4F6EA

Crystal structure of the k182r, a183p mutant manganese superoxide dismutase from sacchromyces cerevisiae
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
192
Chain Sequence
VTLPDLWDFGALEPYISGQINELHYTHHQTYVNGFNTAVDQFQELSDLLAEPSPANARMIAIQQNIFHGGGFTNHCLFWENLAPESQGGGEPPTGALAAIDEQFGSLDELILTNTLAGVQGSGWAFIVNLSNGGLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNRPDYFAIWNVVNWEASRRFDAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Crystal Structure of the K182R, A183P mutant manganese superoxide dismutase from Sacchromyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
total genus 65
structure length 192
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4f6eA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4f6eA02
1QNMA 4C7UA 1LUVA 1GN6A 4E4EA 3LSUA 2P4KA 1JR9A 3IC9A 1MA1A 1XILA 1WB7A 1D5NA 1AP5A 1EN5A 1PM9A 1IDSA 1BT8A 1SZXA 2GDSA 2QKAA 2AW9A 1VARA 1P7GA 2ADQB 3DC6A 4X9QA 4YIPA 2ADPA 1WB8A 5A9GA 3MDSA 1ZLZA 4BR6A 1XREA 1AR5A 3BFRA 4YIOA 1AVMA 1I08A 3AK2A 3EVKA 1IX9A 1AP6A 4GUNA 3OT7A 2CDYA 2QKCA 3RN4A 5AG2A 1EN6A 1I0HA 3DC5A 1EM1A 4JZGA 4FFKA 3AK1A 1ZTEA 1EN4A 1GN2A 1VEWA 1XUQA 4JYYA 1N0JA 3CEIA 1ZUQA 1XDCA 1JA8A 1MSDA 3AK3A 1PL4A 3K9SA 1AR4A 1GN3A 1Y67A 1LUWA 3TJTA 1IXBA 1B06A 2CE4A 4JZ2A 1ZSPA 4F6EA 1KKCA 1MNGA 3C3TA 3KKYA 1MMMA 2RCVA 1BSMA 3QVNA 3C3SA 1N0NA 1GN4A 1BS3A
chains in the Genus database with same CATH superfamily
5C8YA 3CC2V 4G2KA 4W4KA 5IY5B 1WJZA 1HWYA 2WA4A 1IBLO 2F4VO 1SF9A 5IJ9B 2YI9A 2BTQA 1D5NA 2JGDA 4KUMA 4JTDB 4KHPO 2ZXWB 4LP8A 1NTKH 3KZIZ 2YS8A 4FMTA 3CYOA 2PGGA 3ZRWB 1GK9A 2UXBB 4XBFA 2JIZG 4O4LB 2ADQB 1NJIW 3BA9A 3MAQA 3SJQC 3N2KA 2P6JA 1WA8B 3WFVA 4GX1A 5B3SC 3OTOO 5CMUA 4AILC 4LF6B 2V7QG 1AR5A 2VQEO 1OCZC 1SQFA 4J80A 3W7TA 2OCHA 2BOCC 1NH2B 4JYBA 4LC1A 2XUMA 5GONA 1Y74B 1R6NA 2YIDA 2Y69B 4BW5A 2PYLA 3SPJA 1TUEB 4AHCA 2QA4V 4LNUB 5IY5C 3K57A 3OGIB 2BOBC 5LBQA 1ZUQA 1MSDA 1YJ9V 5DEDA 1VQ4V 1XHXA 1IBKB 1HW7A 4DV2B 4FJCC 5EYPB 3M7MX 5CA3A 4R7CA 4ZHQB 3E8HA 5BMVB 5A2QN 3SJBC 1HR0B 4F6EA 4NTYA 3JASB 1Q5OA 2ZR3A 3SYQA 2YEVA 3QVNA 2DMXA 1K34A 2ZM6O 1DTOA 3E2EA 2GBOA 2OWOA 3LDEA 2ZINA 4NXNO 4IGGA 2EIKB 1WB7A 1Q6UA 1AP5A 4DV7O 3N2GA 3DXRA 3IAYA 4JAUA 2GSMB 4H37A 4I4TB 1SA0B 2CK3G 3S3XA 5LOVA 1G1XB 3RFRA 5CBFA 3CRMA 2P06A 4YIPA 1FFXA 1UJWB 2ATKC 1VQOV 2DOSA 2Y69C 1IBMO 4LFAO 1J95A 2AHYA 3HB3B 1O9HA 2IH3C 2YXYA 4U7NA 2UUBB 4WFEA 1TAEA 3RWRD 2P90A 1XHZA 1M93A 1IX9A 4X66O 4OX9O 3CRQA 2AZ0A 1V54B 2VWKA 3H1JH 3O9OA 4TV9B 5B5EZ 2UUAB 4UV8A 1S3JA 5FPRA 1WNSA 3TCUA 4X62O 2FTKA 2XAJA 1SRYA 1FXKA 1VEWA 4O4JA 1IJGA 3P30A 3JD3A 4UCTA 4NXMO 2C2AA 3EHBB 2IBZH 5LMNB 2QEXV 4JI4B 5L3FA 4FLXA 4IHJA 3SYOA 4JI0O 4B3RO 1UFIA 5EZYA 1AILA 4LFBB 2FL4A 2EIMB 1GO3F 5H2FZ 4DV5B 1B3QA 3KCXA 2V4DA 1JNBA 3ZJZA 1JOYA 5LYJB 2UXDB 1NVPB 2B5UA 1MNGA 2HR3A 3H9VA 5JQGB 4PV1B 2DJVA 3ASNC 3JARB 3A0HZ 1VF6C 1SQQH 4GKKB 2N74A 3LSUA 1FJGB 3HKEA 3ABMB 4CS4A 1XL4A 2CTQA 1FAFA 3U0ZA 4O4IB 2QKSA 1EN5A 3SGIA 5EIBD 4DW0A 2ZE5A 4DR3B 4J41A 3MD0A 2Y4UA 2YXLA 3E22B 3H1KH 1P4RA 4TT3G 1V54C 2UXCO 1IURA 1VQ9V 5H6RA 2B9ZA 2CH7B 3K5NA 1ZX3A 3ETGA 4YHHB 1CPYA 1N8RW 2B1GA 4DV4O 1VQLV 1LR1A 2RNBA 4PI0A 3CXHF 2UXBO 1Q6HA 4PA6A 1M4UA 3ZMVA 2KSDA 2JJ1G 2D3OW 2IW5A 1G4YB 3OR7C 4UCOA 1NT2B 1R73A 1P49A 3S3WA 2KQXA 2NNUA 2Q5ZA 3FB7C 5E79Z 3UCSC 2F43G 3QNEA 1QVGU 4CS3A 2FKXA 3ETDA 4J9ZB 5FNVA 2FMLA 3CS5A 3CJHA 1M90W 2L6LA 4LWSA 2A06H 5KHJA 2W6JG 4H13B 1L8DA 3ABMC 1QCEA 4MTOA 1QBZA 4ZIBA 1K33A 1W0JG 3ZHTA 2ODMA 5F2VO 1OJHA 2PTMA 2JS3A 2R70A 2IU0A 2RDCA 4U7OA 3SYPA 2BE3A 3FAVA 3AG1B 1OCRB 2GTSA 1Q82W 3CC4V 4YJ2B 2Q4PA 4I5SA 4J7KA 3T2MA 1N0NA 4LFCB 1IBKO 4PDLA 4DV2O 3PJSK 2GUZB 1GN6A 3LSSA 3H01A 1YHQV 3ZS8C 1XILA 4RQFA 1SQBH 1ZAUA 1IBLB 1AI6A 5LHIA 4LBEC 1G8MA 1NQTA 4I9WA 2GDSA 2Z3YA 1R3JC 2AW9A 3ASOB 2ZNJA 4WFGA 1CXZB 2DWEC 3K79A 2E5LO 1VQ5V 4JI8B 2LP7A 2WAMA 5L3GA 2AZ2A 1WB8A 4MW3A 2JVDA 1ZLZA 2EIJB 1R6TA 3LNMB 4F6RA 3FB5C 4LF8O 4OXSA 3FYIB 2PY5A 5IYCO 3VQVA 4DV3B 3J7AU 3P3PA 5EBWC 3ZHVA 5KA5A 5LHGA 1N32O 1Y66A 2VQEB 3L71H 4FLVA 4D6TH 2IJJA 3VOUA 1KMIZ 1GTOA 1URFA 3R65A 4IT5A 2PZSA 2G38A 2HG5C 3OE7G 1HNWB 4FFKA 4X1KB 1U97A 2EJ7A 4ZOLB 4CH3A 1TUBB 1DLBA 4XDJA 3D36C 4EB6A 4QE7A 1K4DC 1YEWA 3K3WA 4I55B 4DRXB 2QSAA 3AG4B 3OMAB 1N33O 3HKBB 1IXBA 4QGPA 2DE0X 3W7UA 3A0BZ 3STZC 1KKCA 2XAQA 4BIOA 4MVMA 2WLKA 5LXTA 4LFBO 5LA6A 5K1XA 3UO2A 1FXVA 3UM7A 3WB0A 3CCQV 2IJIA 1JR9A 4IIJA 1F4NA 2UXDO 2EIJC 5KMGB 2OCCB 5DECA 3ABKB 1IDSA 1VMGA 5IYZA 1Z5VA 1SC5B 4WF9V 4GKKO 1RPOA 1BL8A 1F7YA 2ARHA 4OPHA 2CGNA 2XHBA 1AI7A 4PELA 4PJ0Z 1ZL8A 2VS0A 2Q0OC 3F7VC 3RBZA 5CBGA 4P30A 5EC2C 4PDMA 3MDSA 2X6AA 3ZRSA 4DR3O 1SQXH 4HNAA 4JI3B 3RW0A 4GKJO 4NVPA 4LFAB 3MHSC 1Q43A 1ROPA 5LHHA 1VF5B 3IFXA 4MSWC 4UCUA 3AG4C 1QLEB 3HR0A 5BY1A 1WN7A 4TQFA 1BGYH 1H5WA 4LH7A 1Q8IA 5KX5B 2QKCA 1KB9F 4YHHO 4X66B 3A0RA 2WLIB 3H1IH 5IJ0A 1DF4A 3K58A 2A9HA 4EFBA 4OGQB 4X62B 1T5EA 1SKVA 3WB2A 3J80N 1YVWA 2W0FC 3AG3C 2YIAA 1NKDA 3JSNA 4X65B 5LL6Y 1WAZA 4JASA 2OCCC 3CRAA 3AG7A 4JTAB 1M1KW 1CP9A 2KG7A 2VQFO 1ZSPA 5B3SB 5CBHA 4DYLA 3OEHG 2B1IA 2XNDG 3ABLC 2LFSA 3CX5F 2QWNB 5IJ9A 2ZD9A 1AI5A 1JFFB 4PA9A 2WLLA 1JJOA 4FLYA 1PM9A 1BCCH 3ZRWA 3ETEA 3K59A 5EK0A 2Q73A 4O4LA 4MVRA 3CPWU 1QLEC 1SZXA 2V1DA 3DTUB 1HDJA 3HKCB 2IJKA 1WA8A 5BR8B 2WA3A 3F7YC 1VARA 1P84F 2A3QA 2AHZA 5KAIZ 4H33A 4X9QA 3L75H 1W2BU 2MK3A 1N36B 2UXCB 5A9GA 3B77A 4FLTA 1K4CC 3UT5B 2EX3A 5CB4B 4UB6Z 2UU9O 1XREA 3M99B 3SJCC 2GTAA 4DV4B 4JI8O 1QVFU 3E8FA 4CC6A 2P67A 1E79G 1H8EG 1Y74A 3JYCA 1XL6A 5KHHA 3SDLA 4HBNA 2N04A 4J9YB 2XAHA 3RYIB 2A79B 4FK5C 3OM3B 5IWAO 2ZE7A 4LNUA 1H2KA 4DV3O 3ZRXA 4QPKA 2HP8A 4N21A 4O2BB 1N34B 2LFRA 3BAAA 1US6A 5EYPA 1SS3A 2QJ1A 1DGSA 4UXNA 4P9PA 5BMVA 4PHZA 1HNWO 1Y4MA 3SPCA 1F23A 4LF9B 2R9IA 4QJFB 5LGTA 1QLNA 2OTJV 2Y48A 1BE3H 1H8HG 4LF7O 1QNMA 3P32A 4UB8Z 5EBMC 4PDVA 1XOUA 4I0XB 1R3IC 3K03A 4J10A 3CD6V 4IL6Z 4ABMA 4I4TA 1SA0A 2Q7HA 1QR9A 1XMQO 4X20A 4K8XA 3ZHRA 2ZIOA 5CA0B 1KP3A 5LP6C 3LSQA 1NR1A 2DYSB 1AB3A 1KP2A 4UV9A 3CWBH 3BY6A 3SR2C 4O4HB 5LGNA 2E5LB 1P7BA 1NH2D 4JI6B 1F4MA 2CGOA 3BFRA 3IJ4A 3SPGA 5B66Z 4EEQA 5DM6V 3CSXA 4LF8B 4TV9A 1DF5A 5D5QA 3E35A 4A5UB 3ASNB 2QM8A 3OAAG 1CEZA 3K0GA 2OIEA 1D2DA 1VQPV 4JI3O 4B3MB 3GWOA 1N32B 3E8GA 3AK1A 1DK1A 5DN6G 1OV9A 4DV1B 3CCMV 5JWPA 2JS5A 4U3JB 2JRIA 1VQ8V 1Y76B 3RYHB 5LYJA 1Y67A 1KC8W 5HFMA 4NKGB 4MTXA 3G67A 4LF5B 1KBHA 5JQGA 1JQ0A 3LUTB 4N23A 2GV9A 3JARA 4FVMA 3DXRB 5JCOA 2DYSC 1N33B 5EBLC 3CCRV 5J2TA 4X65O 2WSSG 2OIGA 1K5QA 4K35A 3JD1A 5LOVB 3JALB 4X1YB 4DR1O 1YJNV 2OT5A 4O4IA 1M56B 1QU7A 1W0KG 1RM1C 2ZDIA 2Q6AA 3D3IA 3E22A 4CC5A 3G6BA 1VQ7V 2X7RB 2ZT9B 3D3QA 3ZN0A 4WFAV 4FZ1A 1AJPA 4H0LB 4PA4A 2CH7A 4R8CA 1VQMV 1UPGA 4B08A 4UFZA 1PNKA 2LGQA 5D5PA 4DK0A 1ORQC 1NTZH 4WFFA 5BR8O 4P9OA 2DW4A 3EVKA 4MS2A 4O4JB 4GKJB 4GUNA 2FB5A 5B1BB 1N36O 1HNXB 3TK1A 2IU3A 1I5YA 4LR3A 1E1RG 2HKOA 2XOKG 4QIWF 4ZI7A 4X64B 2YC0A 4Z2WA 4R50A 3DSQA 4O2AB 2UXNA 4GX0A 1MSWD 1PPJH 5JVDA 3K5OA 1NVPD 1M56C 3CCLV 2YUAA 1K73W 4PI2A 3BRCA 5KAFZ 1XEQA 4L87A 3HKEB 2Y0IA 4MTFA 3JATA 3QF7A 1N34O 2EINC 1ENVA 1IXMA 5FPOA 2NLJC 1MMMA 2GUZA 2LO1A 2VQFB 4TQDA 2D2CB 4PD4F 3WU2Z 1Q6IA 1PL0A 3I55V 4JI2O 2EILB 2CTWA 4LF9O 5FLXN 2M6YA 5KUKA 3OEEG 2HVJC 3OGCC 1KQSU 3K08A 4U3FH 3GVMA 2IH1C 4NTXA 1FXKC 5CN0A 2ZE6A 1H38A 4X89A 3SJAC 5B1BC 3J81N 4CBCA 3K5LA 1HP8A 1Z2GA 1GH6A 2DQ0A 3FB8C 2K1EA 2XAFA 5KA6A 4JYAB 1R1BA 1FPOA 5GTIZ 2Q69A 1Q86W 3EFFK 3ML0A 5J9PC 4YY3O 4TV8B 1K5SA 3L70H 2KB1A 3APOA 5FNVB 3HKDB 1PKXA 2WLJA 2DN9A 2UU9B 3ICXA 4LWSB 1SZTA 3UO3A 2CDYA 4WBNB 4JI1O 3RN4A 5AG2A 4MTGA 3ZBHA 4X1KA 1QR8A 3OUSA 4JI6O 2OYQA 4ZOLA 3W7WA 2RMKB 4DUZO 1I94B 1TUBA 1LNQA 3WG7C 3AEIA 1GN2A 3AG2B 3K06A 1TVKB 4E2LA 5IWAB 4FM1A 2FYUH 4XDKA 4DRXA 1K9MW 5KHKA 3CCSV 2A0LA 2EILC 2CAZC 4J7ZA 4B3MO 3DGEA 4I50B 2H94A 2QDOA 1KECA 3HKBA 3K9SA 3T4DA 3W7SA 1J5EB 1BQ0A 1MZEA 1B06A 4JZ2A 4BAYA 1FOUA 2JGUA 3JD2A 4DV1O 3T1YO 1V55C 1THZA 3KKYA 3E83A 4DR4B 1AI4A 3QO7A 3OR6C 4IYHA 3JAKB 5KMGA 4LF7B 3TXSA 4LF5O 3X2QC 1MA1A 1V9PA 5TISZ 5KUMA 4DR6B 1K3EA 3L9DA 3UKMA 2NN4A 2DWDC 1KD1W 1JX9A 4F6RB 3RYFB 4FM2A 1XMQB 1JPXA 3QG5A 1P7GA 2JDIG 2DQ3A 1WPXA 2F66C 4X1IA 3AG3B 4CH4A 1SQPH 3OW2U 4Z1VA 2Q9LA 4QNHB 3AG2C 1Q7YW 1B04A 3VQYA 1YI2V 4D7TA 5JH7B 4KFMA 3LNNA 3ABLB 3A2FA 2WLIA 4FIPC 5HFLA 1M5IA 1GRJA 2ETNA 5J2UA 1YXBA 2ZCEA 2Y0PA 3CCJV 1YF2A 2HVKC 4ZBMA 3BA8A 4UVCA 4WFHA 4JYCA 4K8ZA 5CA1B 1HNXO 1OCOC 3FB6C 2BSKB 1MG1A 2F23A 4X88A 4TUYB 3IC7A 3APQA 1GAXA 1PL4A 4X64O 1LUWA 1IVSA 3C90A 3TJTA 4JGSA 3Q4HB 3KG2A 5B1AC 3CCVV 4DR7O 2XASA 3FKSG 5IDJA 1R6KA 1IZ3A 3K04A 4H44B 4B3SO 4FPPA 2P4KA 3ABTA 4YJ3B 4FLZA 2LQTA 1ZL8B 2GHYA 1L0LH 1ZWIC 1X59A 1WLEA 4DR1B 2ITDC 1XNRO 3HKCA 5KLVH 4HNAB 2ZR2A 2PYJA 5ITZB 4J7JA 4QE9A 1KU9A 3UT5A 1FYJA 4FFBB 4MVUA 5CB4A 4NYKA 1H2NA 3BPZA 1NS1A 5H6QA 4AQYO 4UUJC 3ZCCA 1VIBA 2JK5C 1AR1B 1QQCA 1PP9H 1U96A 1AVMA 2CUGA 3ZHUA 2EBOA 1GKFA 2N05A 4JYAO 3RYIA 1S5LZ 2PI4A 3ZEDA 2E76B 3ZMUA 5L3BA 4DR5O 1EN6A 3THOA 5B1NA 3B2EE 1SETA 1M9NA 1BZKA 2P22C 4X8AA 1S5JA 4JI7B 3UQ8A 1VQKV 2PF4E 4IYIA 5LP6B 3TXQA 5JJJB 1TA8A 2RN9A 3RGBA 2QM7A 2WPDG 3B09A 2ZKOA 1FKAO 1QHTA 2UXXA 1I94O 4LF4O 3JAWB 5H5NA 3CCUV 1BQZA 1RSOB 4F4LA 2WLLB 3U10A 1YITV 1AJNA 5BZBA 2HHHO 1H2SB 2QWQB 2HJFC 3WB1A 2R9AA 1BSMA 2XTAA 3C3SA 4I0XA 4B7EA 1GN4A 1FFTB 3ZN1A 1XI1A 4ICGA 3SPIA 1J5EO 1LUVA 3VQWA 2PUSA 2EZOA 4ZHQA 4JAVA 3RYCB 2YIBD 3CRRA 5C8YB 1SESA 5CA0A 4Z1MG 2JEUA 1FXHA 3JASA 5IE9A 4JI2B 4J11A 1YDXA 3CP1A 1BMFG 2BTQB 2JGDB 3VQXA 4MVZA 4DR4O 3T1HO 2A7WA 2ZE8A 2QKAA 2QWPB 3JSLA 4PDRA 1S5HC 4O4HA 3FFQA 4DR6O 3B40A 1L0NH 2EULA 3T4ZA 1YTFB 2HJDA 3QO5A 3N2KB 3JD0A 4K3AA 3CC7V 1NTMH 4BR6A 1GM9A 2H3OA 3EXAA 5IT9N 2YI8A 3NR7A 4YY3B 1VF6A 3CE2A 1GM7A 3ZMZA 4JTCB 1NU1H 2LW7A 3BABA 1SQVH 3O65A 2UUCB 2W0XA 2QR4A 3DC5A 2Z0AA 4DV0O 2KKWA 2ZXWC 4KXRA 4RWUA 3LDCA 1EM1A 1PV0A 4MVOA 2RQ6A 4JI1B 4HAMA 5GONB 4NTWA 1H2LA 1XNQB 1EN4A 1RM1B 1YZBA 2ITCC 2EJRA 4DUZB 1JMKC 1AJQA 2P4VA 3CEIA 4U3JA 1Y76A 4CH6A 3RYHA 1MABG 3H1HH 4HYOA 4EFEA 3D8CA 4W4LA 4X20B 4DXWA 1HNZO 2RCVA 1YTFD 1B6QA 3JALA 4X1YA 1BS3A 2F1MA 4R6ZA 3T1YB 3ZHSA 4JI5B 2YEVB 2WLMA 1H2GA 4MT8A 3STLC 4I9QA 4B3TO 4MW8A 4B7KA 1XMOO 5IYDO 2X6BA 3I56V 4OPAA 1RP3B 3N2GB 1F51A 5LGUA 1L1FA 4DR2B 4FM0A 1JJ2U 4DW1A 3DC6A 1KYOF 5GW7A 5LMUB 4DV6O 2Q7GA 3KCYA 3LDDA 4JV5O 4LCUC 4RO2A 1XQ8A 4G28B 2WWWA 1FFXB 4FLWA 2WLNA 3ZX6A 3OMIB 2EINB 4Q20A 3BEHA 1PNMA 3BHPA 3AK2A 1AP6A 2EIKC 3U11A 1KUQA 5L3DA 1YIJV 1JCHA 4GYCB 3NXSA 4O2AA 4I7ZB 2BTOA 2HEPA 4TOIA 4JZGA 3CXCU 2JJ2G 1VQNV 3F5WC 3QTCA 4JYYA 3T1CA 1N0JA 1FXKB 4BW9A 2R9RB 2DYRB 5J2TB 5L3EA 1GN3A 5JJNB 3I5DA 4IHJB 4NB5A 5EZYB 3H1LH 1S72V 3RVYA 4JI7O 2MW2B 3F5TA 3C3TA 2RJZA 2VRZA 3R66A 4DR7B 1GMGA 4DUYB 5EIBC 2M7WA 1EZVH 4GZRB 1N4CA 3ZMSA 2IJHA 2YXHA 2E74B 2O57A 3OD4A 5JJEB 4B3SB 4YXWG 1WP7A 1AROP 4YJ2A 1FD9A 1A32A 3A8TA 4RUFA 3D36A 3WG7B 1R3LC 2EIMC 1XNRB 4D7SA 3L74H 4LF6O 2ADPA 1R3KC 4K0KB 4TV8A 2LW1A 3G6EV 3HKDA 3CHXA 4MVSA 5JCOC 4ZI7B 4AQYB 4RQEA 2Q7EA 1D5AA 4WBNA 2DYRC 1V55B 2BCCH 5IYBO 3OT7A 5KHGA 5JVDB 1H2MA 1NBMG 4PA3A 3OUFA 4RUEA 4J42A 3K5MA 4HZ3A 3X2QB 1TVKA 2ZDIC 4DR5B 1OCCB 3JATB 3JCUZ 4JF3A 4I50A 1XUQA 1E1QG 3RVZA 3CJHB 2UUCO 2QTSA 1S77D 3AK3A 2R72A 1HR0O 2XT9A 4DK1A 1XNQO 3TETA 2F4VB 1JVMA 4NR1A 1M57B 2CE4A 2Y4TA 2ILMA 3ZHQA 4ASUG 4P2ZA 2QWOB 4LF4B 3G80A 4FLUA 3FAVB 3JAKA 4KHPB 4I55A 4QPJA 1TGOA 4KL1A 2HHHB 5L3CA 4RAIA 3K0DA 1RFYA 4ZKIA 2CTRA 3IC9A 2F93B 3OMNB 5C93A 4WFBV 1O9GA 2LJ2A 2W6IG 3RT3C 3RYFA 3SYAA 1RPRA 1NI8A 4GX2A 1VP7A 3OTOB 1OZ0A 1KKDA 3OTFA 3ABUA 3ETQA 3ZRVA 2HFEC 4JI5O 1SERA 3E86A 3GB7C 2QWRB 1I5XA 3T1HB 1S0VA 1OCOB 3BCCH 3P3NA 1NR7A 3OFNG 1Q3EA 3AG1C 1MZFA 1OCRC 3B8MA 1Q90D 2UUBO 3M8AA 1OCCC 2YDEA 3QO8A 5K1PA 5E1AC 5JH7A 4DR2O 2EZPA 4JPRA 5B1AB 3BVOA 1Y6XA 3GWKC 4G27B 2OTLV 2ZQMA 3JAMN 1EFRG 2YICA 5LMUO 2UUAO 1OHHG 2Q68A 3CMEV 2QGNA 1M57C 3ZIAG 3ZMTA 3E89A 4XDLA 5H9CA 5CA1A 2BSKA 4GT1A 1ZTEA 4TUYA 5LMNO 4JI4O 1W59A 4DV0B 3ASOC 3W7XA 4TSFG 1NZ6A 4Q6GA 1GM8A 4UCSA 4CZZA 4DV5O 5KX5A 1XDCA 3FX7A 1JA8A 3B4SA 1AR4A 2ZM6B 2K9PA 3Q4HA 3TGUH 4EB6B 4CH5A 1I7FA 4NXNB 4BIZA 4TWKA 1COWG 1BHBA 3L72H 2X0LA 1K7DA 4DV7B 1XBLA 4AI8A 2Z5UA 1SQGA 1FJGO 4FZ0A 3JCZA 4C7UA 5KHIA 3MHHC 4YJ3A 4BIUA 2ZIMA 4WCEV 1YSCA 1HNZB 4E4EA 5LXTB 2PI5A 5LA6B 4GX5A 1MOFA 2YSUB 3PN1A 4MVQA 2F95B 5BXZA 2QTOA 4X1IB 1EZJA 4IIJB 5ITZA 4GCZA 2P5OA 4B3TB 2CTPA 4PA7A 4UCRA 1IBMB 1BT8A 4DUYO 3L73H 2QE7G 1XMOB 1FS0G 2NR5A 3FYEB 2Q8VA 4FFBA 5IYZB 1JFFA 3CCEV 3IGAC 4OX9B 1S76D 4DO2A 1G6UA 1WP8A 4KP4A 3HPLC 4EKWA 5J2UB 2YIBA 2E3CA 4DV6B 4GLXA 4JV5B 3E8BA 1VF7A 4YIOA 1I08A 4UCVA 5FL7G 2H8PC 3SYCA 2ZNIA 2L35A 3CRCA 2QM4A 1Q81W 4LH6A 4JAAA 2WLHA 4K0KO 3SPHA 1X4TA 4NXMB 2Q0AA 2VWJA 2JEXA 1I0HA 4JI0B 1EBOA 4B3RB 3ABKC 2LGWA 2E75B 3CMAV 5LP6A 2Q67A 3N27A 5B1OA 5IJ0B 2XAGA 2X6CA 1PNLA 2P7TC 2AGAA 1K8AW 3G71V 4L8JA 5GTHZ 1K92A 4UVBA 5EC1C 1OCZB 1PD3A 1YJWV 3G4SV 3JAWA 2AXTZ 1RSOA 1K97A 4BWAA 1VQ6V 1BHAA 3VBBA 4CS2A 1Z5WA 3CB2A 3KDRA 4O2BA 4LFCO 1WPBA 3K9AA 2KG7B 4UVAA 3JD4A 2IM9A 1YCIA 3FD9A 3B8NA 2HLDG 3RYCA
chains in the Genus database with same CATH topology
1QNMA 4C7UA 1LUVA 1GN6A 4E4EA 3LSUA 2P4KA 1JR9A 3IC9A 1MA1A 1XILA 1WB7A 1D5NA 1AP5A 1EN5A 1PM9A 1IDSA 1BT8A 1SZXA 2GDSA 2QKAA 2AW9A 1VARA 1P7GA 2ADQB 3DC6A 4X9QA 4YIPA 2ADPA 1WB8A 5A9GA 3MDSA 1ZLZA 4BR6A 1XREA 1AR5A 3BFRA 4YIOA 1AVMA 1I08A 3AK2A 3EVKA 1IX9A 1AP6A 4GUNA 3OT7A 2CDYA 2QKCA 3RN4A 5AG2A 1EN6A 1I0HA 3DC5A 1EM1A 4JZGA 4FFKA 3AK1A 1ZTEA 1EN4A 1GN2A 1VEWA 1XUQA 4JYYA 1N0JA 3CEIA 1ZUQA 1XDCA 1JA8A 1MSDA 3AK3A 1PL4A 3K9SA 1AR4A 1GN3A 1Y67A 1LUWA 3TJTA 1IXBA 1B06A 2CE4A 4JZ2A 3KDRA 1ZSPA 4F6EA 1KKCA 1MNGA 3C3TA 3KKYA 1MMMA 2RCVA 1BSMA 3QVNA 3C3SA 1N0NA 1GN4A 1BS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNM A;  4C7U A;  1LUV A;  1GN6 A;  4E4E A;  3LSU A;  2P4K A;  1JR9 A;  3IC9 A;  1MA1 A;  1XIL A;  1WB7 A;  1D5N A;  1AP5 A;  1EN5 A;  1PM9 A;  1IDS A;  1BT8 A;  1SZX A;  2GDS A;  2QKA A;  2AW9 A;  1VAR A;  1P7G A;  2ADQ B;  3DC6 A;  4X9Q A;  4YIP A;  2ADP A;  1WB8 A;  5A9G A;  3MDS A;  1ZLZ A;  4BR6 A;  1XRE A;  1AR5 A;  3BFR A;  4YIO A;  1AVM A;  1I08 A;  3AK2 A;  3EVK A;  1IX9 A;  1AP6 A;  4GUN A;  3OT7 A;  2CDY A;  2QKC A;  3RN4 A;  5AG2 A;  1EN6 A;  1I0H A;  3DC5 A;  1EM1 A;  4JZG A;  4FFK A;  3AK1 A;  1ZTE A;  1EN4 A;  1GN2 A;  1VEW A;  1XUQ A;  4JYY A;  1N0J A;  3CEI A;  1ZUQ A;  1XDC A;  1JA8 A;  1MSD A;  3AK3 A;  1PL4 A;  3K9S A;  1AR4 A;  1GN3 A;  1Y67 A;  1LUW A;  3TJT A;  1IXB A;  1B06 A;  2CE4 A;  4JZ2 A;  1ZSP A;  4F6E A;  1KKC A;  1MNG A;  3C3T A;  3KKY A;  1MMM A;  2RCV A;  1BSM A;  3QVN A;  3C3S A;  1N0N A;  1GN4 A;  1BS3 A; 
#chains in the Genus database with same CATH topology
 5C8Y A;  3CC2 V;  4G2K A;  4W4K A;  5IY5 B;  1WJZ A;  1HWY A;  2WA4 A;  1IBL O;  2F4V O;  1SF9 A;  5IJ9 B;  2YI9 A;  2BTQ A;  1D5N A;  2JGD A;  4KUM A;  4JTD B;  4KHP O;  2ZXW B;  4LP8 A;  1NTK H;  3KZI Z;  2YS8 A;  4FMT A;  3CYO A;  2PGG A;  3ZRW B;  1GK9 A;  2UXB B;  4XBF A;  2JIZ G;  4O4L B;  2ADQ B;  1NJI W;  3BA9 A;  3MAQ A;  3SJQ C;  3N2K A;  2P6J A;  1WA8 B;  3WFV A;  4GX1 A;  5B3S C;  3OTO O;  5CMU A;  4AIL C;  4LF6 B;  2V7Q G;  1AR5 A;  2VQE O;  1OCZ C;  1SQF A;  4J80 A;  3W7T A;  2OCH A;  2BOC C;  1NH2 B;  4JYB A;  4LC1 A;  2XUM A;  5GON A;  1Y74 B;  1R6N A;  2YID A;  2Y69 B;  4BW5 A;  2PYL A;  3SPJ A;  1TUE B;  4AHC A;  2QA4 V;  4LNU B;  5IY5 C;  3K57 A;  3OGI B;  2BOB C;  5LBQ A;  1ZUQ A;  1MSD A;  1YJ9 V;  5DED A;  1VQ4 V;  1XHX A;  1IBK B;  1HW7 A;  4DV2 B;  4FJC C;  5EYP B;  3M7M X;  5CA3 A;  4R7C A;  4ZHQ B;  3E8H A;  5BMV B;  5A2Q N;  3SJB C;  1HR0 B;  4F6E A;  4NTY A;  3JAS B;  1Q5O A;  2ZR3 A;  3SYQ A;  2YEV A;  3QVN A;  2DMX A;  1K34 A;  2ZM6 O;  1DTO A;  3E2E A;  2GBO A;  2OWO A;  3LDE A;  2ZIN A;  4NXN O;  4IGG A;  2EIK B;  1WB7 A;  1Q6U A;  1AP5 A;  4DV7 O;  3N2G A;  3DXR A;  3IAY A;  4JAU A;  2GSM B;  4H37 A;  4I4T B;  1SA0 B;  2CK3 G;  3S3X A;  5LOV A;  1G1X B;  3RFR A;  5CBF A;  3CRM A;  2P06 A;  4YIP A;  1FFX A;  1UJW B;  2ATK C;  1VQO V;  2DOS A;  2Y69 C;  1IBM O;  4LFA O;  1J95 A;  2AHY A;  3HB3 B;  1O9H A;  2IH3 C;  2YXY A;  4U7N A;  2UUB B;  4WFE A;  1TAE A;  3RWR D;  2P90 A;  1XHZ A;  1M93 A;  1IX9 A;  4X66 O;  4OX9 O;  3CRQ A;  2AZ0 A;  1V54 B;  2VWK A;  3H1J H;  3O9O A;  4TV9 B;  5B5E Z;  2UUA B;  4UV8 A;  1S3J A;  5FPR A;  1WNS A;  3TCU A;  4X62 O;  2FTK A;  2XAJ A;  1SRY A;  1FXK A;  1VEW A;  4O4J A;  1IJG A;  3P30 A;  3JD3 A;  4UCT A;  4NXM O;  2C2A A;  3EHB B;  2IBZ H;  5LMN B;  2QEX V;  4JI4 B;  5L3F A;  4FLX A;  4IHJ A;  3SYO A;  4JI0 O;  4B3R O;  1UFI A;  5EZY A;  1AIL A;  4LFB B;  2FL4 A;  2EIM B;  1GO3 F;  5H2F Z;  4DV5 B;  1B3Q A;  3KCX A;  2V4D A;  1JNB A;  3ZJZ A;  1JOY A;  5LYJ B;  2UXD B;  1NVP B;  2B5U A;  1MNG A;  2HR3 A;  3H9V A;  5JQG B;  4PV1 B;  2DJV A;  3ASN C;  3JAR B;  3A0H Z;  1VF6 C;  1SQQ H;  4GKK B;  2N74 A;  3LSU A;  1FJG B;  3HKE A;  3ABM B;  4CS4 A;  1XL4 A;  2CTQ A;  1FAF A;  3U0Z A;  4O4I B;  2QKS A;  1EN5 A;  3SGI A;  5EIB D;  4DW0 A;  2ZE5 A;  4DR3 B;  4J41 A;  3MD0 A;  2Y4U A;  2YXL A;  3E22 B;  3H1K H;  1P4R A;  4TT3 G;  1V54 C;  2UXC O;  1IUR A;  1VQ9 V;  5H6R A;  2B9Z A;  2CH7 B;  3K5N A;  1ZX3 A;  3ETG A;  4YHH B;  1CPY A;  1N8R W;  2B1G A;  4DV4 O;  1VQL V;  1LR1 A;  2RNB A;  4PI0 A;  3CXH F;  2UXB O;  1Q6H A;  4PA6 A;  1M4U A;  3ZMV A;  2KSD A;  2JJ1 G;  2D3O W;  2IW5 A;  1G4Y B;  3OR7 C;  4UCO A;  1NT2 B;  1R73 A;  1P49 A;  3S3W A;  2KQX A;  2NNU A;  2Q5Z A;  3FB7 C;  5E79 Z;  3UCS C;  2F43 G;  3QNE A;  1QVG U;  4CS3 A;  2FKX A;  3ETD A;  4J9Z B;  5FNV A;  2FML A;  3CS5 A;  3CJH A;  1M90 W;  2L6L A;  4LWS A;  2A06 H;  5KHJ A;  2W6J G;  4H13 B;  1L8D A;  3ABM C;  1QCE A;  4MTO A;  1QBZ A;  4ZIB A;  1K33 A;  1W0J G;  3ZHT A;  2ODM A;  5F2V O;  1OJH A;  2PTM A;  2JS3 A;  2R70 A;  2IU0 A;  2RDC A;  4U7O A;  3SYP A;  2BE3 A;  3FAV A;  3AG1 B;  1OCR B;  2GTS A;  1Q82 W;  3CC4 V;  4YJ2 B;  2Q4P A;  4I5S A;  4J7K A;  3T2M A;  1N0N A;  4LFC B;  1IBK O;  4PDL A;  4DV2 O;  3PJS K;  2GUZ B;  1GN6 A;  3LSS A;  3H01 A;  1YHQ V;  3ZS8 C;  1XIL A;  4RQF A;  1SQB H;  1ZAU A;  1IBL B;  1AI6 A;  5LHI A;  4LBE C;  1G8M A;  1NQT A;  4I9W A;  2GDS A;  2Z3Y A;  1R3J C;  2AW9 A;  3ASO B;  2ZNJ A;  4WFG A;  1CXZ B;  2DWE C;  3K79 A;  2E5L O;  1VQ5 V;  4JI8 B;  2LP7 A;  2WAM A;  5L3G A;  2AZ2 A;  1WB8 A;  4MW3 A;  2JVD A;  1ZLZ A;  2EIJ B;  1R6T A;  3LNM B;  4F6R A;  3FB5 C;  4LF8 O;  4OXS A;  3FYI B;  2PY5 A;  5IYC O;  3VQV A;  4DV3 B;  3J7A U;  3P3P A;  5EBW C;  3ZHV A;  5KA5 A;  5LHG A;  1N32 O;  1Y66 A;  2VQE B;  3L71 H;  4FLV A;  4D6T H;  2IJJ A;  3VOU A;  1KMI Z;  1GTO A;  1URF A;  3R65 A;  4IT5 A;  2PZS A;  2G38 A;  2HG5 C;  3OE7 G;  1HNW B;  4FFK A;  4X1K B;  1U97 A;  2EJ7 A;  4ZOL B;  4CH3 A;  1TUB B;  1DLB A;  4XDJ A;  3D36 C;  4EB6 A;  4QE7 A;  1K4D C;  1YEW A;  3K3W A;  4I55 B;  4DRX B;  2QSA A;  3AG4 B;  3OMA B;  1N33 O;  3HKB B;  1IXB A;  4QGP A;  2DE0 X;  3W7U A;  3A0B Z;  3STZ C;  1KKC A;  2XAQ A;  4BIO A;  4MVM A;  2WLK A;  5LXT A;  4LFB O;  5LA6 A;  5K1X A;  3UO2 A;  1FXV A;  3UM7 A;  3WB0 A;  3CCQ V;  2IJI A;  1JR9 A;  4IIJ A;  1F4N A;  2UXD O;  2EIJ C;  5KMG B;  2OCC B;  5DEC A;  3ABK B;  1IDS A;  1VMG A;  5IYZ A;  1Z5V A;  1SC5 B;  4WF9 V;  4GKK O;  1RPO A;  1BL8 A;  1F7Y A;  2ARH A;  4OPH A;  2CGN A;  2XHB A;  1AI7 A;  4PEL A;  4PJ0 Z;  1ZL8 A;  2VS0 A;  2Q0O C;  3F7V C;  3RBZ A;  5CBG A;  4P30 A;  5EC2 C;  4PDM A;  3MDS A;  2X6A A;  3ZRS A;  4DR3 O;  1SQX H;  4HNA A;  4JI3 B;  3RW0 A;  4GKJ O;  4NVP A;  4LFA B;  3MHS C;  1Q43 A;  1ROP A;  5LHH A;  1VF5 B;  3IFX A;  4MSW C;  4UCU A;  3AG4 C;  1QLE B;  3HR0 A;  5BY1 A;  1WN7 A;  4TQF A;  1BGY H;  1H5W A;  4LH7 A;  1Q8I A;  5KX5 B;  2QKC A;  1KB9 F;  4YHH O;  4X66 B;  3A0R A;  2WLI B;  3H1I H;  5IJ0 A;  1DF4 A;  3K58 A;  2A9H A;  4EFB A;  4OGQ B;  4X62 B;  1T5E A;  1SKV A;  3WB2 A;  3J80 N;  1YVW A;  2W0F C;  3AG3 C;  2YIA A;  1NKD A;  3JSN A;  4X65 B;  5LL6 Y;  1WAZ A;  4JAS A;  2OCC C;  3CRA A;  3AG7 A;  4JTA B;  1M1K W;  1CP9 A;  2KG7 A;  2VQF O;  1ZSP A;  5B3S B;  5CBH A;  4DYL A;  3OEH G;  2B1I A;  2XND G;  3ABL C;  2LFS A;  3CX5 F;  2QWN B;  5IJ9 A;  2ZD9 A;  1AI5 A;  1JFF B;  4PA9 A;  2WLL A;  1JJO A;  4FLY A;  1PM9 A;  1BCC H;  3ZRW A;  3ETE A;  3K59 A;  5EK0 A;  2Q73 A;  4O4L A;  4MVR A;  3CPW U;  1QLE C;  1SZX A;  2V1D A;  3DTU B;  1HDJ A;  3HKC B;  2IJK A;  1WA8 A;  5BR8 B;  2WA3 A;  3F7Y C;  1VAR A;  1P84 F;  2A3Q A;  2AHZ A;  5KAI Z;  4H33 A;  4X9Q A;  3L75 H;  1W2B U;  2MK3 A;  1N36 B;  2UXC B;  5A9G A;  3B77 A;  4FLT A;  1K4C C;  3UT5 B;  2EX3 A;  5CB4 B;  4UB6 Z;  2UU9 O;  1XRE A;  3M99 B;  3SJC C;  2GTA A;  4DV4 B;  4JI8 O;  1QVF U;  3E8F A;  4CC6 A;  2P67 A;  1E79 G;  1H8E G;  1Y74 A;  3JYC A;  1XL6 A;  5KHH A;  3SDL A;  4HBN A;  2N04 A;  4J9Y B;  2XAH A;  3RYI B;  2A79 B;  4FK5 C;  3OM3 B;  5IWA O;  2ZE7 A;  4LNU A;  1H2K A;  4DV3 O;  3ZRX A;  4QPK A;  2HP8 A;  4N21 A;  4O2B B;  1N34 B;  2LFR A;  3BAA A;  1US6 A;  5EYP A;  1SS3 A;  2QJ1 A;  1DGS A;  4UXN A;  4P9P A;  5BMV A;  4PHZ A;  1HNW O;  1Y4M A;  3SPC A;  1F23 A;  4LF9 B;  2R9I A;  4QJF B;  5LGT A;  1QLN A;  2OTJ V;  2Y48 A;  1BE3 H;  1H8H G;  4LF7 O;  1QNM A;  3P32 A;  4UB8 Z;  5EBM C;  4PDV A;  1XOU A;  4I0X B;  1R3I C;  3K03 A;  4J10 A;  3CD6 V;  4IL6 Z;  4ABM A;  4I4T A;  1SA0 A;  2Q7H A;  1QR9 A;  1XMQ O;  4X20 A;  4K8X A;  3ZHR A;  2ZIO A;  5CA0 B;  1KP3 A;  5LP6 C;  3LSQ A;  1NR1 A;  2DYS B;  1AB3 A;  1KP2 A;  4UV9 A;  3CWB H;  3BY6 A;  3SR2 C;  4O4H B;  5LGN A;  2E5L B;  1P7B A;  1NH2 D;  4JI6 B;  1F4M A;  2CGO A;  3BFR A;  3IJ4 A;  3SPG A;  5B66 Z;  4EEQ A;  5DM6 V;  3CSX A;  4LF8 B;  4TV9 A;  1DF5 A;  5D5Q A;  3E35 A;  4A5U B;  3ASN B;  2QM8 A;  3OAA G;  1CEZ A;  3K0G A;  2OIE A;  1D2D A;  1VQP V;  4JI3 O;  4B3M B;  3GWO A;  1N32 B;  3E8G A;  3AK1 A;  1DK1 A;  5DN6 G;  1OV9 A;  4DV1 B;  3CCM V;  5JWP A;  2JS5 A;  4U3J B;  2JRI A;  1VQ8 V;  1Y76 B;  3RYH B;  5LYJ A;  1Y67 A;  1KC8 W;  5HFM A;  4NKG B;  4MTX A;  3G67 A;  4LF5 B;  1KBH A;  5JQG A;  1JQ0 A;  3LUT B;  4N23 A;  2GV9 A;  3JAR A;  4FVM A;  3DXR B;  5JCO A;  2DYS C;  1N33 B;  5EBL C;  3CCR V;  5J2T A;  4X65 O;  2WSS G;  2OIG A;  1K5Q A;  4K35 A;  3JD1 A;  5LOV B;  3JAL B;  4X1Y B;  4DR1 O;  1YJN V;  2OT5 A;  4O4I A;  1M56 B;  1QU7 A;  1W0K G;  1RM1 C;  2ZDI A;  2Q6A A;  3D3I A;  3E22 A;  4CC5 A;  3G6B A;  1VQ7 V;  2X7R B;  2ZT9 B;  3D3Q A;  3ZN0 A;  4WFA V;  4FZ1 A;  1AJP A;  4H0L B;  4PA4 A;  2CH7 A;  4R8C A;  1VQM V;  1UPG A;  4B08 A;  4UFZ A;  1PNK A;  2LGQ A;  5D5P A;  4DK0 A;  1ORQ C;  1NTZ H;  4WFF A;  5BR8 O;  4P9O A;  2DW4 A;  3EVK A;  4MS2 A;  4O4J B;  4GKJ B;  4GUN A;  2FB5 A;  5B1B B;  1N36 O;  1HNX B;  3TK1 A;  2IU3 A;  1I5Y A;  4LR3 A;  1E1R G;  2HKO A;  2XOK G;  4QIW F;  4ZI7 A;  4X64 B;  2YC0 A;  4Z2W A;  4R50 A;  3DSQ A;  4O2A B;  2UXN A;  4GX0 A;  1MSW D;  1PPJ H;  5JVD A;  3K5O A;  1NVP D;  1M56 C;  3CCL V;  2YUA A;  1K73 W;  4PI2 A;  3BRC A;  5KAF Z;  1XEQ A;  4L87 A;  3HKE B;  2Y0I A;  4MTF A;  3JAT A;  3QF7 A;  1N34 O;  2EIN C;  1ENV A;  1IXM A;  5FPO A;  2NLJ C;  1MMM A;  2GUZ A;  2LO1 A;  2VQF B;  4TQD A;  2D2C B;  4PD4 F;  3WU2 Z;  1Q6I A;  1PL0 A;  3I55 V;  4JI2 O;  2EIL B;  2CTW A;  4LF9 O;  5FLX N;  2M6Y A;  5KUK A;  3OEE G;  2HVJ C;  3OGC C;  1KQS U;  3K08 A;  4U3F H;  3GVM A;  2IH1 C;  4NTX A;  1FXK C;  5CN0 A;  2ZE6 A;  1H38 A;  4X89 A;  3SJA C;  5B1B C;  3J81 N;  4CBC A;  3K5L A;  1HP8 A;  1Z2G A;  1GH6 A;  2DQ0 A;  3FB8 C;  2K1E A;  2XAF A;  5KA6 A;  4JYA B;  1R1B A;  1FPO A;  5GTI Z;  2Q69 A;  1Q86 W;  3EFF K;  3ML0 A;  5J9P C;  4YY3 O;  4TV8 B;  1K5S A;  3L70 H;  2KB1 A;  3APO A;  5FNV B;  3HKD B;  1PKX A;  2WLJ A;  2DN9 A;  2UU9 B;  3ICX A;  4LWS B;  1SZT A;  3UO3 A;  2CDY A;  4WBN B;  4JI1 O;  3RN4 A;  5AG2 A;  4MTG A;  3ZBH A;  4X1K A;  1QR8 A;  3OUS A;  4JI6 O;  2OYQ A;  4ZOL A;  3W7W A;  2RMK B;  4DUZ O;  1I94 B;  1TUB A;  1LNQ A;  3WG7 C;  3AEI A;  1GN2 A;  3AG2 B;  3K06 A;  1TVK B;  4E2L A;  5IWA B;  4FM1 A;  2FYU H;  4XDK A;  4DRX A;  1K9M W;  5KHK A;  3CCS V;  2A0L A;  2EIL C;  2CAZ C;  4J7Z A;  4B3M O;  3DGE A;  4I50 B;  2H94 A;  2QDO A;  1KEC A;  3HKB A;  3K9S A;  3T4D A;  3W7S A;  1J5E B;  1BQ0 A;  1MZE A;  1B06 A;  4JZ2 A;  4BAY A;  1FOU A;  2JGU A;  3JD2 A;  4DV1 O;  3T1Y O;  1V55 C;  1THZ A;  3KKY A;  3E83 A;  4DR4 B;  1AI4 A;  3QO7 A;  3OR6 C;  4IYH A;  3JAK B;  5KMG A;  4LF7 B;  3TXS A;  4LF5 O;  3X2Q C;  1MA1 A;  1V9P A;  5TIS Z;  5KUM A;  4DR6 B;  1K3E A;  3L9D A;  3UKM A;  2NN4 A;  2DWD C;  1KD1 W;  1JX9 A;  4F6R B;  3RYF B;  4FM2 A;  1XMQ B;  1JPX A;  3QG5 A;  1P7G A;  2JDI G;  2DQ3 A;  1WPX A;  2F66 C;  4X1I A;  3AG3 B;  4CH4 A;  1SQP H;  3OW2 U;  4Z1V A;  2Q9L A;  4QNH B;  3AG2 C;  1Q7Y W;  1B04 A;  3VQY A;  1YI2 V;  4D7T A;  5JH7 B;  4KFM A;  3LNN A;  3ABL B;  3A2F A;  2WLI A;  4FIP C;  5HFL A;  1M5I A;  1GRJ A;  2ETN A;  5J2U A;  1YXB A;  2ZCE A;  2Y0P A;  3CCJ V;  1YF2 A;  2HVK C;  4ZBM A;  3BA8 A;  4UVC A;  4WFH A;  4JYC A;  4K8Z A;  5CA1 B;  1HNX O;  1OCO C;  3FB6 C;  2BSK B;  1MG1 A;  2F23 A;  4X88 A;  4TUY B;  3IC7 A;  3APQ A;  1GAX A;  1PL4 A;  4X64 O;  1LUW A;  1IVS A;  3C90 A;  3TJT A;  4JGS A;  3Q4H B;  3KG2 A;  5B1A C;  3CCV V;  4DR7 O;  2XAS A;  3FKS G;  5IDJ A;  1R6K A;  1IZ3 A;  3K04 A;  4H44 B;  4B3S O;  4FPP A;  2P4K A;  3ABT A;  4YJ3 B;  4FLZ A;  2LQT A;  1ZL8 B;  2GHY A;  1L0L H;  1ZWI C;  1X59 A;  1WLE A;  4DR1 B;  2ITD C;  1XNR O;  3HKC A;  5KLV H;  4HNA B;  2ZR2 A;  2PYJ A;  5ITZ B;  4J7J A;  4QE9 A;  1KU9 A;  3UT5 A;  1FYJ A;  4FFB B;  4MVU A;  5CB4 A;  4NYK A;  1H2N A;  3BPZ A;  1NS1 A;  5H6Q A;  4AQY O;  4UUJ C;  3ZCC A;  1VIB A;  2JK5 C;  1AR1 B;  1QQC A;  1PP9 H;  1U96 A;  1AVM A;  2CUG A;  3ZHU A;  2EBO A;  1GKF A;  2N05 A;  4JYA O;  3RYI A;  1S5L Z;  2PI4 A;  3ZED A;  2E76 B;  3ZMU A;  5L3B A;  4DR5 O;  1EN6 A;  3THO A;  5B1N A;  3B2E E;  1SET A;  1M9N A;  1BZK A;  2P22 C;  4X8A A;  1S5J A;  4JI7 B;  3UQ8 A;  1VQK V;  2PF4 E;  4IYI A;  5LP6 B;  3TXQ A;  5JJJ B;  1TA8 A;  2RN9 A;  3RGB A;  2QM7 A;  2WPD G;  3B09 A;  2ZKO A;  1FKA O;  1QHT A;  2UXX A;  1I94 O;  4LF4 O;  3JAW B;  5H5N A;  3CCU V;  1BQZ A;  1RSO B;  4F4L A;  2WLL B;  3U10 A;  1YIT V;  1AJN A;  5BZB A;  2HHH O;  1H2S B;  2QWQ B;  2HJF C;  3WB1 A;  2R9A A;  1BSM A;  2XTA A;  3C3S A;  4I0X A;  4B7E A;  1GN4 A;  1FFT B;  3ZN1 A;  1XI1 A;  4ICG A;  3SPI A;  1J5E O;  1LUV A;  3VQW A;  2PUS A;  2EZO A;  4ZHQ A;  4JAV A;  3RYC B;  2YIB D;  3CRR A;  5C8Y B;  1SES A;  5CA0 A;  4Z1M G;  2JEU A;  1FXH A;  3JAS A;  5IE9 A;  4JI2 B;  4J11 A;  1YDX A;  3CP1 A;  1BMF G;  2BTQ B;  2JGD B;  3VQX A;  4MVZ A;  4DR4 O;  3T1H O;  2A7W A;  2ZE8 A;  2QKA A;  2QWP B;  3JSL A;  4PDR A;  1S5H C;  4O4H A;  3FFQ A;  4DR6 O;  3B40 A;  1L0N H;  2EUL A;  3T4Z A;  1YTF B;  2HJD A;  3QO5 A;  3N2K B;  3JD0 A;  4K3A A;  3CC7 V;  1NTM H;  4BR6 A;  1GM9 A;  2H3O A;  3EXA A;  5IT9 N;  2YI8 A;  3NR7 A;  4YY3 B;  1VF6 A;  3CE2 A;  1GM7 A;  3ZMZ A;  4JTC B;  1NU1 H;  2LW7 A;  3BAB A;  1SQV H;  3O65 A;  2UUC B;  2W0X A;  2QR4 A;  3DC5 A;  2Z0A A;  4DV0 O;  2KKW A;  2ZXW C;  4KXR A;  4RWU A;  3LDC A;  1EM1 A;  1PV0 A;  4MVO A;  2RQ6 A;  4JI1 B;  4HAM A;  5GON B;  4NTW A;  1H2L A;  1XNQ B;  1EN4 A;  1RM1 B;  1YZB A;  2ITC C;  2EJR A;  4DUZ B;  1JMK C;  1AJQ A;  2P4V A;  3CEI A;  4U3J A;  1Y76 A;  4CH6 A;  3RYH A;  1MAB G;  3H1H H;  4HYO A;  4EFE A;  3D8C A;  4W4L A;  4X20 B;  4DXW A;  1HNZ O;  2RCV A;  1YTF D;  1B6Q A;  3JAL A;  4X1Y A;  1BS3 A;  2F1M A;  4R6Z A;  3T1Y B;  3ZHS A;  4JI5 B;  2YEV B;  2WLM A;  1H2G A;  4MT8 A;  3STL C;  4I9Q A;  4B3T O;  4MW8 A;  4B7K A;  1XMO O;  5IYD O;  2X6B A;  3I56 V;  4OPA A;  1RP3 B;  3N2G B;  1F51 A;  5LGU A;  1L1F A;  4DR2 B;  4FM0 A;  1JJ2 U;  4DW1 A;  3DC6 A;  1KYO F;  5GW7 A;  5LMU B;  4DV6 O;  2Q7G A;  3KCY A;  3LDD A;  4JV5 O;  4LCU C;  4RO2 A;  1XQ8 A;  4G28 B;  2WWW A;  1FFX B;  4FLW A;  2WLN A;  3ZX6 A;  3OMI B;  2EIN B;  4Q20 A;  3BEH A;  1PNM A;  3BHP A;  3AK2 A;  1AP6 A;  2EIK C;  3U11 A;  1KUQ A;  5L3D A;  1YIJ V;  1JCH A;  4GYC B;  3NXS A;  4O2A A;  4I7Z B;  2BTO A;  2HEP A;  4TOI A;  4JZG A;  3CXC U;  2JJ2 G;  1VQN V;  3F5W C;  3QTC A;  4JYY A;  3T1C A;  1N0J A;  1FXK B;  4BW9 A;  2R9R B;  2DYR B;  5J2T B;  5L3E A;  1GN3 A;  5JJN B;  3I5D A;  4IHJ B;  4NB5 A;  5EZY B;  3H1L H;  1S72 V;  3RVY A;  4JI7 O;  2MW2 B;  3F5T A;  3C3T A;  2RJZ A;  2VRZ A;  3R66 A;  4DR7 B;  1GMG A;  4DUY B;  5EIB C;  2M7W A;  1EZV H;  4GZR B;  1N4C A;  3ZMS A;  2IJH A;  2YXH A;  2E74 B;  2O57 A;  3OD4 A;  5JJE B;  4B3S B;  4YXW G;  1WP7 A;  1ARO P;  4YJ2 A;  1FD9 A;  1A32 A;  3A8T A;  4RUF A;  3D36 A;  3WG7 B;  1R3L C;  2EIM C;  1XNR B;  4D7S A;  3L74 H;  4LF6 O;  2ADP A;  1R3K C;  4K0K B;  4TV8 A;  2LW1 A;  3G6E V;  3HKD A;  3CHX A;  4MVS A;  5JCO C;  4ZI7 B;  4AQY B;  4RQE A;  2Q7E A;  1D5A A;  4WBN A;  2DYR C;  1V55 B;  2BCC H;  5IYB O;  3OT7 A;  5KHG A;  5JVD B;  1H2M A;  1NBM G;  4PA3 A;  3OUF A;  4RUE A;  4J42 A;  3K5M A;  4HZ3 A;  3X2Q B;  1TVK A;  2ZDI C;  4DR5 B;  1OCC B;  3JAT B;  3JCU Z;  4JF3 A;  4I50 A;  1XUQ A;  1E1Q G;  3RVZ A;  3CJH B;  2UUC O;  2QTS A;  1S77 D;  3AK3 A;  2R72 A;  1HR0 O;  2XT9 A;  4DK1 A;  1XNQ O;  3TET A;  2F4V B;  1JVM A;  4NR1 A;  1M57 B;  2CE4 A;  2Y4T A;  2ILM A;  3ZHQ A;  4ASU G;  4P2Z A;  2QWO B;  4LF4 B;  3G80 A;  4FLU A;  3FAV B;  3JAK A;  4KHP B;  4I55 A;  4QPJ A;  1TGO A;  4KL1 A;  2HHH B;  5L3C A;  4RAI A;  3K0D A;  1RFY A;  4ZKI A;  2CTR A;  3IC9 A;  2F93 B;  3OMN B;  5C93 A;  4WFB V;  1O9G A;  2LJ2 A;  2W6I G;  3RT3 C;  3RYF A;  3SYA A;  1RPR A;  1NI8 A;  4GX2 A;  1VP7 A;  3OTO B;  1OZ0 A;  1KKD A;  3OTF A;  3ABU A;  3ETQ A;  3ZRV A;  2HFE C;  4JI5 O;  1SER A;  3E86 A;  3GB7 C;  2QWR B;  1I5X A;  3T1H B;  1S0V A;  1OCO B;  3BCC H;  3P3N A;  1NR7 A;  3OFN G;  1Q3E A;  3AG1 C;  1MZF A;  1OCR C;  3B8M A;  1Q90 D;  2UUB O;  3M8A A;  1OCC C;  2YDE A;  3QO8 A;  5K1P A;  5E1A C;  5JH7 A;  4DR2 O;  2EZP A;  4JPR A;  5B1A B;  3BVO A;  1Y6X A;  3GWK C;  4G27 B;  2OTL V;  2ZQM A;  3JAM N;  1EFR G;  2YIC A;  5LMU O;  2UUA O;  1OHH G;  2Q68 A;  3CME V;  2QGN A;  1M57 C;  3ZIA G;  3ZMT A;  3E89 A;  4XDL A;  5H9C A;  5CA1 A;  2BSK A;  4GT1 A;  1ZTE A;  4TUY A;  5LMN O;  4JI4 O;  1W59 A;  4DV0 B;  3ASO C;  3W7X A;  4TSF G;  1NZ6 A;  4Q6G A;  1GM8 A;  4UCS A;  4CZZ A;  4DV5 O;  5KX5 A;  1XDC A;  3FX7 A;  1JA8 A;  3B4S A;  1AR4 A;  2ZM6 B;  2K9P A;  3Q4H A;  3TGU H;  4EB6 B;  4CH5 A;  1I7F A;  4NXN B;  4BIZ A;  4TWK A;  1COW G;  1BHB A;  3L72 H;  2X0L A;  1K7D A;  4DV7 B;  1XBL A;  4AI8 A;  2Z5U A;  1SQG A;  1FJG O;  4FZ0 A;  3JCZ A;  4C7U A;  5KHI A;  3MHH C;  4YJ3 A;  4BIU A;  2ZIM A;  4WCE V;  1YSC A;  1HNZ B;  4E4E A;  5LXT B;  2PI5 A;  5LA6 B;  4GX5 A;  1MOF A;  2YSU B;  3PN1 A;  4MVQ A;  2F95 B;  5BXZ A;  2QTO A;  4X1I B;  1EZJ A;  4IIJ B;  5ITZ A;  4GCZ A;  2P5O A;  4B3T B;  2CTP A;  4PA7 A;  4UCR A;  1IBM B;  1BT8 A;  4DUY O;  3L73 H;  2QE7 G;  1XMO B;  1FS0 G;  2NR5 A;  3FYE B;  2Q8V A;  4FFB A;  5IYZ B;  1JFF A;  3CCE V;  3IGA C;  4OX9 B;  1S76 D;  4DO2 A;  1G6U A;  1WP8 A;  4KP4 A;  3HPL C;  4EKW A;  5J2U B;  2YIB A;  2E3C A;  4DV6 B;  4GLX A;  4JV5 B;  3E8B A;  1VF7 A;  4YIO A;  1I08 A;  4UCV A;  5FL7 G;  2H8P C;  3SYC A;  2ZNI A;  2L35 A;  3CRC A;  2QM4 A;  1Q81 W;  4LH6 A;  4JAA A;  2WLH A;  4K0K O;  3SPH A;  1X4T A;  4NXM B;  2Q0A A;  2VWJ A;  2JEX A;  1I0H A;  4JI0 B;  1EBO A;  4B3R B;  3ABK C;  2LGW A;  2E75 B;  3CMA V;  5LP6 A;  2Q67 A;  3N27 A;  5B1O A;  5IJ0 B;  2XAG A;  2X6C A;  1PNL A;  2P7T C;  2AGA A;  1K8A W;  3G71 V;  4L8J A;  5GTH Z;  1K92 A;  4UVB A;  5EC1 C;  1OCZ B;  1PD3 A;  1YJW V;  3G4S V;  3JAW A;  2AXT Z;  1RSO A;  1K97 A;  4BWA A;  1VQ6 V;  1BHA A;  3VBB A;  4CS2 A;  1Z5W A;  3CB2 A;  3KDR A;  4O2B A;  4LFC O;  1WPB A;  3K9A A;  2KG7 B;  4UVA A;  3JD4 A;  2IM9 A;  1YCI A;  3FD9 A;  3B8N A;  2HLD G;  3RYC A; 
#chains in the Genus database with same CATH homology
 1QNM A;  4C7U A;  1LUV A;  1GN6 A;  4E4E A;  3LSU A;  2P4K A;  1JR9 A;  3IC9 A;  1MA1 A;  1XIL A;  1WB7 A;  1D5N A;  1AP5 A;  1EN5 A;  1PM9 A;  1IDS A;  1BT8 A;  1SZX A;  2GDS A;  2QKA A;  2AW9 A;  1VAR A;  1P7G A;  2ADQ B;  3DC6 A;  4X9Q A;  4YIP A;  2ADP A;  1WB8 A;  5A9G A;  3MDS A;  1ZLZ A;  4BR6 A;  1XRE A;  1AR5 A;  3BFR A;  4YIO A;  1AVM A;  1I08 A;  3AK2 A;  3EVK A;  1IX9 A;  1AP6 A;  4GUN A;  3OT7 A;  2CDY A;  2QKC A;  3RN4 A;  5AG2 A;  1EN6 A;  1I0H A;  3DC5 A;  1EM1 A;  4JZG A;  4FFK A;  3AK1 A;  1ZTE A;  1EN4 A;  1GN2 A;  1VEW A;  1XUQ A;  4JYY A;  1N0J A;  3CEI A;  1ZUQ A;  1XDC A;  1JA8 A;  1MSD A;  3AK3 A;  1PL4 A;  3K9S A;  1AR4 A;  1GN3 A;  1Y67 A;  1LUW A;  3TJT A;  1IXB A;  1B06 A;  2CE4 A;  4JZ2 A;  3KDR A;  1ZSP A;  4F6E A;  1KKC A;  1MNG A;  3C3T A;  3KKY A;  1MMM A;  2RCV A;  1BSM A;  3QVN A;  3C3S A;  1N0N A;  1GN4 A;  1BS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...