4F6EA

Crystal structure of the k182r, a183p mutant manganese superoxide dismutase from sacchromyces cerevisiae
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
192
Chain Sequence
VTLPDLWDFGALEPYISGQINELHYTHHQTYVNGFNTAVDQFQELSDLLAEPSPANARMIAIQQNIFHGGGFTNHCLFWENLAPESQGGGEPPTGALAAIDEQFGSLDELILTNTLAGVQGSGWAFIVNLSNGGLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNRPDYFAIWNVVNWEASRRFDAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Crystal Structure of the K182R, A183P mutant manganese superoxide dismutase from Sacchromyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 65
structure length 192
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4f6eA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4f6eA02
2GDSA 1AP5A 1N0JA 1BS3A 1D5NA 5AG2A 1AR4A 3AK2A 1EN4A 1AR5A 4C7UA 5A9GA 4YIOA 1EN5A 1LUWA 3AK3A 3QVNA 4E4EA 1MMMA 4JZ2A 1XILA 1AVMA 1EM1A 1LUVA 1ZUQA 3EVKA 1VARA 2AW9A 1ZTEA 1GN3A 3C3TA 4BR6A 3CEIA 1XUQA 1IX9A 1WB7A 3MDSA 1PL4A 3TJTA 1WB8A 3LSUA 1GN6A 3AK1A 3DC5A 1MSDA 1IDSA 2QKCA 1IXBA 1I08A 4JYYA 2RCVA 4F6EA 2CE4A 2CDYA 1GN2A 3BFRA 1XREA 3K9SA 3OT7A 1MNGA 1MA1A 1ZSPA 2P4KA 1PM9A 1KKCA 1ZLZA 1QNMA 1EN6A 1P7GA 1SZXA 3C3SA 4X9QA 2ADPA 1JA8A 1XDCA 4JZGA 1B06A 3IC9A 1I0HA 1BT8A 2ADQB 1GN4A 4GUNA 2QKAA 3KKYA 1VEWA 3DC6A 3RN4A 1JR9A 1BSMA 1Y67A 4FFKA 4YIPA 1AP6A 1N0NA
chains in the Genus database with same CATH superfamily
3ETEA 2G38A 2K9PA 3QO5A 5JH7A 3ABTA 2Q6AA 2ZKOA 3RFRA 3ZS8C 4HBNA 2VQEB 1WA8B 4DR3O 1QQCA 1R3KC 1AROP 1NR7A 4J7ZA 2XAHA 3K03A 4X1KB 5ITZB 3D36A 1IBKB 5IWAB 4IYHA 3HKBA 3JD4A 2GBOA 1VQ5V 3UO2A 4FM1A 1X59A 1OCZC 4DV1O 4B3SO 2ZD9A 4JI8B 2EULA 4GT1A 4IYIA 2UXBO 2YUAA 1GN6A 1FXKA 4DW1A 3JD1A 2CTRA 3GWOA 4PI0A 3IFXA 3RYIB 4H13B 1VMGA 3WG7C 4JI3O 3DTUB 4PHZA 2A0LA 2QM7A 1EFRG 2C2AA 1KKCA 4H33A 5L3GA 4F4LA 4LFCO 1QNMA 3CHXA 4XDLA 2BOBC 1P7GA 4X1YA 1K4CC 5CBGA 2ZXWB 2XHBA 4I9QA 2BSKA 4ASUG 4WBNB 3RW0A 1EBOA 1Y76B 4LFBO 2AXTZ 2HG5C 4FFBA 3K57A 2FTKA 2DWDC 3K06A 4X20B 3ABUA 2CGNA 5BR8O 4MVSA 2LW1A 2N04A 1AP5A 2ITCC 2GDSA 5D5PA 1DF5A 4CH3A 1JVMA 2JEUA 3AK2A 3LSSA 4B7KA 3LDDA 4C7UA 3CCQV 4P30A 2UUAO 2Y0PA 2UU9O 3QVNA 4J80A 2RJZA 4LF5O 2P6JA 4W4LA 1VF7A 5CMUA 2R9RB 4DV0B 1VP7A 4LNUB 3ETQA 1YSCA 1VIBA 2A79B 3ETDA 3ASOC 3RWRD 1XMOB 5IJ0B 1YEWA 4ZIBA 2PF4E 4DV5O 4BR6A 1IXMA 4YJ3B 4JAUA 2JS3A 3JCZA 1QR8A 3H9VA 4GKKB 2ZM6O 1N33B 1WB8A 4NXMO 1GTOA 4MW3A 1GMGA 3T1HO 3BCCH 2ITDC 4O4LA 1IDSA 1M1KW 2QKCA 5LP6A 4JI0B 4AI8A 2CDYA 2EIJB 1JFFB 1T5EA 2JJ1G 1SA0B 4DO2A 5EK0A 2XASA 2FB5A 4BIUA 4UB8Z 3CP1A 4X9QA 1R6NA 3ZBHA 4JTAB 2V1DA 1WLEA 4DV4B 3K0GA 1NJIW 3F5WC 2B1GA 3J81N 3CRMA 1XNQO 2Y48A 1GM9A 3C90A 3CX5F 4LF8O 4LF6B 5CN0A 5EBMC 1ZWIC 2GUZB 4TV9A 2ARHA 4OX9O 2HHHO 1YVWA 1OCOB 2LFSA 5KA6A 2QKSA 1OCCC 4FLZA 2Q7EA 5KUKA 5LL6Y 3FD9A 3JALB 2ZE8A 3OTOO 2WA3A 1ZUQA 4WF9V 4XDKA 5C93A 4LFAO 3S3XA 4QGPA 2HLDG 1V55B 1J5EB 2QWNB 3B77A 3MHHC 2UXXA 5C8YB 3FX7A 2GV9A 4W4KA 4B3RO 4WFHA 2JS5A 4JI6B 3R66A 5LGTA 3L74H 2X7RB 4QE7A 2K1EA 1Y4MA 4LP8A 3IJ4A 5KX5B 1M57C 2WLIB 3OR7C 3CB2A 3B8MA 2UXCB 4F6RA 3H01A 4X88A 2WLLA 5HFLA 4X64B 4D7SA 5B5EZ 1XREA 4JYCA 1NT2B 3JAWB 2P4KA 3ZMVA 1PM9A 1GH6A 2A7WA 1E79G 4X62B 3RYFB 5EYPA 3AEIA 4RQEA 3RYHB 5JJNB 5IT9N 4JV5O 2HVKC 3U0ZA 4LF4O 3D3QA 5LGUA 1VQ9V 1FFTB 3UO3A 2IH3C 3B2EE 4K35A 4U3FH 1S3JA 2VQFO 2E3CA 3CCEV 4EB6B 3OGCC 1Y74A 5IYDO 5H2FZ 4I50B 3N2GB 4DR2O 4CS4A 1JJ2U 4UVBA 5KUMA 3SYPA 3SYQA 5F2VO 3K79A 3ZMUA 4B3SB 3IAYA 1GAXA 4DR4O 5LA6B 1QR9A 2DOSA 2UXBB 4KHPO 5A2QN 3ZEDA 4H44B 4D6TH 3P3PA 1ZL8A 1YI2V 3T1CA 5CB4A 1LUVA 3JD0A 3UT5A 1I94B 2UUBO 5L3DA 2P4VA 1WPXA 4GYCB 1S5HC 4HAMA 3K5OA 4LCUC 2PUSA 1DK1A 2QWOB 4O2AA 1SQPH 3DXRB 3CEIA 1XI1A 2JK5C 2WSSG 2YI8A 1DF4A 2UXDB 2L35A 3FB8C 4QPKA 1QLEC 4TOIA 2AGAA 2W6JG 3HPLC 2JGDB 4LFCB 2HR3A 3M7MX 1YDXA 3H1JH 4YHHB 2YXHA 3JSNA 4YJ2B 3E8HA 5LYJA 1XBLA 3TCUA 2CH7A 2IW5A 2XOKG 4JI1B 2EJ7A 5J2TB 2PYJA 1GN2A 4RUEA 5B1BB 5EIBC 2EINB 1YZBA 4JI4B 1PP9H 4DV3O 1AJQA 4ZHQB 2JDIG 2B9ZA 2QSAA 5BR8B 1EN6A 3G67A 3M99B 4CZZA 1K73W 2Y69C 3ABLB 1H2KA 4LWSA 3K3WA 4DK0A 2UUAB 4AHCA 2DQ0A 2HJFC 4JI5B 2F4VO 2B5UA 3B4SA 5BMVA 1BT8A 1K3EA 4YXWG 1XNRO 1L1FA 2WLMA 2ADQB 1FJGB 2BOCC 4LF5B 2R70A 1KYOF 3DC6A 4UXNA 4WCEV 1IVSA 3F5TA 2DWEC 4JAVA 4R6ZA 1RSOB 1KB9F 2F23A 1FAFA 4DV5B 4JI2O 3G4SV 1W0KG 1NKDA 2OIEA 1H2LA 3E8GA 4OGQB 3W7TA 3FFQA 3N27A 5JWPA 5LMUO 1TUBA 3SGIA 3TETA 1S76D 1W59A 1VARA 3ICXA 4JF3A 3X2QB 1BCCH 4EFBA 5LBQA 4DUZB 1K34A 2AHYA 4TV8A 2DYRC 2E74B 2CUGA 5FLXN 2QWRB 3LDCA 1AJNA 1WB7A 3ZX6A 3RVYA 1DLBA 3H1IH 3TJTA 3L9DA 4EKWA 2ZXWC 3JD2A 4K0KO 1US6A 2Q73A 4GX1A 1SRYA 1XMQO 1MSDA 1B6QA 3K5LA 3AG4B 1IBLO 3N2KB 3R65A 2R9AA 2M7WA 1E1RG 2ZR3A 2RN9A 1HWYA 3BFRA 1K4DC 3RBZA 4RO2A 1KQSU 4DR1O 3UM7A 5JH7B 5CBFA 5CBHA 1P4RA 3F7YC 1P49A 4UFZA 2E5LB 1MSWD 1F7YA 3E83A 4Z1MG 2HHHB 2N05A 3ZMSA 1WAZA 1WNSA 4HZ3A 4RQFA 4R8CA 1HNZB 2CTWA 4G28B 4CC5A 1WP8A 3HKBB 1G1XB 4MW8A 3EXAA 4TQFA 2Z0AA 2X6BA 2PGGA 4X65O 2PI5A 3G80A 1EN4A 2XAFA 5A9GA 3RVZA 1LUWA 3AK3A 5DM6V 3L73H 4BW9A 3KZIZ 3JAKB 3ZN1A 3CSXA 4HNAB 2ODMA 4UCVA 4DYLA 5JJEB 5LHIA 1SESA 5IYZA 2PYLA 5L3BA 2QM4A 2EIJC 4Q20A 1Q5OA 2YIDA 4YY3O 1IBMO 2ZIOA 3C3TA 3U11A 3CRQA 1IX9A 1ENVA 1S5LZ 1H2MA 3PN1A 2BSKB 4PV1B 2CAZC 5J9PC 3OE7G 2PZSA 1HP8A 1NR1A 5EC2C 3CPWU 2H94A 4JI7B 3WFVA 1E1QG 2RCVA 4FFBB 3S3WA 1M5IA 2QGNA 4JV5B 4BWAA 3CRCA 4LF4B 2O57A 2ZCEA 1K92A 3RYCA 1K5QA 4MTFA 1M90W 3CRAA 3H1LH 3HB3B 3HKDA 3OUSA 5EZYA 4R50A 3RT3C 5KMGA 1JA8A 4GKJO 2DJVA 5CA0A 5IE9A 4QNHB 5GTIZ 1OCOC 4DR2B 4B7EA 1YJWV 4OXSA 4MTOA 2ZNIA 4J11A 4UCRA 4B3MO 4KHPB 5KAIZ 1F51A 2HKOA 4X66O 2KB1A 1GK9A 1V55C 1VEWA 4PA9A 1Y67A 2UUBB 5FNVA 3A2FA 3QO7A 3THOA 1VQMV 5AG2A 1XOUA 3UCSC 1NVPD 1JQ0A 3F7VC 3ZCCA 1XILA 3T1YO 2IJIA 4NXNO 3BVOA 3ZHUA 3ZHQA 3SPJA 1BHAA 3H1KH 1BE3H 4JYAO 3A0RA 3EVKA 4PDLA 2OT5A 1A32A 2AW9A 3SR2C 5IJ9A 4JPRA 4DV7B 4A5UB 5KHHA 1HDJA 1XUQA 1WN7A 2QE7G 3MDSA 4I55A 4DV3B 4IGGA 3AG1B 2FYUH 1MZFA 2FMLA 4IHJA 2QDOA 4UUJC 3D3IA 3B09A 3G6EV 1OCRB 4J41A 3CCJV 1AJPA 4FLYA 1Q3EA 3STLC 3P32A 4DR6O 2GHYA 1XNRB 4FZ0A 1AI5A 5FPOA 2QR4A 2Q4PA 4TV9B 1FOUA 4P9OA 1S5JA 1HR0O 4LBEC 4LF7O 1R1BA 1SETA 2EZPA 3FYIB 1Q81W 1XL6A 4KXRA 1RM1C 3ETGA 2EZOA 1K7DA 1YTFD 3CWBH 4WBNA 3W7UA 2KKWA 5CA1A 2HFEC 2LGQA 2X6CA 1N32O 3JYCA 4G2KA 5CA3A 2EIKB 4PA4A 1P84F 1AP6A 3L75H 4NB5A 5BXZA 5IY5B 4WFEA 1HNWB 1PD3A 2E75B 2ZT9B 2UUCO 2D3OW 1FXHA 4I0XA 1EZVH 4JAAA 2EILC 4DV6O 2QTOA 3OAAG 1W0JG 3VQXA 3ABKB 4DV2B 2QTSA 4YIOA 1CPYA 3TXSA 3E86A 5BZBA 3EHBB 4FLWA 1V54C 2D2CB 1VQLV 5LXTA 4PJ0Z 4F6RB 3LUTB 2RDCA 1XMQB 2EIMC 4TUYA 2AHZA 4CS2A 1I7FA 1UPGA 1VQ8V 4MVUA 4WFGA 4LNUA 2P22C 1QVFU 3ZRVA 3FAVA 2JRIA 1H2GA 1YXBA 4LF9B 3TXQA 5GW7A 5EYPB 2DYSC 3DGEA 3ABLC 3LSUA 4GZRB 4DR1B 1VQOV 1RPOA 1R6KA 4BAYA 4DXWA 2Q68A 4J9YB 3VQWA 1IXBA 2V4DA 4J10A 5IYBO 4IIJA 1VQ4V 3B40A 4AQYO 1Z5WA 3LSQA 4KUMA 3SPCA 5JQGA 1BL8A 4OPAA 4NTWA 4PI2A 1QCEA 1ZLZA 4FM2A 1JFFA 2QWPB 5B1AC 1NQTA 4O4HA 4RWUA 2EX3A 4FLVA 3JAMN 4O4JA 1QLNA 4X65B 1F4MA 4O2BA 1YIJV 1NBMG 1FKAO 1I0HA 4DR5B 4BIOA 1ZL8B 4GX2A 5CB4B 4PDRA 3UT5B 2QJ1A 4JTCB 2QA4V 4DW0A 5LOVA 4GX0A 3Q4HA 3SPIA 4DRXB 1S0VA 2H3OA 3W7XA 2Z5UA 1XL4A 1G4YB 3X2QC 2ZDIC 1D2DA 4FFKA 1GM8A 5KHIA 4PD4F 4IL6Z 3AG2B 1JMKC 1D5NA 4IT5A 2YIAA 2NNUA 2OTLV 1AR5A 2Q0OC 3O65A 3ZMTA 3SJAC 1K97A 2VQEO 1CXZB 2GUZA 1B04A 4DR3B 1QU7A 1V9PA 4UCSA 2N74A 4MVZA 3E35A 3AG4C 3SYOA 3VQYA 5LYJB 2CH7B 2PI4A 3CC7V 4ZBMA 4MVMA 3W7WA 4P9PA 1XEQA 1H2SB 1L0LH 2GSMB 3ZMZA 2WA4A 5IWAO 2OWOA 2VRZA 5DEDA 3JATA 1KECA 2B1IA 1GN3A 2XAGA 4DR7O 4DV1B 4EFEA 4QPJA 1CEZA 3JARA 4LWSB 1PNKA 3P30A 2DQ3A 1VQPV 3AK1A 2OCCC 1PPJH 3FB7C 4UB6Z 1PL0A 1VF6C 5BMVB 4GKJB 3WB2A 2HJDA 4ZOLA 4CH6A 1M56B 4JI3B 1S72V 3JASB 1NZ6A 4MVOA 3G71V 3K9SA 1TGOA 1ZSPA 1LR1A 5JVDA 4X1IB 4X66B 2WLKA 4NTYA 5GONA 2UXNA 3ZHSA 2IU3A 3ABMB 2ADPA 1HNXO 3E22A 3OMAB 2AZ2A 1B06A 5JCOC 5GTHZ 1P7BA 1M4UA 5FL7G 4K8ZA 4KP4A 4LFBB 2R72A 4X8AA 1EZJA 1FS0G 1TUBB 2ZR2A 3LNNA 4FK5C 4L8JA 1JNBA 1KKDA 1KD1W 2HP8A 4B3TO 3QO8A 3T1YB 2RMKB 4ZI7B 4NXNB 2ZIMA 4CC6A 3L70H 2LJ2A 1H8EG 3ZN0A 1FYJA 3CS5A 3ZRWA 1GM7A 3ML0A 5J2UA 3E8FA 1N0NA 1MOFA 3QG5A 1IZ3A 1H38A 2R9IA 4MTGA 3CMAV 1QBZA 2NLJC 5TISZ 3SYAA 4H37A 3P3NA 3DSQA 2UU9B 1KMIZ 1WP7A 4I50A 1MMMA 2EBOA 5L3FA 2HEPA 5FPRA 3T4ZA 4DV0O 3A0BZ 4CH5A 1XMOO 3NR7A 5KHGA 1RFYA 3ZRXA 1WJZA 1PL4A 3HKCA 4FLXA 1GO3F 3BPZA 1N33O 3ZJZA 2ZM6B 4NXMB 5DN6G 3T1HB 4QE9A 3LNMB 4B08A 1SQBH 4PA7A 5LMNO 4JI0O 2JGDA 1QVGU 1M57B 1ZX3A 2VWKA 2E76B 1PNLA 4G27B 4PA3A 2Z3YA 4BW5A 3NXSA 4I4TA 3SPHA 2CGOA 2XAQA 1JCHA 4UVCA 5J2TA 3CMEV 4TWKA 4NKGB 1KU9A 3BHPA 1Q8IA 2UUCB 2WWWA 1M93A 2JEXA 1NI8A 2BTQA 2BTOA 5IYZB 2CK3G 3BA9A 4DV4O 1GN4A 3OMNB 2QWQB 4GUNA 3TK1A 4O4IA 4MTXA 4Z2WA 1XHXA 3CCMV 1IURA 4UVAA 1XNQB 4YIPA 1PNMA 3QF7A 3MD0A 4LF8B 4LF6O 2YEVA 3K9AA 4OX9B 1EN5A 1AB3A 1Q6IA 3WU2Z 3CCVV 4R7CA 5IYCO 1OCRC 3CXHF 1NTZH 3OTOB 1GKFA 3UQ8A 3OW2U 4FVMA 4LFAB 3CC4V 3RYCB 2Q5ZA 1VQ7V 2YXYA 3HKDB 2RNBA 5EZYB 3SPGA 4AQYB 4B3RB 1FXKB 4UCUA 5B1NA 2XUMA 2ZDIA 3K0DA 4JI6O 3K5NA 1F23A 4U3JA 3APQA 4TQDA 5KMGB 2YI9A 3CD6V 4LC1A 3QNEA 1KBHA 2XNDG 5CA0B 5JJJB 2P7TC 3HKEA 1SF9A 5H9CA 2QM8A 2IJHA 2Q9LA 2Q7HA 2UXCO 4JASA 1AILA 1DTOA 4X64O 4X1YB 1UFIA 5L3CA 3AG3B 5FNVB 2EIKC 1COWG 3IGAC 4GCZA 1FFXA 1MG1A 5IY5C 4I9WA 4X62O 1VQKV 4MS2A 1AR1B 1Q43A 3CE2A 3CCSV 3ABKC 2Y69B 4J42A 1JJOA 3K04A 2OCHA 3OEHG 4GX5A 2WLJA 1TVKA 3B8NA 1Y66A 4GLXA 3L72H 4JGSA 1YCIA 4AILC 1SZTA 1VF6A 1OZ0A 2RQ6A 3ZHTA 3APOA 2P67A 2AZ0A 2QKAA 1XHZA 5IJ9B 2VQFB 3CCLV 2P06A 1UJWB 2A3QA 3E89A 1BS3A 2DN9A 4I55B 3FYEB 1SQXH 1AR4A 4DR7B 2NR5A 4IHJB 3KCXA 4DR4B 1G6UA 1I5XA 4E4EA 1LNQA 4JZ2A 5JCOA 4QIWF 2Q67A 1I94O 3M8AA 3JAKA 4MSWC 1FPOA 1BQ0A 1BMFG 3CJHA 4HNAA 1OV9A 1Q6HA 2KG7A 1SQQH 3IC7A 3LDEA 1SC5B 2DYRB 2UXDO 2JVDA 3T2MA 4O4LB 4FZ1A 5H5NA 1VQNV 3JSLA 5KHKA 1KUQA 1NTKH 5LP6B 5KAFZ 2A06H 3G6BA 2W6IG 2YIBA 2CTQA 1AI7A 1YITV 1N34O 1WA8A 1HNXB 1I08A 4YHHO 5CA1B 4JI1O 2CE4A 1MABG 1Z5VA 4X1KA 5ITZA 3WB0A 3OT7A 4JI4O 5B3SB 3ASNB 3UKMA 2XTAA 4B3TB 2H8PC 1R3JC 4FPPA 4BIZA 4I0XB 3J80N 2YDEA 3AG2C 3OEEG 3A0HZ 1BGYH 1H8HG 4KL1A 3K08A 5LXTB 1IJGA 5E79Z 4JI5O 3CC2V 2DW4A 2F4VB 1WPBA 3D8CA 4TUYB 3RYIA 1FJGO 5K1XA 4FM0A 2Q8VA 2IJJA 1NH2D 1CP9A 3RGBA 4X89A 1NTMH 3FAVB 3L71H 3BEHA 1SERA 1Z2GA 1F4NA 2QEXV 2Y4UA 3OR6C 4L87A 4JI2B 5H6QA 1THZA 1SKVA 2YSUB 3BRCA 4P2ZA 1YJ9V 2BCCH 4IIJB 1Y76A 2ZQMA 2DE0X 5LMUB 1YHQV 1EM1A 1M56C 2IU0A 4D7TA 5LMNB 4QJFB 5DECA 4WFFA 4X20A 4DUZO 5JQGB 4U7OA 1ORQC 1NU1H 3STZC 5KLVH 2ZE7A 4O4HB 4CBCA 4MT8A 4O4JB 1H2NA 3K58A 3FKSG 3ABMC 1K33A 4K0KB 4O2BB 1N4CA 1I5YA 2F43G 2Y0IA 2WLLB 3H1HH 1IBLB 1K5SA 1MZEA 2LQTA 4F6EA 5LOVB 1O9GA 3I5DA 3Q4HB 5B1BC 2WAMA 2EINC 3CCRV 4NVPA 5EC1C 2NN4A 1TAEA 5IJ0A 1OCZB 3OD4A 4RUFA 1SQVH 4H0LB 1Q6UA 4YJ3A 2XT9A 1VF5B 1ROPA 2EJRA 3TGUH 2XAJA 1Q86W 2P5OA 3GWKC 1RP3B 5KHJA 1N36O 2E5LO 3GB7C 2L6LA 4CH4A 3WG7B 4DUYO 1HNZO 3JATB 1Y74B 4MVRA 3RN4A 1BSMA 1SA0A 3VQVA 4LR3A 3JARB 3FB6C 1N0JA 3CYOA 2ILMA 3KDRA 1XQ8A 2WLNA 3OTFA 5EIBD 3SJCC 2F1MA 1N8RW 2ZE6A 4ZOLB 3BA8A 4N21A 2ETNA 5EBWC 4J7JA 4WFAV 1JPXA 3OMIB 2IJKA 2LO1A 4O2AB 1KP2A 2YIBD 3U10A 2JGUA 5JVDB 2LP7A 3PJSK 4YY3B 1ZTEA 5HFMA 2W0XA 1IBMB 3VOUA 5GONB 3E22B 1PV0A 1K8AW 1PKXA 1BHBA 1RPRA 2HVJC 4UCTA 4MVQA 3KCYA 1IBKO 5L3EA 4JI7O 4NR1A 2V7QG 3T4DA 4Z1VA 3JALA 2GTSA 2Q7GA 3ASOB 1NS1A 1KP3A 1MA1A 1O9HA 3ZRWB 4FMTA 5J2UB 4JI8O 3ZHVA 2JIZG 3OFNG 1K9MW 4TT3G 5C8YA 1BZKA 3I56V 3JCUZ 2FL4A 4JZGA 2ZE5A 4HYOA 3AG7A 3HR0A 1L8DA 2Y4TA 3D36C 2WPDG 1RM1B 5KX5A 1S77D 2WLIA 4UV9A 1DGSA 1FXVA 4B3MB 4PDVA 2OTJV 4TSFG 5EBLC 2IBZH 3KKYA 3JAWA 1SS3A 4FLTA 4DRXA 3CXCU 4U7NA 1FXKC 2F93B 3HKCB 1JOYA 3K5MA 1Q90D 2MK3A 2ZNJA 3RYFA 2EILB 3RYHA 2DMXA 2X6AA 5LHGA 4DK1A 1AVMA 1NVPB 1V54B 2PTMA 5K1PA 1N34B 2YS8A 4TV8B 4JYAB 1ZAUA 4I4TB 2EIMB 1SQFA 2Q0AA 5IDJA 1U96A 1AI6A 4E2LA 4EB6A 3AG3C 4DV7O 3BABA 1B3QA 4UV8A 2A9HA 2M6YA 2WLHA 3ZRSA 3N2GA 2MW2B 1OHHG 2VWJA 1FD9A 1OCCB 2DYSB 3DC5A 2PY5A 4EEQA 4PDMA 2OIGA 2P90A 2Q69A 4Q6GA 5LA6A 4JYYA 2BTQB 1TUEB 4XBFA 4LH7A 2IH1C 4O4IB 4NTXA 4DR6B 1URFA 5LHHA 3W7SA 4J7KA 1Q82W 1MNGA 3CCUV 1U97A 3FB5C 3JASA 4ABMA 2YEVB 4GKKO 3DXRA 3SJBC 4JTDB 4KFMA 4XDJA 3ZHRA 1SZXA 3C3SA 4X1IA 1KC8W 1HR0B 3SDLA 2F66C 4LF7B 2CTPA 2IM9A 5B1AB 3JD3A 1NH2B 5B1OA 4FJCC 1H5WA 3OM3B 4ZKIA 3IC9A 2VS0A 3VBBA 4ICGA 4YJ2A 3OUFA 4NYKA 1YTFB 1N32B 1X4TA 1JR9A 1Q7YW 2KQXA 4ZHQA 4ZI7A 4U3JB 1HNWO 1JX9A 4DV6B 3HKEB 5H6RA 3ZIAG 4DV2O 5LP6C 2LW7A 2ZINA 4RAIA 1L0NH 3MAQA 2BE3A 3BAAA 2FKXA 4WFBV 4J9ZB 3KG2A 3I55V 1SQGA 1VQ6V 5E1AC 2ATKC 4JYBA 5B3SC 4K8XA 3ASNC 1FFXB 1QHTA 4PELA 3E2EA 4UCOA 1BQZA 1G8MA 3K59A 4LF9O 3SYCA 3AG1C 4N23A 5BY1A 1RSOA 3OGIB 3A8TA 1TVKB 2OCCB 4OPHA 2YICA 4I5SA 1R6TA 1N36B 1J5EO 4K3AA 3J7AU 1OJHA 3WB1A 1M9NA 4DUYB 4PA6A 4CS3A 3EFFK 2LGWA 2X0LA 1R3LC 4FIPC 1AI4A 1QLEB 1R3IC 1R73A 2LFRA 4LH6A 5KA5A 1XDCA 4FLUA 5B66Z 3CRRA 1YJNV 3O9OA 1Y6XA 2GTAA 5LGNA 4DR5O 2F95B 3E8BA 2OYQA 1TA8A 3GVMA 3SJQC 5D5QA 3N2KA 1W2BU 3QTCA 2YC0A 1GRJA 1YF2A 3CJHB 2KSDA 2YXLA 1J95A 2JJ2G 3BY6A 4I7ZB 2KG7B 1HW7A 2W0FC 3MHSC 1D5AA
chains in the Genus database with same CATH topology
2GDSA 1AP5A 1N0JA 1BS3A 1D5NA 5AG2A 3KDRA 1AR4A 3AK2A 1EN4A 1AR5A 4C7UA 5A9GA 4YIOA 1EN5A 1LUWA 3AK3A 3QVNA 4E4EA 1MMMA 4JZ2A 1XILA 1AVMA 1EM1A 1LUVA 1ZUQA 3EVKA 1VARA 2AW9A 1ZTEA 1GN3A 3C3TA 4BR6A 3CEIA 1XUQA 1IX9A 1WB7A 3MDSA 1PL4A 3TJTA 1WB8A 3LSUA 1GN6A 3AK1A 3DC5A 1MSDA 1IDSA 2QKCA 1IXBA 1I08A 4JYYA 2RCVA 4F6EA 2CE4A 2CDYA 1GN2A 3BFRA 1XREA 3K9SA 3OT7A 1MNGA 1MA1A 1ZSPA 2P4KA 1PM9A 1KKCA 1ZLZA 1QNMA 1EN6A 1P7GA 1SZXA 3C3SA 4X9QA 2ADPA 1JA8A 1XDCA 4JZGA 1B06A 3IC9A 1I0HA 1BT8A 2ADQB 1GN4A 4GUNA 2QKAA 3KKYA 1VEWA 3DC6A 3RN4A 1JR9A 1BSMA 1Y67A 4FFKA 4YIPA 1AP6A 1N0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDS A;  1AP5 A;  1N0J A;  1BS3 A;  1D5N A;  5AG2 A;  1AR4 A;  3AK2 A;  1EN4 A;  1AR5 A;  4C7U A;  5A9G A;  4YIO A;  1EN5 A;  1LUW A;  3AK3 A;  3QVN A;  4E4E A;  1MMM A;  4JZ2 A;  1XIL A;  1AVM A;  1EM1 A;  1LUV A;  1ZUQ A;  3EVK A;  1VAR A;  2AW9 A;  1ZTE A;  1GN3 A;  3C3T A;  4BR6 A;  3CEI A;  1XUQ A;  1IX9 A;  1WB7 A;  3MDS A;  1PL4 A;  3TJT A;  1WB8 A;  3LSU A;  1GN6 A;  3AK1 A;  3DC5 A;  1MSD A;  1IDS A;  2QKC A;  1IXB A;  1I08 A;  4JYY A;  2RCV A;  4F6E A;  2CE4 A;  2CDY A;  1GN2 A;  3BFR A;  1XRE A;  3K9S A;  3OT7 A;  1MNG A;  1MA1 A;  1ZSP A;  2P4K A;  1PM9 A;  1KKC A;  1ZLZ A;  1QNM A;  1EN6 A;  1P7G A;  1SZX A;  3C3S A;  4X9Q A;  2ADP A;  1JA8 A;  1XDC A;  4JZG A;  1B06 A;  3IC9 A;  1I0H A;  1BT8 A;  2ADQ B;  1GN4 A;  4GUN A;  2QKA A;  3KKY A;  1VEW A;  3DC6 A;  3RN4 A;  1JR9 A;  1BSM A;  1Y67 A;  4FFK A;  4YIP A;  1AP6 A;  1N0N A; 
#chains in the Genus database with same CATH topology
 3ETE A;  2G38 A;  2K9P A;  3QO5 A;  5JH7 A;  3ABT A;  2Q6A A;  2ZKO A;  3RFR A;  3ZS8 C;  4HBN A;  2VQE B;  1WA8 B;  4DR3 O;  1QQC A;  1R3K C;  1ARO P;  1NR7 A;  4J7Z A;  2XAH A;  3K03 A;  4X1K B;  5ITZ B;  3D36 A;  1IBK B;  5IWA B;  4IYH A;  3HKB A;  3JD4 A;  2GBO A;  1VQ5 V;  3UO2 A;  4FM1 A;  1X59 A;  1OCZ C;  4DV1 O;  4B3S O;  2ZD9 A;  4JI8 B;  2EUL A;  4GT1 A;  4IYI A;  2UXB O;  2YUA A;  1GN6 A;  1FXK A;  4DW1 A;  3JD1 A;  2CTR A;  3GWO A;  4PI0 A;  3IFX A;  3RYI B;  4H13 B;  1VMG A;  3WG7 C;  4JI3 O;  3DTU B;  4PHZ A;  2A0L A;  2QM7 A;  1EFR G;  2C2A A;  1KKC A;  4H33 A;  5L3G A;  4F4L A;  4LFC O;  1QNM A;  3CHX A;  4XDL A;  2BOB C;  1P7G A;  4X1Y A;  1K4C C;  5CBG A;  2ZXW B;  2XHB A;  4I9Q A;  2BSK A;  4ASU G;  4WBN B;  3RW0 A;  1EBO A;  1Y76 B;  4LFB O;  2AXT Z;  2HG5 C;  4FFB A;  3K57 A;  2FTK A;  2DWD C;  3K06 A;  4X20 B;  3ABU A;  2CGN A;  5BR8 O;  4MVS A;  2LW1 A;  2N04 A;  1AP5 A;  2ITC C;  2GDS A;  5D5P A;  1DF5 A;  4CH3 A;  1JVM A;  2JEU A;  3AK2 A;  3LSS A;  4B7K A;  3LDD A;  4C7U A;  3CCQ V;  4P30 A;  2UUA O;  2Y0P A;  2UU9 O;  3QVN A;  4J80 A;  2RJZ A;  4LF5 O;  2P6J A;  4W4L A;  1VF7 A;  5CMU A;  2R9R B;  4DV0 B;  1VP7 A;  4LNU B;  3ETQ A;  1YSC A;  1VIB A;  2A79 B;  3ETD A;  3ASO C;  3RWR D;  1XMO B;  5IJ0 B;  1YEW A;  4ZIB A;  2PF4 E;  4DV5 O;  4BR6 A;  1IXM A;  4YJ3 B;  4JAU A;  2JS3 A;  3JCZ A;  1QR8 A;  3H9V A;  4GKK B;  2ZM6 O;  1N33 B;  1WB8 A;  4NXM O;  1GTO A;  4MW3 A;  1GMG A;  3T1H O;  3BCC H;  2ITD C;  4O4L A;  1IDS A;  1M1K W;  2QKC A;  5LP6 A;  4JI0 B;  4AI8 A;  2CDY A;  2EIJ B;  1JFF B;  1T5E A;  2JJ1 G;  1SA0 B;  4DO2 A;  5EK0 A;  2XAS A;  2FB5 A;  4BIU A;  4UB8 Z;  3CP1 A;  4X9Q A;  1R6N A;  3ZBH A;  4JTA B;  2V1D A;  1WLE A;  4DV4 B;  3K0G A;  1NJI W;  3F5W C;  2B1G A;  3J81 N;  3CRM A;  1XNQ O;  2Y48 A;  1GM9 A;  3C90 A;  3CX5 F;  4LF8 O;  4LF6 B;  5CN0 A;  5EBM C;  1ZWI C;  2GUZ B;  4TV9 A;  2ARH A;  4OX9 O;  2HHH O;  1YVW A;  1OCO B;  2LFS A;  5KA6 A;  2QKS A;  1OCC C;  4FLZ A;  2Q7E A;  5KUK A;  5LL6 Y;  3FD9 A;  3JAL B;  2ZE8 A;  3OTO O;  2WA3 A;  1ZUQ A;  4WF9 V;  4XDK A;  5C93 A;  4LFA O;  3S3X A;  4QGP A;  2HLD G;  1V55 B;  1J5E B;  2QWN B;  3B77 A;  3MHH C;  2UXX A;  5C8Y B;  3FX7 A;  2GV9 A;  4W4K A;  4B3R O;  4WFH A;  2JS5 A;  4JI6 B;  3R66 A;  5LGT A;  3L74 H;  2X7R B;  4QE7 A;  2K1E A;  1Y4M A;  4LP8 A;  3IJ4 A;  5KX5 B;  1M57 C;  2WLI B;  3OR7 C;  3CB2 A;  3B8M A;  2UXC B;  4F6R A;  3H01 A;  4X88 A;  2WLL A;  5HFL A;  4X64 B;  4D7S A;  5B5E Z;  1XRE A;  4JYC A;  1NT2 B;  3JAW B;  2P4K A;  3ZMV A;  1PM9 A;  1GH6 A;  2A7W A;  1E79 G;  4X62 B;  3RYF B;  5EYP A;  3AEI A;  4RQE A;  3RYH B;  5JJN B;  5IT9 N;  4JV5 O;  2HVK C;  3U0Z A;  4LF4 O;  3D3Q A;  5LGU A;  1VQ9 V;  1FFT B;  3UO3 A;  2IH3 C;  3B2E E;  4K35 A;  4U3F H;  1S3J A;  2VQF O;  2E3C A;  3CCE V;  4EB6 B;  3OGC C;  1Y74 A;  5IYD O;  5H2F Z;  4I50 B;  3N2G B;  4DR2 O;  4CS4 A;  1JJ2 U;  4UVB A;  5KUM A;  3SYP A;  3SYQ A;  5F2V O;  3K79 A;  3ZMU A;  4B3S B;  3IAY A;  1GAX A;  4DR4 O;  5LA6 B;  1QR9 A;  2DOS A;  2UXB B;  4KHP O;  5A2Q N;  3ZED A;  4H44 B;  4D6T H;  3P3P A;  1ZL8 A;  1YI2 V;  3T1C A;  5CB4 A;  1LUV A;  3JD0 A;  3UT5 A;  1I94 B;  2UUB O;  5L3D A;  2P4V A;  1WPX A;  4GYC B;  1S5H C;  4HAM A;  3K5O A;  4LCU C;  2PUS A;  1DK1 A;  2QWO B;  4O2A A;  1SQP H;  3DXR B;  3CEI A;  1XI1 A;  2JK5 C;  2WSS G;  2YI8 A;  1DF4 A;  2UXD B;  2L35 A;  3FB8 C;  4QPK A;  1QLE C;  4TOI A;  2AGA A;  2W6J G;  3HPL C;  2JGD B;  4LFC B;  2HR3 A;  3M7M X;  1YDX A;  3H1J H;  4YHH B;  2YXH A;  3JSN A;  4YJ2 B;  3E8H A;  5LYJ A;  1XBL A;  3TCU A;  2CH7 A;  2IW5 A;  2XOK G;  4JI1 B;  2EJ7 A;  5J2T B;  2PYJ A;  1GN2 A;  4RUE A;  5B1B B;  5EIB C;  2EIN B;  1YZB A;  4JI4 B;  1PP9 H;  4DV3 O;  1AJQ A;  4ZHQ B;  2JDI G;  2B9Z A;  2QSA A;  5BR8 B;  1EN6 A;  3G67 A;  3M99 B;  4CZZ A;  1K73 W;  2Y69 C;  3ABL B;  1H2K A;  4LWS A;  3K3W A;  4DK0 A;  2UUA B;  4AHC A;  2DQ0 A;  2HJF C;  4JI5 B;  2F4V O;  2B5U A;  3B4S A;  5BMV A;  1BT8 A;  1K3E A;  4YXW G;  1XNR O;  1L1F A;  2WLM A;  2ADQ B;  1FJG B;  2BOC C;  4LF5 B;  2R70 A;  1KYO F;  3DC6 A;  4UXN A;  4WCE V;  1IVS A;  3F5T A;  2DWE C;  4JAV A;  4R6Z A;  1RSO B;  1KB9 F;  2F23 A;  1FAF A;  4DV5 B;  4JI2 O;  3G4S V;  1W0K G;  1NKD A;  2OIE A;  1H2L A;  3E8G A;  4OGQ B;  3W7T A;  3FFQ A;  3N27 A;  5JWP A;  5LMU O;  1TUB A;  3SGI A;  3TET A;  1S76 D;  1W59 A;  1VAR A;  3ICX A;  4JF3 A;  3X2Q B;  1BCC H;  4EFB A;  5LBQ A;  4DUZ B;  1K34 A;  2AHY A;  4TV8 A;  2DYR C;  2E74 B;  2CUG A;  5FLX N;  2QWR B;  3LDC A;  1AJN A;  1WB7 A;  3ZX6 A;  3RVY A;  1DLB A;  3H1I H;  3TJT A;  3L9D A;  4EKW A;  2ZXW C;  3JD2 A;  4K0K O;  1US6 A;  2Q73 A;  4GX1 A;  1SRY A;  1XMQ O;  1MSD A;  1B6Q A;  3K5L A;  3AG4 B;  1IBL O;  3N2K B;  3R65 A;  2R9A A;  2M7W A;  1E1R G;  2ZR3 A;  2RN9 A;  1HWY A;  3BFR A;  1K4D C;  3RBZ A;  4RO2 A;  1KQS U;  4DR1 O;  3UM7 A;  5JH7 B;  5CBF A;  5CBH A;  1P4R A;  3F7Y C;  1P49 A;  4UFZ A;  2E5L B;  1MSW D;  1F7Y A;  3E83 A;  4Z1M G;  2HHH B;  2N05 A;  3ZMS A;  1WAZ A;  1WNS A;  4HZ3 A;  4RQF A;  4R8C A;  1HNZ B;  2CTW A;  4G28 B;  4CC5 A;  1WP8 A;  3HKB B;  1G1X B;  4MW8 A;  3EXA A;  4TQF A;  2Z0A A;  2X6B A;  2PGG A;  4X65 O;  2PI5 A;  3G80 A;  1EN4 A;  2XAF A;  5A9G A;  3RVZ A;  1LUW A;  3AK3 A;  5DM6 V;  3L73 H;  4BW9 A;  3KZI Z;  3JAK B;  3ZN1 A;  3CSX A;  4HNA B;  2ODM A;  4UCV A;  4DYL A;  5JJE B;  5LHI A;  1SES A;  5IYZ A;  2PYL A;  5L3B A;  2QM4 A;  2EIJ C;  4Q20 A;  1Q5O A;  2YID A;  4YY3 O;  1IBM O;  2ZIO A;  3C3T A;  3U11 A;  3CRQ A;  1IX9 A;  1ENV A;  1S5L Z;  1H2M A;  3PN1 A;  2BSK B;  4PV1 B;  2CAZ C;  5J9P C;  3OE7 G;  2PZS A;  1HP8 A;  1NR1 A;  5EC2 C;  3CPW U;  2H94 A;  4JI7 B;  3WFV A;  1E1Q G;  2RCV A;  4FFB B;  3S3W A;  1M5I A;  2QGN A;  4JV5 B;  4BWA A;  3CRC A;  4LF4 B;  2O57 A;  2ZCE A;  1K92 A;  3RYC A;  1K5Q A;  4MTF A;  1M90 W;  3CRA A;  3H1L H;  3HB3 B;  3HKD A;  3OUS A;  5EZY A;  4R50 A;  3RT3 C;  5KMG A;  1JA8 A;  4GKJ O;  2DJV A;  5CA0 A;  5IE9 A;  4QNH B;  5GTI Z;  1OCO C;  4DR2 B;  4B7E A;  1YJW V;  4OXS A;  4MTO A;  2ZNI A;  4J11 A;  4UCR A;  4B3M O;  4KHP B;  5KAI Z;  1F51 A;  2HKO A;  4X66 O;  2KB1 A;  1GK9 A;  1V55 C;  1VEW A;  4PA9 A;  1Y67 A;  2UUB B;  5FNV A;  3A2F A;  3QO7 A;  3THO A;  1VQM V;  5AG2 A;  1XOU A;  3UCS C;  1NVP D;  1JQ0 A;  3F7V C;  3ZCC A;  1XIL A;  3T1Y O;  2IJI A;  4NXN O;  3BVO A;  3ZHU A;  3ZHQ A;  3SPJ A;  1BHA A;  3H1K H;  1BE3 H;  4JYA O;  3A0R A;  3EVK A;  4PDL A;  2OT5 A;  1A32 A;  2AW9 A;  3SR2 C;  5IJ9 A;  4JPR A;  4DV7 B;  4A5U B;  5KHH A;  1HDJ A;  1XUQ A;  1WN7 A;  2QE7 G;  3MDS A;  4I55 A;  4DV3 B;  4IGG A;  3AG1 B;  2FYU H;  1MZF A;  2FML A;  4IHJ A;  2QDO A;  4UUJ C;  3D3I A;  3B09 A;  3G6E V;  1OCR B;  4J41 A;  3CCJ V;  1AJP A;  4FLY A;  1Q3E A;  3STL C;  3P32 A;  4DR6 O;  2GHY A;  1XNR B;  4FZ0 A;  1AI5 A;  5FPO A;  2QR4 A;  2Q4P A;  4TV9 B;  1FOU A;  4P9O A;  1S5J A;  1HR0 O;  4LBE C;  4LF7 O;  1R1B A;  1SET A;  2EZP A;  3FYI B;  1Q81 W;  1XL6 A;  4KXR A;  1RM1 C;  3ETG A;  2EZO A;  1K7D A;  1YTF D;  3CWB H;  4WBN A;  3W7U A;  2KKW A;  5CA1 A;  2HFE C;  2LGQ A;  2X6C A;  1N32 O;  3JYC A;  4G2K A;  5CA3 A;  2EIK B;  4PA4 A;  1P84 F;  1AP6 A;  3L75 H;  4NB5 A;  5BXZ A;  5IY5 B;  4WFE A;  1HNW B;  1PD3 A;  2E75 B;  2ZT9 B;  2UUC O;  2D3O W;  1FXH A;  4I0X A;  1EZV H;  4JAA A;  2EIL C;  4DV6 O;  2QTO A;  3OAA G;  1W0J G;  3VQX A;  3ABK B;  4DV2 B;  2QTS A;  4YIO A;  1CPY A;  3TXS A;  3E86 A;  5BZB A;  3EHB B;  4FLW A;  1V54 C;  2D2C B;  1VQL V;  5LXT A;  4PJ0 Z;  4F6R B;  3LUT B;  2RDC A;  1XMQ B;  2EIM C;  4TUY A;  2AHZ A;  4CS2 A;  1I7F A;  1UPG A;  1VQ8 V;  4MVU A;  4WFG A;  4LNU A;  2P22 C;  1QVF U;  3ZRV A;  3FAV A;  2JRI A;  1H2G A;  1YXB A;  4LF9 B;  3TXQ A;  5GW7 A;  5EYP B;  2DYS C;  3DGE A;  3ABL C;  3LSU A;  4GZR B;  4DR1 B;  1VQO V;  1RPO A;  1R6K A;  4BAY A;  4DXW A;  2Q68 A;  4J9Y B;  3VQW A;  1IXB A;  2V4D A;  4J10 A;  5IYB O;  4IIJ A;  1VQ4 V;  3B40 A;  4AQY O;  1Z5W A;  3LSQ A;  4KUM A;  3SPC A;  5JQG A;  1BL8 A;  4OPA A;  4NTW A;  4PI2 A;  1QCE A;  1ZLZ A;  4FM2 A;  1JFF A;  2QWP B;  5B1A C;  1NQT A;  4O4H A;  4RWU A;  2EX3 A;  4FLV A;  3JAM N;  4O4J A;  1QLN A;  4X65 B;  1F4M A;  4O2B A;  1YIJ V;  1NBM G;  1FKA O;  1I0H A;  4DR5 B;  4BIO A;  1ZL8 B;  4GX2 A;  5CB4 B;  4PDR A;  3UT5 B;  2QJ1 A;  4JTC B;  2QA4 V;  4DW0 A;  5LOV A;  4GX0 A;  3Q4H A;  3SPI A;  4DRX B;  1S0V A;  2H3O A;  3W7X A;  2Z5U A;  1XL4 A;  1G4Y B;  3X2Q C;  2ZDI C;  1D2D A;  4FFK A;  1GM8 A;  5KHI A;  4PD4 F;  4IL6 Z;  3AG2 B;  1JMK C;  1D5N A;  4IT5 A;  2YIA A;  2NNU A;  2OTL V;  1AR5 A;  2Q0O C;  3O65 A;  3ZMT A;  3SJA C;  1K97 A;  2VQE O;  1CXZ B;  2GUZ A;  1B04 A;  4DR3 B;  1QU7 A;  1V9P A;  4UCS A;  2N74 A;  4MVZ A;  3E35 A;  3AG4 C;  3SYO A;  3VQY A;  5LYJ B;  2CH7 B;  2PI4 A;  3CC7 V;  4ZBM A;  4MVM A;  3W7W A;  4P9P A;  1XEQ A;  1H2S B;  1L0L H;  2GSM B;  3ZMZ A;  2WA4 A;  5IWA O;  2OWO A;  2VRZ A;  5DED A;  3JAT A;  1KEC A;  2B1I A;  1GN3 A;  2XAG A;  4DR7 O;  4DV1 B;  4EFE A;  4QPJ A;  1CEZ A;  3JAR A;  4LWS B;  1PNK A;  3P30 A;  2DQ3 A;  1VQP V;  3AK1 A;  2OCC C;  1PPJ H;  3FB7 C;  4UB6 Z;  1PL0 A;  1VF6 C;  5BMV B;  4GKJ B;  3WB2 A;  2HJD A;  4ZOL A;  4CH6 A;  1M56 B;  4JI3 B;  1S72 V;  3JAS B;  1NZ6 A;  4MVO A;  3G71 V;  3K9S A;  1TGO A;  1ZSP A;  1LR1 A;  5JVD A;  4X1I B;  4X66 B;  2WLK A;  4NTY A;  5GON A;  2UXN A;  3ZHS A;  2IU3 A;  3ABM B;  2ADP A;  1HNX O;  3E22 A;  3OMA B;  2AZ2 A;  1B06 A;  5JCO C;  5GTH Z;  1P7B A;  1M4U A;  5FL7 G;  4K8Z A;  4KP4 A;  4LFB B;  2R72 A;  4X8A A;  1EZJ A;  1FS0 G;  1TUB B;  2ZR2 A;  3LNN A;  4FK5 C;  4L8J A;  1JNB A;  1KKD A;  1KD1 W;  2HP8 A;  4B3T O;  3QO8 A;  3T1Y B;  2RMK B;  4ZI7 B;  4NXN B;  2ZIM A;  4CC6 A;  3L70 H;  2LJ2 A;  1H8E G;  3ZN0 A;  1FYJ A;  3CS5 A;  3ZRW A;  1GM7 A;  3ML0 A;  5J2U A;  3E8F A;  1N0N A;  1MOF A;  3QG5 A;  1IZ3 A;  1H38 A;  2R9I A;  4MTG A;  3CMA V;  1QBZ A;  2NLJ C;  5TIS Z;  3SYA A;  4H37 A;  3P3N A;  3DSQ A;  2UU9 B;  1KMI Z;  1WP7 A;  4I50 A;  1MMM A;  2EBO A;  5L3F A;  2HEP A;  5FPR A;  3T4Z A;  4DV0 O;  3A0B Z;  4CH5 A;  1XMO O;  3NR7 A;  5KHG A;  1RFY A;  3ZRX A;  1WJZ A;  1PL4 A;  3HKC A;  4FLX A;  1GO3 F;  3BPZ A;  1N33 O;  3ZJZ A;  2ZM6 B;  4NXM B;  5DN6 G;  3T1H B;  4QE9 A;  3LNM B;  4B08 A;  1SQB H;  4PA7 A;  5LMN O;  4JI0 O;  2JGD A;  1QVG U;  1M57 B;  1ZX3 A;  2VWK A;  2E76 B;  1PNL A;  4G27 B;  4PA3 A;  2Z3Y A;  4BW5 A;  3NXS A;  4I4T A;  3SPH A;  2CGO A;  2XAQ A;  1JCH A;  4UVC A;  5J2T A;  3CME V;  4TWK A;  4NKG B;  1KU9 A;  3BHP A;  1Q8I A;  2UUC B;  2WWW A;  1M93 A;  2JEX A;  1NI8 A;  2BTQ A;  2BTO A;  5IYZ B;  2CK3 G;  3BA9 A;  4DV4 O;  1GN4 A;  3OMN B;  2QWQ B;  4GUN A;  3TK1 A;  4O4I A;  4MTX A;  4Z2W A;  1XHX A;  3CCM V;  1IUR A;  4UVA A;  1XNQ B;  4YIP A;  1PNM A;  3QF7 A;  3MD0 A;  4LF8 B;  4LF6 O;  2YEV A;  3K9A A;  4OX9 B;  1EN5 A;  1AB3 A;  1Q6I A;  3WU2 Z;  3CCV V;  4R7C A;  5IYC O;  1OCR C;  3CXH F;  1NTZ H;  3OTO B;  1GKF A;  3UQ8 A;  3OW2 U;  4FVM A;  4LFA B;  3CC4 V;  3RYC B;  2Q5Z A;  1VQ7 V;  2YXY A;  3HKD B;  2RNB A;  5EZY B;  3SPG A;  4AQY B;  4B3R B;  1FXK B;  4UCU A;  5B1N A;  2XUM A;  2ZDI A;  3K0D A;  4JI6 O;  3K5N A;  1F23 A;  4U3J A;  3APQ A;  4TQD A;  5KMG B;  2YI9 A;  3CD6 V;  4LC1 A;  3QNE A;  1KBH A;  2XND G;  5CA0 B;  5JJJ B;  2P7T C;  3HKE A;  1SF9 A;  5H9C A;  2QM8 A;  2IJH A;  2Q9L A;  2Q7H A;  2UXC O;  4JAS A;  1AIL A;  1DTO A;  4X64 O;  4X1Y B;  1UFI A;  5L3C A;  3AG3 B;  5FNV B;  2EIK C;  1COW G;  3IGA C;  4GCZ A;  1FFX A;  1MG1 A;  5IY5 C;  4I9W A;  4X62 O;  1VQK V;  4MS2 A;  1AR1 B;  1Q43 A;  3CE2 A;  3CCS V;  3ABK C;  2Y69 B;  4J42 A;  1JJO A;  3K04 A;  2OCH A;  3OEH G;  4GX5 A;  2WLJ A;  1TVK A;  3B8N A;  1Y66 A;  4GLX A;  3L72 H;  4JGS A;  1YCI A;  4AIL C;  1SZT A;  1VF6 A;  1OZ0 A;  2RQ6 A;  3ZHT A;  3APO A;  2P67 A;  2AZ0 A;  2QKA A;  1XHZ A;  5IJ9 B;  2VQF B;  3CCL V;  2P06 A;  1UJW B;  2A3Q A;  3E89 A;  1BS3 A;  2DN9 A;  4I55 B;  3FYE B;  1SQX H;  1AR4 A;  4DR7 B;  2NR5 A;  4IHJ B;  3KCX A;  4DR4 B;  1G6U A;  1I5X A;  4E4E A;  1LNQ A;  4JZ2 A;  5JCO A;  4QIW F;  2Q67 A;  1I94 O;  3M8A A;  3JAK A;  4MSW C;  1FPO A;  1BQ0 A;  1BMF G;  3CJH A;  4HNA A;  1OV9 A;  1Q6H A;  2KG7 A;  1SQQ H;  3IC7 A;  3LDE A;  1SC5 B;  2DYR B;  2UXD O;  2JVD A;  3T2M A;  4O4L B;  4FZ1 A;  5H5N A;  1VQN V;  3JSL A;  5KHK A;  1KUQ A;  1NTK H;  5LP6 B;  5KAF Z;  2A06 H;  3G6B A;  2W6I G;  2YIB A;  2CTQ A;  1AI7 A;  1YIT V;  1N34 O;  1WA8 A;  1HNX B;  1I08 A;  4YHH O;  5CA1 B;  4JI1 O;  2CE4 A;  1MAB G;  1Z5V A;  4X1K A;  5ITZ A;  3WB0 A;  3OT7 A;  4JI4 O;  5B3S B;  3ASN B;  3UKM A;  2XTA A;  4B3T B;  2H8P C;  1R3J C;  4FPP A;  4BIZ A;  4I0X B;  3J80 N;  2YDE A;  3AG2 C;  3OEE G;  3A0H Z;  1BGY H;  1H8H G;  4KL1 A;  3K08 A;  5LXT B;  1IJG A;  5E79 Z;  4JI5 O;  3CC2 V;  2DW4 A;  2F4V B;  1WPB A;  3D8C A;  4TUY B;  3RYI A;  1FJG O;  5K1X A;  4FM0 A;  2Q8V A;  2IJJ A;  1NH2 D;  1CP9 A;  3RGB A;  4X89 A;  1NTM H;  3FAV B;  3L71 H;  3BEH A;  1SER A;  1Z2G A;  1F4N A;  2QEX V;  2Y4U A;  3OR6 C;  4L87 A;  4JI2 B;  5H6Q A;  1THZ A;  1SKV A;  2YSU B;  3BRC A;  4P2Z A;  1YJ9 V;  2BCC H;  4IIJ B;  1Y76 A;  2ZQM A;  2DE0 X;  5LMU B;  1YHQ V;  1EM1 A;  1M56 C;  2IU0 A;  4D7T A;  5LMN B;  4QJF B;  5DEC A;  4WFF A;  4X20 A;  4DUZ O;  5JQG B;  4U7O A;  1ORQ C;  1NU1 H;  3STZ C;  5KLV H;  2ZE7 A;  4O4H B;  4CBC A;  4MT8 A;  4O4J B;  1H2N A;  3K58 A;  3FKS G;  3ABM C;  1K33 A;  4K0K B;  4O2B B;  1N4C A;  1I5Y A;  2F43 G;  2Y0I A;  2WLL B;  3H1H H;  1IBL B;  1K5S A;  1MZE A;  2LQT A;  4F6E A;  5LOV B;  1O9G A;  3I5D A;  3Q4H B;  5B1B C;  2WAM A;  2EIN C;  3CCR V;  4NVP A;  5EC1 C;  2NN4 A;  1TAE A;  5IJ0 A;  1OCZ B;  3OD4 A;  4RUF A;  1SQV H;  4H0L B;  1Q6U A;  4YJ3 A;  2XT9 A;  1VF5 B;  1ROP A;  2EJR A;  3TGU H;  2XAJ A;  1Q86 W;  2P5O A;  3GWK C;  1RP3 B;  5KHJ A;  1N36 O;  2E5L O;  3GB7 C;  2L6L A;  4CH4 A;  3WG7 B;  4DUY O;  1HNZ O;  3JAT B;  1Y74 B;  4MVR A;  3RN4 A;  1BSM A;  1SA0 A;  3VQV A;  4LR3 A;  3JAR B;  3FB6 C;  1N0J A;  3CYO A;  2ILM A;  3KDR A;  1XQ8 A;  2WLN A;  3OTF A;  5EIB D;  3SJC C;  2F1M A;  1N8R W;  2ZE6 A;  4ZOL B;  3BA8 A;  4N21 A;  2ETN A;  5EBW C;  4J7J A;  4WFA V;  1JPX A;  3OMI B;  2IJK A;  2LO1 A;  4O2A B;  1KP2 A;  2YIB D;  3U10 A;  2JGU A;  5JVD B;  2LP7 A;  3PJS K;  4YY3 B;  1ZTE A;  5HFM A;  2W0X A;  1IBM B;  3VOU A;  5GON B;  3E22 B;  1PV0 A;  1K8A W;  1PKX A;  1BHB A;  1RPR A;  2HVJ C;  4UCT A;  4MVQ A;  3KCY A;  1IBK O;  5L3E A;  4JI7 O;  4NR1 A;  2V7Q G;  3T4D A;  4Z1V A;  3JAL A;  2GTS A;  2Q7G A;  3ASO B;  1NS1 A;  1KP3 A;  1MA1 A;  1O9H A;  3ZRW B;  4FMT A;  5J2U B;  4JI8 O;  3ZHV A;  2JIZ G;  3OFN G;  1K9M W;  4TT3 G;  5C8Y A;  1BZK A;  3I56 V;  3JCU Z;  2FL4 A;  4JZG A;  2ZE5 A;  4HYO A;  3AG7 A;  3HR0 A;  1L8D A;  2Y4T A;  3D36 C;  2WPD G;  1RM1 B;  5KX5 A;  1S77 D;  2WLI A;  4UV9 A;  1DGS A;  1FXV A;  4B3M B;  4PDV A;  2OTJ V;  4TSF G;  5EBL C;  2IBZ H;  3KKY A;  3JAW A;  1SS3 A;  4FLT A;  4DRX A;  3CXC U;  4U7N A;  1FXK C;  2F93 B;  3HKC B;  1JOY A;  3K5M A;  1Q90 D;  2MK3 A;  2ZNJ A;  3RYF A;  2EIL B;  3RYH A;  2DMX A;  2X6A A;  5LHG A;  4DK1 A;  1AVM A;  1NVP B;  1V54 B;  2PTM A;  5K1P A;  1N34 B;  2YS8 A;  4TV8 B;  4JYA B;  1ZAU A;  4I4T B;  2EIM B;  1SQF A;  2Q0A A;  5IDJ A;  1U96 A;  1AI6 A;  4E2L A;  4EB6 A;  3AG3 C;  4DV7 O;  3BAB A;  1B3Q A;  4UV8 A;  2A9H A;  2M6Y A;  2WLH A;  3ZRS A;  3N2G A;  2MW2 B;  1OHH G;  2VWJ A;  1FD9 A;  1OCC B;  2DYS B;  3DC5 A;  2PY5 A;  4EEQ A;  4PDM A;  2OIG A;  2P90 A;  2Q69 A;  4Q6G A;  5LA6 A;  4JYY A;  2BTQ B;  1TUE B;  4XBF A;  4LH7 A;  2IH1 C;  4O4I B;  4NTX A;  4DR6 B;  1URF A;  5LHH A;  3W7S A;  4J7K A;  1Q82 W;  1MNG A;  3CCU V;  1U97 A;  3FB5 C;  3JAS A;  4ABM A;  2YEV B;  4GKK O;  3DXR A;  3SJB C;  4JTD B;  4KFM A;  4XDJ A;  3ZHR A;  1SZX A;  3C3S A;  4X1I A;  1KC8 W;  1HR0 B;  3SDL A;  2F66 C;  4LF7 B;  2CTP A;  2IM9 A;  5B1A B;  3JD3 A;  1NH2 B;  5B1O A;  4FJC C;  1H5W A;  3OM3 B;  4ZKI A;  3IC9 A;  2VS0 A;  3VBB A;  4ICG A;  4YJ2 A;  3OUF A;  4NYK A;  1YTF B;  1N32 B;  1X4T A;  1JR9 A;  1Q7Y W;  2KQX A;  4ZHQ A;  4ZI7 A;  4U3J B;  1HNW O;  1JX9 A;  4DV6 B;  3HKE B;  5H6R A;  3ZIA G;  4DV2 O;  5LP6 C;  2LW7 A;  2ZIN A;  4RAI A;  1L0N H;  3MAQ A;  2BE3 A;  3BAA A;  2FKX A;  4WFB V;  4J9Z B;  3KG2 A;  3I55 V;  1SQG A;  1VQ6 V;  5E1A C;  2ATK C;  4JYB A;  5B3S C;  4K8X A;  3ASN C;  1FFX B;  1QHT A;  4PEL A;  3E2E A;  4UCO A;  1BQZ A;  1G8M A;  3K59 A;  4LF9 O;  3SYC A;  3AG1 C;  4N23 A;  5BY1 A;  1RSO A;  3OGI B;  3A8T A;  1TVK B;  2OCC B;  4OPH A;  2YIC A;  4I5S A;  1R6T A;  1N36 B;  1J5E O;  4K3A A;  3J7A U;  1OJH A;  3WB1 A;  1M9N A;  4DUY B;  4PA6 A;  4CS3 A;  3EFF K;  2LGW A;  2X0L A;  1R3L C;  4FIP C;  1AI4 A;  1QLE B;  1R3I C;  1R73 A;  2LFR A;  4LH6 A;  5KA5 A;  1XDC A;  4FLU A;  5B66 Z;  3CRR A;  1YJN V;  3O9O A;  1Y6X A;  2GTA A;  5LGN A;  4DR5 O;  2F95 B;  3E8B A;  2OYQ A;  1TA8 A;  3GVM A;  3SJQ C;  5D5Q A;  3N2K A;  1W2B U;  3QTC A;  2YC0 A;  1GRJ A;  1YF2 A;  3CJH B;  2KSD A;  2YXL A;  1J95 A;  2JJ2 G;  3BY6 A;  4I7Z B;  2KG7 B;  1HW7 A;  2W0F C;  3MHS C;  1D5A A; 
#chains in the Genus database with same CATH homology
 2GDS A;  1AP5 A;  1N0J A;  1BS3 A;  1D5N A;  5AG2 A;  3KDR A;  1AR4 A;  3AK2 A;  1EN4 A;  1AR5 A;  4C7U A;  5A9G A;  4YIO A;  1EN5 A;  1LUW A;  3AK3 A;  3QVN A;  4E4E A;  1MMM A;  4JZ2 A;  1XIL A;  1AVM A;  1EM1 A;  1LUV A;  1ZUQ A;  3EVK A;  1VAR A;  2AW9 A;  1ZTE A;  1GN3 A;  3C3T A;  4BR6 A;  3CEI A;  1XUQ A;  1IX9 A;  1WB7 A;  3MDS A;  1PL4 A;  3TJT A;  1WB8 A;  3LSU A;  1GN6 A;  3AK1 A;  3DC5 A;  1MSD A;  1IDS A;  2QKC A;  1IXB A;  1I08 A;  4JYY A;  2RCV A;  4F6E A;  2CE4 A;  2CDY A;  1GN2 A;  3BFR A;  1XRE A;  3K9S A;  3OT7 A;  1MNG A;  1MA1 A;  1ZSP A;  2P4K A;  1PM9 A;  1KKC A;  1ZLZ A;  1QNM A;  1EN6 A;  1P7G A;  1SZX A;  3C3S A;  4X9Q A;  2ADP A;  1JA8 A;  1XDC A;  4JZG A;  1B06 A;  3IC9 A;  1I0H A;  1BT8 A;  2ADQ B;  1GN4 A;  4GUN A;  2QKA A;  3KKY A;  1VEW A;  3DC6 A;  3RN4 A;  1JR9 A;  1BSM A;  1Y67 A;  4FFK A;  4YIP A;  1AP6 A;  1N0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...