3A 4FZ1A 2NLJC 1BCCH 4FM2A 1Q7YW 3WG7C 5J2UA 3UT5A 4O4JA 3CC7V 4PI0A 1D2DA 1SKVA 1QLNA 3ZN1A 4CS4A 3EFFK 2EIMB 3F7VC 2QA4V 1PM9A 4OPAA 2EZPA 3E8GA 4GUNA 5DEDA 1XDCA 1AROP 1W2BU 2A06H 3TGUH 2IJHA 4MVUA 1XHXA 1OCZC 3E22A 3HR0A 1Q6HA 4I5SA 4WFFA 4DR3B 2AGAA 2N74A 3HKEA 3CC2V 4O2BB 1R3JC 3SPIA 2DW4A 3S3XA 1H2GA 3BABA 4HNAA 1EN5A 4NTXA 4QGPA 5B1AB 2HVKC 3CCUV 2AHZA 2ZE8A 3WB1A 3ZHUA 4AI8A 1R73A 2ZIOA 4DV5B 2D3OW 4KHPO 1HNXB 2ZM6B 3GWKC 1VQ7V 1Q43A 4QIWF 1K4DC 2ZD9A 3JCZA 3UCSC 5DM6V 1I0HA 4HYOA 1SQFA 3ICXA 3W7UA 2EULA 4DV7O 3IGAC 2B9ZA 2YXYA 1NS1A 1IXMA 5JH7A 1W0JG 3OGIB 2EINB 2Y4UA 4UB8Z 1QLEC 2LQTA 4CC5A 2HKOA 3K5MA 2UUCB 4JTDB 4YJ3A 1VQPV 1WN7A 2Q5ZA 3HKDB 3SJQC 5JQGB 5K1XA 3RYFA 3JALB 3AG2C 2ZXWB 2F93B 4MTXA 2Q6AA 3JARA 2RN9A 1SQVH 4JI3B 2RCVA 4DV4O 4TV8A 1K33A 3CRRA 4JTCB 2P4KA 1PL4A 3K79A 1RSOB 1KQSU 4WFGA 2ZINA 4KP4A 1EFRG 4PELA 3K0DA 4IHJA 2F43G 1SQGA 4DRXB 4PDLA 1Q3EA 2DE0X 3QG5A 4LF4O 5DECA 2AZ2A 2CUGA 1D5NA 2Q9LA 3ZIAG 2IU0A 2NR5A 4ZKIA 3QO7A 3KZIZ 1ENVA 1R1BA 1SA0A 2HR3A 1AI5A 2Q67A 4FFBA 3B4SA 5CA1A 1HWYA 1R3LC 4TUYB 2Q7GA 1F51A 1DK1A 3JSNA 2QEXV 3P3PA 2YIAA 3K9SA 5KHIA 3FB5C 5EZYA 2DYSC 1AR5A 3SPHA 4JI1O 4U3JB 4ICGA 5B1BB 2BOCC 1AR1B 1M4UA 3BEHA 1GMGA 3CHXA 1QCEA 2PY5A 1NZ6A 1YVWA 3QO5A 2GUZB 4D6TH 3GWOA 4DUZO 1P49A 1OCRC 1XILA 1I5XA 5LHGA 1H2NA 3ZBHA 3RT3C 1R6KA 4BAYA 1H8HG 5KMGA 4X1KB 3M8AA 3RYHA 1UJWB 5KHJA 4P9OA 4B7EA 4JI0O 2E76B 2IBZH 3HKCA 4NB5A 1XNQO 2LGQA 3AG1B 1GN4A 3OT7A 2XAHA 3ZRWA 1KP3A 3JYCA 3DXRB 4YHHO 3K5NA 3UO3A 1R3KC 3X2QB 5IYDO 5EBLC 3RBZA 4JI8O 4I9WA 4ZOLA 2E74B 2WSSG 4I0XA 2YXLA 4UV8A 1KKDA 4EKWA 2EBOA 5ITZA 3VQXA 2EIKC 1KUQA 1IURA 4CH6A 2CAZC 1SF9A 2JK5C 3H1IH 1US6A 1YZBA 1BQ0A 2EIMC 1QU7A 4LF5O 4F6RB 3TCUA 2MK3A 4MVRA 4H37A 3ZEDA 4DV1B 5IDJA 4X66O 1BHAA 1LR1A 3ZS8C 3BPZA 4LNUA 4WBNA 1OHHG 3ABLB 4B3SO 2JGDB 3CRQA 1XMQO 1JJOA 5IYZB 2YIDA 2EZOA 2OIEA 4DR6B 1WPXA 4JPRA 2NN4A 3L72H 4FM1A 2PI5A 1EN6A 1P7GA 2UUAO 3H9VA 3IFXA 2EX3A 4UCTA 3G6BA 4I4TB 3NR7A 3LSUA 3OEHG 1AI7A 2E5LB 3CJHA 3H1JH 3LNMB 4FM0A 2VQEB 4UCUA 2IJJA 3ABUA 1IVSA 3FB6C 5BZBA 1FFTB 1MABG 5KAIZ 2A9HA 4FPPA 2F66C 2EJRA 3K06A 3TETA 4FLWA 4AHCA 4XDLA 1E1RG 2JRIA 1FOUA 4LF7B 1AR4A 4PDRA 3WB0A 2JIZG 2ETNA 3W7XA 5IJ9A 5D5PA 3APOA 1I94O 4JI7B 1IBKB 4FK5C 3W7WA 1G8MA 3G67A 3DSQA 1IBLB 4X65B 3K3WA 4DV3O 1GM8A 4O2BA 3K9AA 1M90W 3A0RA 4CH5A 2ZNJA 2Y69C 4AQYO 2D2CB 1I5YA 1FXKC 1MNGA 3B8MA 1QVGU 2DQ3A 2CH7B 1N33O 2N05A 5EBMC 4K8XA 4PA7A 2HHHO 1ZLZA 1HNWB 4DR1B 2K9PA 2CTWA 1CXZB 1YSCA 1NH2D 1N0NA 2XHBA 3VQYA 2XT9A 3MHSC 1ZUQA 2GDSA 4JYAO 5EC2C 2EILC 3CEIA 5FPOA 1QR8A 4JV5B 4JI5B 1M93A 4QPJA 2RQ6A 4UB6Z 3ETEA 2EIJB 1IBMB 4R8CA 1Y66A 3OEEG 4PA6A 1U96A 3B2EE 5E1AC 1ORQC 5H6RA 3CCRV 3OR7C 3HKDA 4RWUA 1SERA 3T4DA 5JQGA 2QTSA 3JALA 2UXCB 3ML0A 2DYRB 1Z5VA 1Z5WA 4UVCA 1OCCB 1I7FA 3A0BZ 4U3FH 1WA8B 3UKMA 2V7QG 1Y74B 3SYOA 1RSOA 3OFNG 4D7SA 4FLZA 3KG2A 1N0JA 1Q5OA 3B77A 3ABKB 4QJFB 2P4VA 1M56B 4YJ2B 4B3TB 1EBOA 5CBHA 4DRXA 3ZMSA 2NNUA 4UV9A 5LMUO 3OTFA 5LMNB 3AG1C 2BSKB 1ROPA 1GM7A 1MZEA 5C8YB 1QNMA 4UUJC 1FXHA 5JWPA 1NH2B 1OCOC 1S5LZ 2IU3A 4P2ZA 1X4TA 2OCHA 4TUYA 2UXBO 4LH6A 1JX9A 3K57A 3APQA 5JJEB 3E83A 4IYHA 2L35A 2Z3YA 3J80N 2AW9A 1DLBA 4MS2A 2Y0IA 1N36B 2YC0A 3WB2A 1P7BA 4U3JA 2P7TC 3ASOC 1XQ8A 3RVZA 1V54B 4JI6O 2PGGA 1NQTA 1BMFG 1ZTEA 4I7ZB 5CA0B 2UXNA 3CWBH 3FKSG 4MTGA 1S76D 1H5WA 5IYBO 3BRCA 3K5LA 2GUZA 3BA9A 1XNRB 1A32A 1WNSA 1NR1A 1B3QA 3NXSA 1RFYA 4LFBO 4LH7A 1K97A 4PA9A 5AG2A 1K5QA 2JEXA 4DR5B 1MZFA 4DV0O 3ZHRA 2JGUA 5B66Z 1BSMA 2Q8VA 1YI2V 1HNZB 3F5TA 2QSAA 3K08A 2ZE5A 5IJ0A 2VWKA 3G71V 4JAUA 2YDEA 2QKCA 1E79G 4H0LB 3VOUA 1WJZA 2Z0AA 4E2LA 4YY3B 1BHBA 4J41A 3T2MA 4X89A 1S5HC 1Y76B 1N34O 1AJPA 3UM7A 3W7TA 3AK1A 3ABMC 3E8FA 4GKJB 2WLLB 5KUMA 4JYCA 3KCXA 1O9HA 1M57C 4GX0A 4JTAB 3W7SA 1BE3H 2AZ0A 1EZJA 2KG7B 2ITDC 4IL6Z 1N32B 2LW7A 4F6RA 2JJ1G 2ZR2A 4NXNB 4X20B 1BT8A 2LP7A 4JAVA 5GONB 4GYCB 3TXSA 4E4EA 4BIUA 4LFCB 4LF6B 2A3QA 2H3OA 2IH1C 2JGDA 4PV1B 5BXZA 5IYZA 5FLXN 3VQVA 3JD3A 4QNHB 2JS3A 1B04A 4CH4A 1KB9F 1KU9A 3H1HH 3SJCC 4MVOA 3T1CA 1YHQV 4I4TA 5IY5B 3QVNA 4J11A 3BVOA 4F4LA 4O4LB 4ZIBA 4K35A 4X62B 4FFKA 4JI2O 1WPBA 1V55B 1H8EG 1VF7A 2WLMA 3CCLV 2WPDG 2Q69A 3WU2Z 2QE7G 4GKKO 3H1KH 5CBFA 2IJKA 3VBBA 4NXMB 3QNEA 1K73W 4PDVA 3T1YB 4LCUC 1GH6A 2P6JA 4JASA 5L3EA 1WLEA 2F23A 4NR1A 3AG3B 3GVMA 1TGOA 4B3MO 1J5EO 4O4HA 1ZWIC 4JI4O 3HPLC 4DV2O 4B7KA 3IAYA 4YIPA 3TXQA 3ZMTA 2ILMA 4GX5A 3G4SV 1VQNV 5B1OA 3RWRD 4DK0A 3SYQA 2C2AA 2Z5UA 5LHIA 4OGQB 2ZKOA 1OCCC 3E35A 4TV9B 3ZMUA 2CH7A 5DN6G 3OTOO 4DR4O 1K34A 3JSLA 2BCCH 1VQLV 4DR7O 1HDJA 1LUWA 4O2AB 2QKAA 1M56C 4AILC 1K92A 2F1MA 1KMIZ 2QJ1A 4KUMA 4A5UB 3I55V 4LP8A 3LDCA 4J42A 3JAKB 4EEQA 2JS5A 3KDRA 3AG4B 5IWAO 1RM1B 2A79B 2X6BA 5H2FZ 3JASA 4KHPB 4GZRB 1GN3A 4CS3A 2A0LA 1RP3B 1TUBB 2OCCB 4RAIA 1MG1A 5CB4A 1ZAUA 2F4VO 4KXRA 2P22C 1N4CA 2RDCA 4FLVA 4WFAV 1NJIW 2ATKC 4DV7B 4FLXA 3ASNB 4GCZA 2CGNA 1CP9A 5J9PC 5LOVB 5JVDB 4KL1A 3LNNA 5B3SC 1PD3A 1WA8A 1YIJV 5H5NA 3Q4HA 3P32A 1GN6A 1NBMG 1XMOO 1FS0G 4YJ2A 1F4NA 5FNVA 3L74H 3ZRVA 1GM9A 4DV4B 1F23A 2QDOA 2BSKA 4DR2O 4WCEV 5CBGA 1XI1A 5C8YA 3MD0A 2H8PC 1JPXA 1OZ0A 1VIBA 2ZE7A 4W4KA 1E1QG 3SPJA 3PN1A 1THZA 1WAZA 4BIZA 4Z1VA 4PA3A 3MAQA 4LF4B 4TOIA 5E79Z 2JDIG 1RPRA 4O4IA 1BZKA 3ZRXA 4WFEA 4PA4A 4FZ0A 1SQQH 5BMVB 1Y4MA 2O57A 2ZR3A 2QKSA 5CA0A 1H2MA 4G28B 3UQ8A 3S3WA 4B3RO 1BL8A 4JI1B 4L87A 2VWJA 3OGCC 4MVSA 4J7KA 3M99B 2Q73A 4NYKA 1AVMA 1VQOV 2PUSA 2LO1A 4R6ZA 5LYJA 2JEUA 5EBWC 2KKWA 1PKXA 3CE2A 5LA6B 3ZHTA 3CPWU 2LJ2A 4JYYA 3N2KB 5EYPB 3CCQV 4RQEA 2P90A 5TISZ 4DUZB 3A8TA 1YTFD 2HP8A 4IIJB 1NTMH 1N8RW 1JCHA 5EIBC 1AB3A 4JI0B 2JVDA 3DGEA 1GRJA 1JOYA 1XNQB 1Y76A 2UXXA 5BR8O 5J2UB 2XOKG 2DMXA 1G1XB 5C93A 3N2GA 4YHHB 5B1AC 4ABMA 1ZL8B 3B8NA 4RQFA 2IM9A 1KC8W 3HB3B 1SZXA 2KG7A 3FB8C 4JI8B 2GHYA 1AI6A 1IXBA 4DV6O 4X20A 5LGNA 3TK1A 1NI8A 5GONA 4F6EA 4EB6B 4LWSB 1F4MA 2XASA 3HKEB 5A9GA 1IX9A 4NVPA 5LXTB 5KA6A 3M7MX 2PYLA 4LF5B 4X64O 4KFMA 1YCIA 3RYIB 3AG7A 4HNAB 4X66B 4PHZA 4LC1A 3FYIB 5CMUA 2WLIB 4PD4F 4YXWG 5KHHA 5GTHZ 4B3SB 2EINC 4CH3A 3IC7A 4LF8O 1XMQB 2VQFO 1Y6XA 5KHGA 4JZ2A 1YTFB 3ZCCA 3WG7B 2H94A 4TQFA 2XAJA 2ZXWC 2UUAB 2XAFA 4CC6A 1WB7A 2UXDO 2QR4A 2A7WA 3DTUB 3SYCA 3A0HZ 3CB2A 2ZT9B 2DJVA 3LSQA 5JJNB 3CRAA 1YEWA 2N04A 3SJAC 1R6TA 1FXVA 4K8ZA 3E8HA 3L73H 2YI9A 2GV9A 4J7JA 1EZVH 2QM8A 4TSFG 1CEZA 1GAXA 1OCZB 3CCMV 1PP9H 3D3IA 2OCCC 1K3EA 4J10A 1YJWV 2HJFC 1H2SB 3BY6A 2FB5A 3EHBB 3EVKA 3K04A 3RYFB 2FMLA 1UFIA 3OUFA 3LDEA 1JVMA 4Q20A 1QVFU 4GX1A 1I94B 2FTKA 1FJGO 2WLJA 3STLC 5KX5B 1TA8A 1UPGA 2BTQB 4N21A 3RN4A 4IGGA 4JZGA 4TV9A 4I9QA 2UUBO 4DV3B 3D3QA 3MDSA 4XBFA 4IHJB 5B1BC 1AJQA 3CCVV 4O2AA 1JA8A 1F7YA 4AQYB 1XEQA 2IW5A 2ARHA 5LGTA 4UCSA 1Q86W 1N33B 5IE9A 1SA0B 1SETA 3ABTA 4JAAA 3K5OA 4BW9A 2HHHB 3CSXA 4FJCC 1TVKB 3CS5A 1FPOA 4DW1A 4I55B 4TWKA 4BWAA 5A2QN 2ZDIA 1L8DA 3JCUZ 4ZBMA 5EZYB 1TUBA 1QLEB 3E8BA 1QBZA 4I50B 4GX2A 1XHZA 4JYAB 2Q0AA 2VS0A 3JAWB 3CD6V 2UU9O 3OUSA 1K7DA 4X1YB 4OX9O 2P67A 1B6QA 3ZHSA 3X2QC 4LFAO 4LF9O 2Y4TA 4G2KA 1VQ4V 1YF2A 5J2TB 3ZN0A 5LOVA 5JVDA 4K0KO 4J9YB 1Q8IA 3BA8A 5KMGB 4GT1A 3RYHB 3B09A 4DUYO 2WLNA 3I56V 4X8AA 2PF4E 3SYAA 1WP8A 3FD9A 4ASUG 1Q82W 4R7CA 2P5OA 1M5IA 2R72A 1NT2B 3ZJZA 3T1HO 3CMEV 3ZHQA 2ADQB 3R66A 3ABLC 2YICA 4X1KA 4ZI7B 4C7UA 4TT3G 5LMUB 4FLTA 2DYSB 3D36A 1NTZH 4OXSA 3OMAB 2CTPA 4CBCA 3JD1A 4BIOA 2ZQMA 3DXRA 4U7NA 2F95B 1JMKC 5FL7G 2MW2B 2CDYA 3RW0A 2GTSA 2UXBB 4QPKA 5BMVA 4MTOA 1OV9A 3CCEV 4UCVA 2Q7HA 4MSWC 1NR7A 1VQMV 3N27A 1OCRB 1PNKA 4DXWA 1VF6C 2GTAA 4N23A 1LUVA 3RYCB 4DR3O 3SGIA 3ZRSA 2XTAA 4JI6B 1SQPH 4UCRA 5LA6A 3OR6C 4IYIA 5EYPA 2BTOA
chains in the Genus database with same CATH topology
1B06A 3BFRA 3DC6A 1ZUQA 1GN3A 3K9SA 1ZTEA 2GDSA 1AVMA 1WB7A 1AR5A 3QVNA 4YIOA 3CEIA 4JYYA 3AK2A 1EN6A 1P7GA 4FFKA 5AG2A 1VEWA 1Y67A 3LSUA 1KKCA 1I08A 1BSMA 1I0HA 4X9QA 1XILA 3AK3A 1MSDA 1WB8A 2QKCA 3EVKA 3TJTA 1VARA 1XUQA 1GN6A 3KKYA 4BR6A 1GN4A 3OT7A 2ADQB 3C3TA 1AR4A 3AK1A 1SZXA 1MA1A 4YIPA 4C7UA 3RN4A 4JZGA 1IXBA 1N0JA 3C3SA 1EM1A 1PM9A 2RCVA 3MDSA 4F6EA 4GUNA 1IDSA 1XDCA 1BS3A 1JA8A 1PL4A 2P4KA 5A9GA 2CDYA 1IX9A 1ZSPA 2ADPA 1EN4A 3DC5A 1QNMA 2CE4A 1BT8A 1MNGA 4E4EA 1LUWA 2QKAA 1D5NA 1AP5A 1LUVA 1ZLZA 2AW9A 1EN5A 1AP6A 1MMMA 1N0NA 1GN2A 3KDRA 3IC9A 4JZ2A 1JR9A 1XREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B06 A;  3BFR A;  3DC6 A;  1ZUQ A;  1GN3 A;  3K9S A;  1ZTE A;  2GDS A;  1AVM A;  1WB7 A;  1AR5 A;  3QVN A;  4YIO A;  3CEI A;  4JYY A;  3AK2 A;  1EN6 A;  1P7G A;  4FFK A;  5AG2 A;  1VEW A;  1Y67 A;  3LSU A;  1KKC A;  1I08 A;  1BSM A;  1I0H A;  4X9Q A;  1XIL A;  3AK3 A;  1MSD A;  1WB8 A;  2QKC A;  3EVK A;  3TJT A;  1VAR A;  1XUQ A;  1GN6 A;  3KKY A;  4BR6 A;  1GN4 A;  3OT7 A;  2ADQ B;  3C3T A;  1AR4 A;  3AK1 A;  1SZX A;  1MA1 A;  4YIP A;  4C7U A;  3RN4 A;  4JZG A;  1IXB A;  1N0J A;  3C3S A;  1EM1 A;  1PM9 A;  2RCV A;  3MDS A;  4F6E A;  4GUN A;  1IDS A;  1XDC A;  1BS3 A;  1JA8 A;  1PL4 A;  2P4K A;  5A9G A;  2CDY A;  1IX9 A;  1ZSP A;  2ADP A;  1EN4 A;  3DC5 A;  1QNM A;  2CE4 A;  1BT8 A;  1MNG A;  4E4E A;  1LUW A;  2QKA A;  1D5N A;  1AP5 A;  1LUV A;  1ZLZ A;  2AW9 A;  1EN5 A;  1AP6 A;  1MMM A;  1N0N A;  1GN2 A;  3IC9 A;  4JZ2 A;  1JR9 A;  1XRE A; 
#chains in the Genus database with same CATH topology
 1B06 A;  3BFR A;  1QQC A;  2QWQ B;  4LFB B;  1LNQ A;  3SYP A;  5LBQ A;  2M6Y A;  4IIJ A;  2FYU H;  4U7O A;  1S77 D;  3AK2 A;  4DV0 B;  2RJZ A;  1W59 A;  3OMN B;  1KBH A;  1G4Y B;  1V9P A;  1DGS A;  4X1I B;  5LGU A;  1YXB A;  2E75 B;  2EIK B;  2V4D A;  4DV5 O;  1Q6U A;  1DF4 A;  2YIB D;  3OM3 B;  5GW7 A;  4WFB V;  1U97 A;  1AIL A;  2YSU B;  1HNX O;  3AK3 A;  2ZM6 O;  1ZL8 A;  1PL0 A;  4DO2 A;  1QHT A;  1N34 B;  1WB8 A;  1KP2 A;  2R9R B;  5HFM A;  2V1D A;  1PV0 A;  5IJ9 B;  3B40 A;  5JJJ B;  1VF6 A;  1KYO F;  4JGS A;  1NU1 H;  4EB6 A;  4LWS A;  5L3D A;  3G80 A;  4HZ3 A;  1NTK H;  1NVP D;  3O9O A;  3MHH C;  4ZHQ B;  5LXT A;  2UUC O;  1H2K A;  3OD4 A;  2G38 A;  1EM1 A;  4MVQ A;  3CC4 V;  3CX5 F;  1DF5 A;  3RYI A;  3L71 H;  2ZE6 A;  2YI8 A;  1GKF A;  4XDJ A;  4JI3 O;  3I5D A;  4G27 B;  2EIJ C;  3FYE B;  1JQ0 A;  2WLI A;  2GBO A;  3F7Y C;  3JD0 A;  1XOU A;  2ITC C;  4P30 A;  2DWD C;  2R9I A;  3CRC A;  2WLK A;  3CXC U;  2WAM A;  3ZMZ A;  3ETD A;  1XL4 A;  4MTF A;  3U11 A;  2DYR C;  4FIP C;  5B5E Z;  3OMI B;  5BY1 A;  1RPO A;  3JAM N;  1IZ3 A;  1SQB H;  3CRM A;  2WWW A;  3WFV A;  2ODM A;  2QM4 A;  1GK9 A;  2YXH A;  4JI2 B;  3ABK C;  3P3N A;  2P06 A;  2X0L A;  3HKB B;  3EXA A;  5H6Q A;  3H01 A;  4GKK B;  2BE3 A;  4FLY A;  3QO8 A;  2KSD A;  2PTM A;  1KKC A;  1I08 A;  4HBN A;  2LFS A;  3L75 H;  3FX7 A;  2Y69 B;  1D5A A;  1VQ8 V;  1YIT V;  1FXK B;  4LBE C;  3SJB C;  1FKA O;  1NVP B;  4RUE A;  3OW2 U;  4IT5 A;  4B3M B;  2X7R B;  1J5E B;  4JI4 B;  1WP7 A;  2QM7 A;  5KX5 A;  3TJT A;  4DV2 B;  2BTQ A;  1VQK V;  2GSM B;  1OJH A;  3E89 A;  2X6A A;  4MW3 A;  1JFF B;  1V54 C;  4DW0 A;  3BCC H;  2LW1 A;  4NKG B;  1MA1 A;  4NTY A;  2OIG A;  2OTJ V;  1FYJ A;  3P30 A;  1S3J A;  3JD2 A;  1VMG A;  2EIL B;  4MVM A;  2EJ7 A;  1AI4 A;  3OTO B;  1Y74 A;  4DR4 B;  4PDM A;  1Q81 W;  1SQX H;  4DR7 B;  2XAG A;  1TVK A;  3JAT B;  4FLU A;  4I55 A;  4QE9 A;  3U0Z A;  4EFB A;  4I50 A;  1SRY A;  5JCO C;  3SPC A;  5KHK A;  1BGY H;  3O65 A;  3JAW A;  1R3I C;  2DQ0 A;  2Q4P A;  3SDL A;  5LL6 Y;  1BQZ A;  5IWA B;  4X1Y A;  2OYQ A;  4PJ0 Z;  1P84 F;  1ZX3 A;  4B08 A;  1JNB A;  2HVJ C;  1YDX A;  2X6C A;  2R70 A;  3ZX6 A;  3BAA A;  1XRE A;  5KAF Z;  5J2T A;  2F4V B;  1SZT A;  2WA3 A;  4DV1 O;  1YJ9 V;  1VQ5 V;  4UCO A;  1SS3 A;  1XL6 A;  4X88 A;  2YEV B;  1CPY A;  1GO3 F;  4P9P A;  4UVB A;  4DR6 O;  5IJ0 B;  1FFX B;  4H44 B;  3RGB A;  2QWN B;  1J95 A;  4XDK A;  3OAA G;  1OCO B;  5KA5 A;  1MSD A;  2E5L O;  1L0L H;  2HJD A;  2ZCE A;  1XMO B;  2Y48 A;  4K3A A;  2VQE O;  3FAV B;  4ZI7 A;  2QWR B;  5KLV H;  4DR2 B;  5JCO A;  3LUT B;  3C3T A;  4MT8 A;  3ASO B;  4QE7 A;  5LP6 B;  3SPG A;  1SC5 B;  4Q6G A;  3LSS A;  5IY5 C;  3ETG A;  3C3S A;  4LF7 O;  3U10 A;  2B1G A;  3UT5 B;  3ZHV A;  4O4J B;  2WLL A;  1IDS A;  1MOF A;  1BS3 A;  2HFE C;  1V55 C;  4JI7 O;  1ZSP A;  1IBK O;  1EN4 A;  2PYJ A;  2HLD G;  3CP1 A;  3K0G A;  3RYC A;  3ETQ A;  2WLH A;  1W0K G;  1IBL O;  2CTR A;  4X65 O;  2LGW A;  1HP8 A;  4B3R B;  5L3G A;  5K1P A;  3E22 B;  1SES A;  2XAQ A;  1G6U A;  3J81 N;  1HW7 A;  2XND G;  3AG3 C;  3IC9 A;  5LHH A;  1HR0 O;  3D8C A;  1HNW O;  4DR1 O;  3ABM B;  4X1I A;  3THO A;  3IJ4 A;  1M9N A;  1M57 B;  2K1E A;  2W0F C;  5L3C A;  2WA4 A;  2W6J G;  3RVY A;  4UFZ A;  3K59 A;  1VEW A;  4WF9 V;  1Y67 A;  1L1F A;  5BR8 B;  4JV5 O;  4R50 A;  1M1K W;  4JI5 O;  4O4L A;  2QTO A;  2OT5 A;  1IBM O;  4O4H B;  1H38 A;  1VAR A;  1XUQ A;  5B1N A;  2CTQ A;  3SR2 C;  2IJI A;  4ZHQ A;  5F2V O;  3CCJ V;  1VF5 B;  1K4C C;  3F5W C;  5EC1 C;  3J7A U;  2W6I G;  4DV6 B;  3AG4 C;  3C90 A;  2W0X A;  1RM1 C;  2YS8 A;  1TUE B;  3L9D A;  2UXC O;  2ZDI C;  5JH7 B;  2LFR A;  2Q7E A;  1T5E A;  3CMA V;  1X59 A;  4EFE A;  1TAE A;  4DYL A;  2QWO B;  2AHY A;  2QGN A;  4YJ3 B;  2DWE C;  1HR0 B;  1PNL A;  5D5Q A;  4J7Z A;  4X64 B;  5KUK A;  1COW G;  2ZIM A;  4W4L A;  3JAR B;  4MVZ A;  4B3T O;  3ASN C;  1S72 V;  1P4R A;  4TV8 B;  1S5J A;  2JJ2 G;  5LMN O;  2OTL V;  5HFL A;  1XBL A;  4LF8 B;  1PPJ H;  4JF3 A;  3E2E A;  2VQF B;  1KEC A;  1AP5 A;  3K03 A;  4FVM A;  4GLX A;  3JAS B;  1Q6I A;  2YIB A;  4JYB A;  3LDD A;  2RNB A;  1YJN V;  1AP6 A;  1GN2 A;  5CB4 B;  2RMK B;  1JR9 A;  2UXD B;  3HKB A;  3DC6 A;  1N36 O;  2E3C A;  4Z1M G;  5L3B A;  3JAK A;  4FFB B;  2HG5 C;  4WFH A;  5CA1 B;  1L0N H;  2CGO A;  2FL4 A;  1S0V A;  2BOB C;  4FMT A;  3CYO A;  3ZMV A;  3R65 A;  1FXK A;  3OE7 G;  2L6L A;  4RUF A;  2FKX A;  4J80 A;  1GTO A;  3QF7 A;  3D36 C;  5IYC O;  1IJG A;  1DTO A;  1XNR O;  2YUA A;  5CN0 A;  1QR9 A;  3Q4H B;  3QTC A;  3AG2 B;  4DR5 O;  3E86 A;  1JFF A;  4HAM A;  1K8A W;  1FD9 A;  5FNV B;  2M7W A;  1HNZ O;  1FJG B;  3RFR A;  2DOS A;  3KKY A;  1K5S A;  4BW5 A;  3L70 H;  4BR6 A;  1PNM A;  5L3F A;  2UUB B;  3FFQ A;  2R9A A;  3GB7 C;  1URF A;  4YY3 O;  4MW8 A;  2ZNI A;  2DN9 A;  3HKC B;  3JAT A;  2KB1 A;  2PI4 A;  1NKD A;  2Q68 A;  4UVA A;  4GKJ O;  2PZS A;  2B5U A;  4TQD A;  3VQW A;  2Q0O C;  3G6E V;  3ZRW B;  4CS2 A;  4O4I B;  4UXN A;  1H2L A;  2ADP A;  2AXT Z;  1AJN A;  5LP6 C;  3DC5 A;  2CE4 A;  4H33 A;  2CK3 G;  4ZOL B;  2OWO A;  4I0X B;  1N32 O;  3T4Z A;  4NXN O;  4D7T A;  4H13 B;  5B3S B;  5ITZ B;  4Z2W A;  5GTI Z;  2IH3 C;  3KCY A;  1JJ2 U;  2KQX A;  2UU9 B;  1MSW D;  4OX9 B;  4LFC O;  4LF6 O;  2YEV A;  1MMM A;  2QWP B;  5LYJ B;  5EIB D;  2B1I A;  4LFA B;  4LF9 B;  3JD4 A;  3CXH F;  1KD1 W;  3PJS K;  2XUM A;  3H1L H;  1VP7 A;  3UO2 A;  1FAF A;  3CCS V;  1FFX A;  4K0K B;  4YIO A;  4NTW A;  4PI2 A;  1O9G A;  4LNU B;  4CZZ A;  2HEP A;  4DK1 A;  4WBN B;  2VRZ A;  1Q90 D;  4DUY B;  1R6N A;  4RO2 A;  3BHP A;  5CA3 A;  3STZ C;  3FAV A;  1Z2G A;  3N2K A;  3A2F A;  1VQ9 V;  4X62 O;  3FB7 C;  5EK0 A;  4X9Q A;  5H9C A;  1K9M W;  3N2G B;  4L8J A;  4OPH A;  2Y0P A;  5IT9 N;  3T1H B;  5LP6 A;  3CJH B;  4J9Z B;  3K58 A;  4NXM O;  5FPR A;  1VQ6 V;  3AEI A;  3T1Y O;  4LR3 A;  4FZ1 A;  2NLJ C;  1BCC H;  4FM2 A;  1Q7Y W;  3WG7 C;  5J2U A;  3UT5 A;  4O4J A;  3CC7 V;  4PI0 A;  1D2D A;  1SKV A;  1QLN A;  3ZN1 A;  4CS4 A;  3EFF K;  2EIM B;  3F7V C;  2QA4 V;  1PM9 A;  4OPA A;  2EZP A;  3E8G A;  4GUN A;  5DED A;  1XDC A;  1ARO P;  1W2B U;  2A06 H;  3TGU H;  2IJH A;  4MVU A;  1XHX A;  1OCZ C;  3E22 A;  3HR0 A;  1Q6H A;  4I5S A;  4WFF A;  4DR3 B;  2AGA A;  2N74 A;  3HKE A;  3CC2 V;  4O2B B;  1R3J C;  3SPI A;  2DW4 A;  3S3X A;  1H2G A;  3BAB A;  4HNA A;  1EN5 A;  4NTX A;  4QGP A;  5B1A B;  2HVK C;  3CCU V;  2AHZ A;  2ZE8 A;  3WB1 A;  3ZHU A;  4AI8 A;  1R73 A;  2ZIO A;  4DV5 B;  2D3O W;  4KHP O;  1HNX B;  2ZM6 B;  3GWK C;  1VQ7 V;  1Q43 A;  4QIW F;  1K4D C;  2ZD9 A;  3JCZ A;  3UCS C;  5DM6 V;  1I0H A;  4HYO A;  1SQF A;  3ICX A;  3W7U A;  2EUL A;  4DV7 O;  3IGA C;  2B9Z A;  2YXY A;  1NS1 A;  1IXM A;  5JH7 A;  1W0J G;  3OGI B;  2EIN B;  2Y4U A;  4UB8 Z;  1QLE C;  2LQT A;  4CC5 A;  2HKO A;  3K5M A;  2UUC B;  4JTD B;  4YJ3 A;  1VQP V;  1WN7 A;  2Q5Z A;  3HKD B;  3SJQ C;  5JQG B;  5K1X A;  3RYF A;  3JAL B;  3AG2 C;  2ZXW B;  2F93 B;  4MTX A;  2Q6A A;  3JAR A;  2RN9 A;  1SQV H;  4JI3 B;  2RCV A;  4DV4 O;  4TV8 A;  1K33 A;  3CRR A;  4JTC B;  2P4K A;  1PL4 A;  3K79 A;  1RSO B;  1KQS U;  4WFG A;  2ZIN A;  4KP4 A;  1EFR G;  4PEL A;  3K0D A;  4IHJ A;  2F43 G;  1SQG A;  4DRX B;  4PDL A;  1Q3E A;  2DE0 X;  3QG5 A;  4LF4 O;  5DEC A;  2AZ2 A;  2CUG A;  1D5N A;  2Q9L A;  3ZIA G;  2IU0 A;  2NR5 A;  4ZKI A;  3QO7 A;  3KZI Z;  1ENV A;  1R1B A;  1SA0 A;  2HR3 A;  1AI5 A;  2Q67 A;  4FFB A;  3B4S A;  5CA1 A;  1HWY A;  1R3L C;  4TUY B;  2Q7G A;  1F51 A;  1DK1 A;  3JSN A;  2QEX V;  3P3P A;  2YIA A;  3K9S A;  5KHI A;  3FB5 C;  5EZY A;  2DYS C;  1AR5 A;  3SPH A;  4JI1 O;  4U3J B;  4ICG A;  5B1B B;  2BOC C;  1AR1 B;  1M4U A;  3BEH A;  1GMG A;  3CHX A;  1QCE A;  2PY5 A;  1NZ6 A;  1YVW A;  3QO5 A;  2GUZ B;  4D6T H;  3GWO A;  4DUZ O;  1P49 A;  1OCR C;  1XIL A;  1I5X A;  5LHG A;  1H2N A;  3ZBH A;  3RT3 C;  1R6K A;  4BAY A;  1H8H G;  5KMG A;  4X1K B;  3M8A A;  3RYH A;  1UJW B;  5KHJ A;  4P9O A;  4B7E A;  4JI0 O;  2E76 B;  2IBZ H;  3HKC A;  4NB5 A;  1XNQ O;  2LGQ A;  3AG1 B;  1GN4 A;  3OT7 A;  2XAH A;  3ZRW A;  1KP3 A;  3JYC A;  3DXR B;  4YHH O;  3K5N A;  3UO3 A;  1R3K C;  3X2Q B;  5IYD O;  5EBL C;  3RBZ A;  4JI8 O;  4I9W A;  4ZOL A;  2E74 B;  2WSS G;  4I0X A;  2YXL A;  4UV8 A;  1KKD A;  4EKW A;  2EBO A;  5ITZ A;  3VQX A;  2EIK C;  1KUQ A;  1IUR A;  4CH6 A;  2CAZ C;  1SF9 A;  2JK5 C;  3H1I H;  1US6 A;  1YZB A;  1BQ0 A;  2EIM C;  1QU7 A;  4LF5 O;  4F6R B;  3TCU A;  2MK3 A;  4MVR A;  4H37 A;  3ZED A;  4DV1 B;  5IDJ A;  4X66 O;  1BHA A;  1LR1 A;  3ZS8 C;  3BPZ A;  4LNU A;  4WBN A;  1OHH G;  3ABL B;  4B3S O;  2JGD B;  3CRQ A;  1XMQ O;  1JJO A;  5IYZ B;  2YID A;  2EZO A;  2OIE A;  4DR6 B;  1WPX A;  4JPR A;  2NN4 A;  3L72 H;  4FM1 A;  2PI5 A;  1EN6 A;  1P7G A;  2UUA O;  3H9V A;  3IFX A;  2EX3 A;  4UCT A;  3G6B A;  4I4T B;  3NR7 A;  3LSU A;  3OEH G;  1AI7 A;  2E5L B;  3CJH A;  3H1J H;  3LNM B;  4FM0 A;  2VQE B;  4UCU A;  2IJJ A;  3ABU A;  1IVS A;  3FB6 C;  5BZB A;  1FFT B;  1MAB G;  5KAI Z;  2A9H A;  4FPP A;  2F66 C;  2EJR A;  3K06 A;  3TET A;  4FLW A;  4AHC A;  4XDL A;  1E1R G;  2JRI A;  1FOU A;  4LF7 B;  1AR4 A;  4PDR A;  3WB0 A;  2JIZ G;  2ETN A;  3W7X A;  5IJ9 A;  5D5P A;  3APO A;  1I94 O;  4JI7 B;  1IBK B;  4FK5 C;  3W7W A;  1G8M A;  3G67 A;  3DSQ A;  1IBL B;  4X65 B;  3K3W A;  4DV3 O;  1GM8 A;  4O2B A;  3K9A A;  1M90 W;  3A0R A;  4CH5 A;  2ZNJ A;  2Y69 C;  4AQY O;  2D2C B;  1I5Y A;  1FXK C;  1MNG A;  3B8M A;  1QVG U;  2DQ3 A;  2CH7 B;  1N33 O;  2N05 A;  5EBM C;  4K8X A;  4PA7 A;  2HHH O;  1ZLZ A;  1HNW B;  4DR1 B;  2K9P A;  2CTW A;  1CXZ B;  1YSC A;  1NH2 D;  1N0N A;  2XHB A;  3VQY A;  2XT9 A;  3MHS C;  1ZUQ A;  2GDS A;  4JYA O;  5EC2 C;  2EIL C;  3CEI A;  5FPO A;  1QR8 A;  4JV5 B;  4JI5 B;  1M93 A;  4QPJ A;  2RQ6 A;  4UB6 Z;  3ETE A;  2EIJ B;  1IBM B;  4R8C A;  1Y66 A;  3OEE G;  4PA6 A;  1U96 A;  3B2E E;  5E1A C;  1ORQ C;  5H6R A;  3CCR V;  3OR7 C;  3HKD A;  4RWU A;  1SER A;  3T4D A;  5JQG A;  2QTS A;  3JAL A;  2UXC B;  3ML0 A;  2DYR B;  1Z5V A;  1Z5W A;  4UVC A;  1OCC B;  1I7F A;  3A0B Z;  4U3F H;  1WA8 B;  3UKM A;  2V7Q G;  1Y74 B;  3SYO A;  1RSO A;  3OFN G;  4D7S A;  4FLZ A;  3KG2 A;  1N0J A;  1Q5O A;  3B77 A;  3ABK B;  4QJF B;  2P4V A;  1M56 B;  4YJ2 B;  4B3T B;  1EBO A;  5CBH A;  4DRX A;  3ZMS A;  2NNU A;  4UV9 A;  5LMU O;  3OTF A;  5LMN B;  3AG1 C;  2BSK B;  1ROP A;  1GM7 A;  1MZE A;  5C8Y B;  1QNM A;  4UUJ C;  1FXH A;  5JWP A;  1NH2 B;  1OCO C;  1S5L Z;  2IU3 A;  4P2Z A;  1X4T A;  2OCH A;  4TUY A;  2UXB O;  4LH6 A;  1JX9 A;  3K57 A;  3APQ A;  5JJE B;  3E83 A;  4IYH A;  2L35 A;  2Z3Y A;  3J80 N;  2AW9 A;  1DLB A;  4MS2 A;  2Y0I A;  1N36 B;  2YC0 A;  3WB2 A;  1P7B A;  4U3J A;  2P7T C;  3ASO C;  1XQ8 A;  3RVZ A;  1V54 B;  4JI6 O;  2PGG A;  1NQT A;  1BMF G;  1ZTE A;  4I7Z B;  5CA0 B;  2UXN A;  3CWB H;  3FKS G;  4MTG A;  1S76 D;  1H5W A;  5IYB O;  3BRC A;  3K5L A;  2GUZ A;  3BA9 A;  1XNR B;  1A32 A;  1WNS A;  1NR1 A;  1B3Q A;  3NXS A;  1RFY A;  4LFB O;  4LH7 A;  1K97 A;  4PA9 A;  5AG2 A;  1K5Q A;  2JEX A;  4DR5 B;  1MZF A;  4DV0 O;  3ZHR A;  2JGU A;  5B66 Z;  1BSM A;  2Q8V A;  1YI2 V;  1HNZ B;  3F5T A;  2QSA A;  3K08 A;  2ZE5 A;  5IJ0 A;  2VWK A;  3G71 V;  4JAU A;  2YDE A;  2QKC A;  1E79 G;  4H0L B;  3VOU A;  1WJZ A;  2Z0A A;  4E2L A;  4YY3 B;  1BHB A;  4J41 A;  3T2M A;  4X89 A;  1S5H C;  1Y76 B;  1N34 O;  1AJP A;  3UM7 A;  3W7T A;  3AK1 A;  3ABM C;  3E8F A;  4GKJ B;  2WLL B;  5KUM A;  4JYC A;  3KCX A;  1O9H A;  1M57 C;  4GX0 A;  4JTA B;  3W7S A;  1BE3 H;  2AZ0 A;  1EZJ A;  2KG7 B;  2ITD C;  4IL6 Z;  1N32 B;  2LW7 A;  4F6R A;  2JJ1 G;  2ZR2 A;  4NXN B;  4X20 B;  1BT8 A;  2LP7 A;  4JAV A;  5GON B;  4GYC B;  3TXS A;  4E4E A;  4BIU A;  4LFC B;  4LF6 B;  2A3Q A;  2H3O A;  2IH1 C;  2JGD A;  4PV1 B;  5BXZ A;  5IYZ A;  5FLX N;  3VQV A;  3JD3 A;  4QNH B;  2JS3 A;  1B04 A;  4CH4 A;  1KB9 F;  1KU9 A;  3H1H H;  3SJC C;  4MVO A;  3T1C A;  1YHQ V;  4I4T A;  5IY5 B;  3QVN A;  4J11 A;  3BVO A;  4F4L A;  4O4L B;  4ZIB A;  4K35 A;  4X62 B;  4FFK A;  4JI2 O;  1WPB A;  1V55 B;  1H8E G;  1VF7 A;  2WLM A;  3CCL V;  2WPD G;  2Q69 A;  3WU2 Z;  2QE7 G;  4GKK O;  3H1K H;  5CBF A;  2IJK A;  3VBB A;  4NXM B;  3QNE A;  1K73 W;  4PDV A;  3T1Y B;  4LCU C;  1GH6 A;  2P6J A;  4JAS A;  5L3E A;  1WLE A;  2F23 A;  4NR1 A;  3AG3 B;  3GVM A;  1TGO A;  4B3M O;  1J5E O;  4O4H A;  1ZWI C;  4JI4 O;  3HPL C;  4DV2 O;  4B7K A;  3IAY A;  4YIP A;  3TXQ A;  3ZMT A;  2ILM A;  4GX5 A;  3G4S V;  1VQN V;  5B1O A;  3RWR D;  4DK0 A;  3SYQ A;  2C2A A;  2Z5U A;  5LHI A;  4OGQ B;  2ZKO A;  1OCC C;  3E35 A;  4TV9 B;  3ZMU A;  2CH7 A;  5DN6 G;  3OTO O;  4DR4 O;  1K34 A;  3JSL A;  2BCC H;  1VQL V;  4DR7 O;  1HDJ A;  1LUW A;  4O2A B;  2QKA A;  1M56 C;  4AIL C;  1K92 A;  2F1M A;  1KMI Z;  2QJ1 A;  4KUM A;  4A5U B;  3I55 V;  4LP8 A;  3LDC A;  4J42 A;  3JAK B;  4EEQ A;  2JS5 A;  3KDR A;  3AG4 B;  5IWA O;  1RM1 B;  2A79 B;  2X6B A;  5H2F Z;  3JAS A;  4KHP B;  4GZR B;  1GN3 A;  4CS3 A;  2A0L A;  1RP3 B;  1TUB B;  2OCC B;  4RAI A;  1MG1 A;  5CB4 A;  1ZAU A;  2F4V O;  4KXR A;  2P22 C;  1N4C A;  2RDC A;  4FLV A;  4WFA V;  1NJI W;  2ATK C;  4DV7 B;  4FLX A;  3ASN B;  4GCZ A;  2CGN A;  1CP9 A;  5J9P C;  5LOV B;  5JVD B;  4KL1 A;  3LNN A;  5B3S C;  1PD3 A;  1WA8 A;  1YIJ V;  5H5N A;  3Q4H A;  3P32 A;  1GN6 A;  1NBM G;  1XMO O;  1FS0 G;  4YJ2 A;  1F4N A;  5FNV A;  3L74 H;  3ZRV A;  1GM9 A;  4DV4 B;  1F23 A;  2QDO A;  2BSK A;  4DR2 O;  4WCE V;  5CBG A;  1XI1 A;  5C8Y A;  3MD0 A;  2H8P C;  1JPX A;  1OZ0 A;  1VIB A;  2ZE7 A;  4W4K A;  1E1Q G;  3SPJ A;  3PN1 A;  1THZ A;  1WAZ A;  4BIZ A;  4Z1V A;  4PA3 A;  3MAQ A;  4LF4 B;  4TOI A;  5E79 Z;  2JDI G;  1RPR A;  4O4I A;  1BZK A;  3ZRX A;  4WFE A;  4PA4 A;  4FZ0 A;  1SQQ H;  5BMV B;  1Y4M A;  2O57 A;  2ZR3 A;  2QKS A;  5CA0 A;  1H2M A;  4G28 B;  3UQ8 A;  3S3W A;  4B3R O;  1BL8 A;  4JI1 B;  4L87 A;  2VWJ A;  3OGC C;  4MVS A;  4J7K A;  3M99 B;  2Q73 A;  4NYK A;  1AVM A;  1VQO V;  2PUS A;  2LO1 A;  4R6Z A;  5LYJ A;  2JEU A;  5EBW C;  2KKW A;  1PKX A;  3CE2 A;  5LA6 B;  3ZHT A;  3CPW U;  2LJ2 A;  4JYY A;  3N2K B;  5EYP B;  3CCQ V;  4RQE A;  2P90 A;  5TIS Z;  4DUZ B;  3A8T A;  1YTF D;  2HP8 A;  4IIJ B;  1NTM H;  1N8R W;  1JCH A;  5EIB C;  1AB3 A;  4JI0 B;  2JVD A;  3DGE A;  1GRJ A;  1JOY A;  1XNQ B;  1Y76 A;  2UXX A;  5BR8 O;  5J2U B;  2XOK G;  2DMX A;  1G1X B;  5C93 A;  3N2G A;  4YHH B;  5B1A C;  4ABM A;  1ZL8 B;  3B8N A;  4RQF A;  2IM9 A;  1KC8 W;  3HB3 B;  1SZX A;  2KG7 A;  3FB8 C;  4JI8 B;  2GHY A;  1AI6 A;  1IXB A;  4DV6 O;  4X20 A;  5LGN A;  3TK1 A;  1NI8 A;  5GON A;  4F6E A;  4EB6 B;  4LWS B;  1F4M A;  2XAS A;  3HKE B;  5A9G A;  1IX9 A;  4NVP A;  5LXT B;  5KA6 A;  3M7M X;  2PYL A;  4LF5 B;  4X64 O;  4KFM A;  1YCI A;  3RYI B;  3AG7 A;  4HNA B;  4X66 B;  4PHZ A;  4LC1 A;  3FYI B;  5CMU A;  2WLI B;  4PD4 F;  4YXW G;  5KHH A;  5GTH Z;  4B3S B;  2EIN C;  4CH3 A;  3IC7 A;  4LF8 O;  1XMQ B;  2VQF O;  1Y6X A;  5KHG A;  4JZ2 A;  1YTF B;  3ZCC A;  3WG7 B;  2H94 A;  4TQF A;  2XAJ A;  2ZXW C;  2UUA B;  2XAF A;  4CC6 A;  1WB7 A;  2UXD O;  2QR4 A;  2A7W A;  3DTU B;  3SYC A;  3A0H Z;  3CB2 A;  2ZT9 B;  2DJV A;  3LSQ A;  5JJN B;  3CRA A;  1YEW A;  2N04 A;  3SJA C;  1R6T A;  1FXV A;  4K8Z A;  3E8H A;  3L73 H;  2YI9 A;  2GV9 A;  4J7J A;  1EZV H;  2QM8 A;  4TSF G;  1CEZ A;  1GAX A;  1OCZ B;  3CCM V;  1PP9 H;  3D3I A;  2OCC C;  1K3E A;  4J10 A;  1YJW V;  2HJF C;  1H2S B;  3BY6 A;  2FB5 A;  3EHB B;  3EVK A;  3K04 A;  3RYF B;  2FML A;  1UFI A;  3OUF A;  3LDE A;  1JVM A;  4Q20 A;  1QVF U;  4GX1 A;  1I94 B;  2FTK A;  1FJG O;  2WLJ A;  3STL C;  5KX5 B;  1TA8 A;  1UPG A;  2BTQ B;  4N21 A;  3RN4 A;  4IGG A;  4JZG A;  4TV9 A;  4I9Q A;  2UUB O;  4DV3 B;  3D3Q A;  3MDS A;  4XBF A;  4IHJ B;  5B1B C;  1AJQ A;  3CCV V;  4O2A A;  1JA8 A;  1F7Y A;  4AQY B;  1XEQ A;  2IW5 A;  2ARH A;  5LGT A;  4UCS A;  1Q86 W;  1N33 B;  5IE9 A;  1SA0 B;  1SET A;  3ABT A;  4JAA A;  3K5O A;  4BW9 A;  2HHH B;  3CSX A;  4FJC C;  1TVK B;  3CS5 A;  1FPO A;  4DW1 A;  4I55 B;  4TWK A;  4BWA A;  5A2Q N;  2ZDI A;  1L8D A;  3JCU Z;  4ZBM A;  5EZY B;  1TUB A;  1QLE B;  3E8B A;  1QBZ A;  4I50 B;  4GX2 A;  1XHZ A;  4JYA B;  2Q0A A;  2VS0 A;  3JAW B;  3CD6 V;  2UU9 O;  3OUS A;  1K7D A;  4X1Y B;  4OX9 O;  2P67 A;  1B6Q A;  3ZHS A;  3X2Q C;  4LFA O;  4LF9 O;  2Y4T A;  4G2K A;  1VQ4 V;  1YF2 A;  5J2T B;  3ZN0 A;  5LOV A;  5JVD A;  4K0K O;  4J9Y B;  1Q8I A;  3BA8 A;  5KMG B;  4GT1 A;  3RYH B;  3B09 A;  4DUY O;  2WLN A;  3I56 V;  4X8A A;  2PF4 E;  3SYA A;  1WP8 A;  3FD9 A;  4ASU G;  1Q82 W;  4R7C A;  2P5O A;  1M5I A;  2R72 A;  1NT2 B;  3ZJZ A;  3T1H O;  3CME V;  3ZHQ A;  2ADQ B;  3R66 A;  3ABL C;  2YIC A;  4X1K A;  4ZI7 B;  4C7U A;  4TT3 G;  5LMU B;  4FLT A;  2DYS B;  3D36 A;  1NTZ H;  4OXS A;  3OMA B;  2CTP A;  4CBC A;  3JD1 A;  4BIO A;  2ZQM A;  3DXR A;  4U7N A;  2F95 B;  1JMK C;  5FL7 G;  2MW2 B;  2CDY A;  3RW0 A;  2GTS A;  2UXB B;  4QPK A;  5BMV A;  4MTO A;  1OV9 A;  3CCE V;  4UCV A;  2Q7H A;  4MSW C;  1NR7 A;  1VQM V;  3N27 A;  1OCR B;  1PNK A;  4DXW A;  1VF6 C;  2GTA A;  4N23 A;  1LUV A;  3RYC B;  4DR3 O;  3SGI A;  3ZRS A;  2XTA A;  4JI6 B;  1SQP H;  4UCR A;  5LA6 A;  3OR6 C;  4IYI A;  5EYP A;  2BTO A; 
#chains in the Genus database with same CATH homology
 1B06 A;  3BFR A;  3DC6 A;  1ZUQ A;  1GN3 A;  3K9S A;  1ZTE A;  2GDS A;  1AVM A;  1WB7 A;  1AR5 A;  3QVN A;  4YIO A;  3CEI A;  4JYY A;  3AK2 A;  1EN6 A;  1P7G A;  4FFK A;  5AG2 A;  1VEW A;  1Y67 A;  3LSU A;  1KKC A;  1I08 A;  1BSM A;  1I0H A;  4X9Q A;  1XIL A;  3AK3 A;  1MSD A;  1WB8 A;  2QKC A;  3EVK A;  3TJT A;  1VAR A;  1XUQ A;  1GN6 A;  3KKY A;  4BR6 A;  1GN4 A;  3OT7 A;  2ADQ B;  3C3T A;  1AR4 A;  3AK1 A;  1SZX A;  1MA1 A;  4YIP A;  4C7U A;  3RN4 A;  4JZG A;  1IXB A;  1N0J A;  3C3S A;  1EM1 A;  1PM9 A;  2RCV A;  3MDS A;  4F6E A;  4GUN A;  1IDS A;  1XDC A;  1BS3 A;  1JA8 A;  1PL4 A;  2P4K A;  5A9G A;  2CDY A;  1IX9 A;  1ZSP A;  2ADP A;  1EN4 A;  3DC5 A;  1QNM A;  2CE4 A;  1BT8 A;  1MNG A;  4E4E A;  1LUW A;  2QKA A;  1D5N A;  1AP5 A;  1LUV A;  1ZLZ A;  2AW9 A;  1EN5 A;  1AP6 A;  1MMM A;  1N0N A;  1GN2 A;  3KDR A;  3IC9 A;  4JZ2 A;  1JR9 A;  1XRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...