4F6EA

Crystal structure of the k182r, a183p mutant manganese superoxide dismutase from sacchromyces cerevisiae
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
192
Chain Sequence
VTLPDLWDFGALEPYISGQINELHYTHHQTYVNGFNTAVDQFQELSDLLAEPSPANARMIAIQQNIFHGGGFTNHCLFWENLAPESQGGGEPPTGALAAIDEQFGSLDELILTNTLAGVQGSGWAFIVNLSNGGLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNRPDYFAIWNVVNWEASRRFDAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Crystal Structure of the K182R, A183P mutant manganese superoxide dismutase from Sacchromyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 65
structure length 192
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4f6eA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4f6eA02
1JA8A 1XUQA 1AVMA 4JYYA 3AK2A 1BS3A 4GUNA 1EN6A 3DC5A 2AW9A 1IX9A 1MSDA 1AP5A 2P4KA 4BR6A 1D5NA 1PM9A 1XDCA 1BSMA 1LUWA 1GN3A 1QNMA 1VARA 1XREA 4FFKA 3RN4A 3K9SA 1VEWA 1EN5A 4YIPA 1MMMA 3TJTA 1EN4A 2ADPA 1GN2A 1WB8A 3CEIA 4E4EA 1MA1A 4JZ2A 1IXBA 1AR5A 3OT7A 4C7UA 4JZGA 1GN4A 2RCVA 1XILA 1Y67A 1IDSA 3AK3A 1MNGA 1JR9A 1PL4A 1P7GA 1ZUQA 2GDSA 3C3TA 1B06A 1EM1A 4YIOA 3KKYA 3LSUA 4X9QA 1BT8A 2CDYA 3C3SA 1I08A 2QKCA 1LUVA 1WB7A 1GN6A 1ZLZA 1N0JA 1I0HA 1KKCA 3EVKA 4F6EA 1SZXA 3MDSA 3AK1A 1N0NA 1AR4A 3IC9A 1ZTEA 1AP6A 2ADQB 3QVNA 1ZSPA 3BFRA 5AG2A 2CE4A 3DC6A 2QKAA 5A9GA
chains in the Genus database with same CATH superfamily
4HBNA 1XUQA 1NTKH 4JAVA 2CTQA 1G6UA 3LNMB 4O4HA 4ZI7A 1TUBA 4I9QA 1SQFA 3K5LA 3GB7C 3G71V 1MSDA 1VF6A 2E3CA 1P84F 3KCYA 1QLEC 1VQLV 3HR0A 1YEWA 2EZOA 4H0LB 1K97A 1V55C 3JAWB 1F4MA 5A2QN 3CRMA 5BY1A 5LHHA 3DSQA 1Q3EA 1RPOA 1E1QG 5JVDB 1MMMA 4RWUA 3TJTA 5H6RA 4X1IA 2VQFO 4U3JA 4B7KA 2YXHA 4D7SA 1MSWD 4LF5B 3I56V 2X0LA 4JYAO 1AR5A 2YEVA 4JYCA 1S72V 2HHHB 1TAEA 5D5QA 3RYCA 3UKMA 3B2EE 2DYSC 3O65A 1H2GA 4CH6A 4QPKA 5IWAB 2AZ2A 1B06A 5L3DA 5LP6A 4OX9B 4X1YB 2YXLA 2ZE6A 1THZA 3AG2C 3OMAB 2JIZG 2QKCA 2E5LB 3EVKA 3F7YC 4OPHA 4PDLA 3F5WC 2QWOB 4FMTA 3E8FA 5DM6V 3HKEB 5L3BA 1Z5WA 3IAYA 3S3WA 1Q81W 5JCOA 4D7TA 3H1HH 4JI8O 5J2UB 3UO3A 4FLTA 4BW5A 3E2EA 4FM1A 1VQ7V 2P22C 5CA1A 3ZHQA 1Q7YW 3JCZA 2G38A 4JI4B 5JQGA 4UCUA 3OR7C 2OWOA 1M5IA 1RP3B 4TV8B 4MVSA 2P4KA 3SPJA 1V54C 2EZPA 4PA3A 3OGIB 4DV2B 4DV3B 3K04A 4MTXA 2HJDA 4K0KO 4DV0B 4NTWA 1AJPA 4LWSA 4GKJB 2GUZB 4KUMA 1XREA 1Y6XA 1BQZA 3G67A 4UVAA 1Q5OA 4X88A 4CS2A 3C90A 5LA6A 4UXNA 2HFEC 3ABMB 3I55V 1KMIZ 2WLIB 4PJ0Z 3WG7B 1L0NH 3RFRA 1SESA 2IM9A 3A2FA 1HNWO 4PI2A 1RPRA 4DV7B 4IIJA 1W59A 3A0RA 4LF4B 3JD3A 5BXZA 1TVKB 3B09A 2R70A 3E89A 3E8HA 1ZUQA 2WPDG 1S0VA 1IURA 1M56B 5KUMA 1K34A 4DRXB 2JS3A 3ASNB 1DLBA 2JJ1G 4ZOLA 5K1XA 4DV2O 4DV6B 1JFFB 3CCJV 1WLEA 3ZMZA 3ZRWB 3IJ4A 4QIWF 2BTOA 3N2KB 1KUQA 4KHPB 3JASA 2P90A 5KMGB 4TV9A 1ZTEA 5CA0B 2P7TC 4TT3G 5IYCO 1R3JC 1M57B 4CH3A 4I9WA 2CAZC 5CB4B 2UXXA 1JPXA 4CC6A 2Z0AA 1H2NA 1H2SB 3OE7G 2NR5A 3P3PA 1TUEB 3JCUZ 4GT1A 4YHHB 3AG1C 4O4JB 2R72A 2L6LA 2DQ3A 1IX9A 2QM4A 2IH3C 4BW9A 1XL4A 1ZWIC 1D5NA 1PM9A 1BSMA 2Q7GA 4FPPA 4DV5B 1N33B 3RVYA 5FPOA 1K33A 1SC5B 3L71H 1WP8A 4QNHB 2EIJB 1ZL8A 2QR4A 2ETNA 1WPXA 5BMVB 1BGYH 1UFIA 2GSMB 4QGPA 1EN4A 5LYJB 2ADPA 2YIBA 3LSSA 5IJ0A 1NKDA 5LXTB 1S77D 4QPJA 1X4TA 1UPGA 3CYOA 3FYEB 1PNKA 2BSKB 3G80A 1Q43A 4DW0A 2IW5A 2EX3A 4NXMB 1ZAUA 4Q6GA 4J41A 4WBNB 4B3RO 4YHHO 1M4UA 2PI5A 3RGBA 1KP2A 3ZCCA 1KD1W 1COWG 1BMFG 2A79B 1YZBA 3FB8C 1FJGO 3T1YB 2QTOA 4WF9V 4MVMA 1FOUA 1AI6A 4K8XA 3CCMV 1SA0B 1N33O 1XQ8A 1CP9A 1L8DA 3L75H 3OTOO 4H37A 3EXAA 5B1BB 2JDIG 3L72H 3ZRXA 4N23A 2E76B 4J7JA 1N4CA 1E1RG 5LOVA 2AZ0A 3FX7A 4LF9O 4NXMO 1L0LH 3GVMA 4YY3B 4PA9A 2HKOA 3FAVB 1CXZB 1HW7A 1JFFA 2P6JA 1GO3F 2BOBC 2ZXWC 5IJ9B 3ZRWA 3CPWU 1N36B 4NYKA 1SZTA 3CWBH 2Q0AA 4E2LA 3D3QA 3T1YO 4GKKO 4G2KA 4GCZA 5KMGA 1DK1A 1WPBA 3D36C 2IJHA 1VARA 3M7MX 4JI6O 4HAMA 2ZE7A 1NU1H 4LF7O 1O9HA 1K5SA 1Q90D 4DR6O 2XOKG 3LDEA 1KKDA 3SYAA 1WB8A 1SETA 3JARB 1N32O 1YTFD 4WFEA 2QDOA 2YI8A 2V4DA 4P2ZA 4DW1A 1PV0A 4DR5B 2X6AA 3ABTA 1DGSA 4B3MB 2YS8A 3ZMUA 2XASA 4YY3O 2WLLB 5JJJB 4UVBA 1AJNA 4HNAA 2QWNB 3CMEV 1Q6UA 4MS2A 1SQBH 4CBCA 4UCSA 3ZN0A 1AR1B 1EZVH 3PN1A 2PUSA 2W0XA 4PV1B 1K92A 4LFCB 3IC9A 4DO2A 1A32A 2KQXA 4BIOA 1YITV 5EC1C 4WCEV 4O4LA 3CSXA 2KSDA 4ZI7B 1TUBB 3H01A 3AG3C 1R73A 5EZYA 1VMGA 5CMUA 2UXCB 3SPIA 4DR4B 4B3MO 2XNDG 3T1CA 2ZQMA 2EIMC 4JI1B 5CA3A 3OAAG 2L35A 2RN9A 2UXNA 1K7DA 1VIBA 2DWEC 1XDCA 4I55A 2UUBB 3WB2A 4X1IB 1NZ6A 5FL7G 4U3JB 1GTOA 4PELA 2OCCC 1VQOV 2UU9B 1IBLB 4YIPA 2YEVB 4PA4A 5LBQA 1OCRC 4XDLA 1VQNV 3RYCB 4X65B 3CCQV 4QE7A 1MG1A 4X8AA 3CEIA 4OGQB 3ABLB 4JZ2A 2IJJA 2LO1A 4Z2WA 5KUKA 2EJRA 4DR3B 1DTOA 4JTCB 1I94B 4PA7A 4FLVA 4AILC 5LMUB 2PYJA 5LP6B 1R1BA 2DJVA 2ITCC 2JJ2G 1P4RA 2E75B 1AI4A 3SJBC 4I50A 4FM0A 4JI2O 4LBEC 4LR3A 2XAFA 3SYPA 2ZINA 4J10A 2EIKC 2AGAA 3ZEDA 2XAGA 3AG4B 4FK5C 1QLEB 1NH2B 1PNMA 4DK0A 2LW7A 1VQ6V 3SYOA 2B1GA 5CA1B 3P30A 1VQPV 3VQWA 5L3GA 3TGUH 1SKVA 4X65O 3CJHA 3OUSA 5JQGB 2DOSA 2AXTZ 4FJCC 4BIZA 4FLWA 4EB6A 1I94O 2A9HA 2DE0X 3JSLA 1OCZC 1CPYA 1K8AW 3WB0A 2OT5A 3BABA 1NVPD 1EN6A 2AW9A 4LCUC 1AP5A 3AEIA 5LA6B 2JEUA 2N04A 3TCUA 2PTMA 1YVWA 4MVQA 3K06A 4JYAB 2DYRC 4X89A 4MTOA 2JRIA 4ZKIA 4FFKA 5JH7A 3RN4A 4XDJA 1WP7A 4PD4F 3ZS8C 4IIJB 1QCEA 1GM9A 2HG5C 3OEHG 4IGGA 3QO5A 4R7CA 4NVPA 5DEDA 4FLZA 2CUGA 3ZMVA 1XEQA 2X6BA 4FVMA 4X64O 1SQPH 1YJNV 1Z2GA 3FD9A 4DR7O 3D3IA 3E22B 4I4TB 3P3NA 5KX5A 3X2QC 4ZOLB 3RVZA 2JGDA 3K57A 3IC7A 3Q4HA 1PKXA 2V1DA 4X66O 4JI8B 4JF3A 1FD9A 3JASB 4P9OA 4UV9A 2WAMA 4TV9B 1LUVA 4AQYO 1N0JA 2Y4TA 4TUYA 3HKDA 1SZXA 1FXKC 2RMKB 3BA8A 3QO7A 2Q0OC 2LJ2A 3ZHSA 5LMNO 2AHYA 2DW4A 2KG7B 4GX0A 4R8CA 1FFXA 1U97A 4K0KB 1GM7A 4ZHQB 4Q20A 1JA8A 3HPLC 2Q68A 3FB5C 3CB2A 4UUJC 3L70H 5CBGA 4CH5A 3OGCC 5EBMC 3OD4A 1HNWB 1ZL8B 1K9MW 1VQ5V 2AHZA 2ZIMA 4JTAB 3K79A 5IJ0B 1ZX3A 3QG5A 4NTYA 1OHHG 2WLHA 3K9AA 2ODMA 4LP8A 3ZHTA 2Z5UA 1US6A 1SRYA 2Q5ZA 3W7XA 1QQCA 3JD1A 4RAIA 2LQTA 2QA4V 4EEQA 1MA1A 1GM8A 1LNQA 4RUFA 3OFNG 4DXWA 5KHIA 5HFLA 4BAYA 4CS3A 4DR1O 3SGIA 1FXKA 2GTAA 3CP1A 5FNVB 3TK1A 2OYQA 3ZIAG 4MW3A 3F5TA 3DXRA 2B1IA 3CCSV 3KKYA 1R6KA 4X9QA 3AG1B 1QU7A 3SJAC 2MW2B 4N21A 3ETDA 1SQVH 2M7WA 1Y4MA 3JD0A 3RYFA 2FMLA 2EINB 2QE7G 1SERA 4B3TO 5B3SB 2RJZA 3CCVV 5LOVB 3JALB 1AP6A 2QWRB 2ARHA 3QVNA 2F4VO 3E22A 4I4TA 1GH6A 1JJ2U 5JJEB 3JD2A 4FIPC 4JAAA 2E74B 4JYYA 4RQFA 3SR2C 1QR8A 1XMQO 3K0DA 1I5XA 2YXYA 3JAKA 3T1HO 1HNZB 2ATKC 1Q6HA 1K5QA 2Q4PA 5EIBD 4JI0O 4RUEA 2HEPA 3D8CA 5LHGA 3STLC 3U0ZA 4PDVA 1YJWV 4PDMA 5IYBO 2EILC 2F23A 5F2VO 2KG7A 3HKBB 1JMKC 5B66Z 1VQ8V 1VQKV 2ZKOA 4B3RB 3FFQA 3CE2A 1VF7A 3CCEV 3VQYA 5B5EZ 4ZHQA 5TISZ 1KYOF 4BIUA 1FJGB 2R9IA 3ABMC 1Z5VA 2RQ6A 1FS0G 4HNAB 3WG7C 5DN6G 3WFVA 3ZHRA 3L9DA 3K08A 4B08A 4MVZA 1LR1A 1PNLA 3OTOB 1PL4A 2XAJA 2ZNIA 1HNZO 3RBZA 5E79Z 3QTCA 1OV9A 3JSNA 2O57A 3B40A 3OUFA 4LH6A 1RM1B 1BQ0A 4O2BA 3LSQA 3VQXA 2ZXWB 4LF9B 2RNBA 1GK9A 2WLNA 1DF5A 4UVCA 3ASNC 4O4LB 2ZE8A 1G4YB 1DF4A 4I5SA 2V7QG 5EZYB 5FLXN 4IHJA 4YXWG 2ADQB 1OCCC 3BPZA 3PJSK 5AG2A 3S3XA 5FNVA 3QNEA 3T4ZA 2W6JG 4GKKB 1KB9F 3ASOC 1YJ9V 5A9GA 1Y74A 4GZRB 4JI6B 3BEHA 1NJIW 3I5DA 3E35A 4LF7B 4I55B 1K73W 4DR6B 1JQ0A 4ZBMA 1WNSA 4GX2A 1N32B 4GLXA 3H9VA 1H8HG 1YF2A 4X20A 1YCIA 5FPRA 3JALA 4XBFA 2ZE5A 1R6NA 5LGTA 4O2AA 4FLYA 1EN5A 2UXBO 3ABUA 2IJIA 2JVDA 2FTKA 3JYCA 5JJNB 1NBMG 2EIJC 1HR0O 1VQ4V 4WFFA 4I50B 1FKAO 2ZDIC 1YI2V 1B6QA 3OM3B 3K59A 1XMOO 4MW8A 3UT5A 2BOCC 4CS4A 1XNQO 3CRQA 1OJHA 1PL0A 4EKWA 1MNGA 1B3QA 2ZT9B 4LF8O 1H2MA 1AI5A 4IYHA 3HKBA 2CDYA 4F6RB 1FAFA 2EIMB 2Q7EA 1NQTA 1SQGA 3ZHVA 5IY5C 1I08A 1BL8A 1WAZA 1GN6A 4J80A 2VQEO 3L74H 3CJHB 2IJKA 1J5EO 2QKSA 5C8YA 5KA5A 5LGNA 4EB6B 3VBBA 2WSSG 4JPRA 5E1AC 4TQDA 3UO2A 2ZD9A 3ETQA 1F4NA 1GRJA 2CGOA 1OCRB 1EZJA 4LFAO 1BZKA 1H38A 1BCCH 3JATA 4KXRA 5B1BC 1IBKB 1XBLA 3K58A 4PDRA 1M90W 2DWDC 3K03A 2Z3YA 3IFXA 4ABMA 2FYUH 5JH7B 1XNRO 2D2CB 3F7VC 5GTIZ 2Y69B 3R65A 3JD4A 1VQMV 3NXSA 1XI1A 2CTWA 3SPCA 1N34B 4EFEA 3D36A 4DV1O 3BHPA 2XAQA 2F43G 2K9PA 2QM8A 4JV5O 1AILA 2IU3A 1PPJH 1K4CC 1HDJA 2EIKB 2KB1A 4JI2B 4X1KA 3E86A 4LH7A 4JI7O 1P7BA 3SYQA 5KX5B 2UUCB 3JAMN 4X62O 1BHAA 1SQQH 2JGDB 5EIBC 4NXNO 1IXBA 2ZIOA 3Q4HB 3CX5F 1XHZA 5JWPA 3BA9A 4IT5A 1JX9A 3RYHA 3U10A 2HLDG 2IU0A 1MZEA 3RWRD 1JVMA 4CH4A 1OCOC 2P5OA 1IBKO 3WB1A 1MABG 2Q9LA 4GX5A 4LNUA 4DUZO 3B8NA 2QM7A 3HKDB 4TUYB 5KLVH 1NR7A 1FYJA 4H13B 3SYCA 2QGNA 1H5WA 2P06A 2QJ1A 2BTQA 2Q73A 3N2GA 3ZN1A 1FFXB 4ZIBA 4K8ZA 1N34O 3THOA 5CN0A 4UB6Z 1ORQC 3MDSA 1KP3A 2P4VA 1X59A 2KKWA 5IYZA 1N0NA 1NT2B 3SJQC 3TXSA 4B3SB 3W7UA 4AI8A 4B7EA 1ZSPA 4ICGA 2UUCO 3A0HZ 4NTXA 2Q67A 1T5EA 3BCCH 4UCVA 3IGAC 2YIDA 4MTGA 2CH7A 1EBOA 1F23A 2CTPA 4JASA 4F6RA 2W0FC 4CZZA 3DC5A 1V55B 3CHXA 2VWJA 3LUTB 3TETA 3ZHUA 4NR1A 5ITZA 1R3KC 1VF5B 4X64B 2QEXV 1YDXA 2XHBA 4DR7B 1GN3A 2GHYA 1IBMO 4YJ2B 1CEZA 2PF4E 1Y76A 2W6IG 4B3SO 2MK3A 1HNXO 1YTFB 5K1PA 4W4LA 1FXKB 2DYSB 4X66B 3RT3C 3DXRB 3OT7A 4AQYB 3ABKC 1YSCA 4J7ZA 4C7UA 5CBHA 4I0XB 1IXMA 3AG2B 5LMNB 2F66C 1KU9A 3ABLC 1JR9A 1VQ9V 3H1LH 4QE9A 1RFYA 1IZ3A 3RYFB 5GONB 4P9PA 2WLJA 2QTSA 1KECA 2JEXA 4YIOA 2GTSA 2VS0A 1BT8A 3KDRA 3J80N 4UCTA 1W0JG 1YIJV 1KKCA 2PGGA 1M1KW 3ZRVA 5B1AC 1EFRG 2Y4UA 2XTAA 3R66A 3AK1A 2Q8VA 4KFMA 2HVKC 2Q69A 3SPHA 3MD0A 3RYIA 1KC8W 1K3EA 4WFGA 4DR2O 3GWKC 4HYOA 5H5NA 1IJGA 3BFRA 1WA8A 3B8MA 5JCOC 3AG4C 5H2FZ 3VOUA 2CE4A 2HP8A 3JAKB 2QKAA 1PP9H 3M8AA 1R3LC 1QBZA 5EC2C 3STZC 5BR8O 5EYPB 2K1EA 3BVOA 3L73H 1FXHA 4JTDB 1V54B 3OR6C 1BS3A 1AJQA 4OXSA 4GUNA 4LF6O 4LFBO 4PI0A 2NNUA 3HKCB 2ZM6O 3T4DA 4UCOA 2NN4A 2WA3A 4EFBA 1LUWA 3LDDA 4DR1B 2WLMA 3CC7V 5CBFA 1TA8A 2LGWA 2P67A 4BWAA 2LP7A 4YJ3A 2H8PC 1W0KG 1SS3A 4MVOA 4HZ3A 1FFTB 4E4EA 4GYCB 3UM7A 1V9PA 1SQXH 1AROP 3CRAA 4ASUG 4B3TB 2RCVA 1Y67A 1S3JA 1QR9A 3HB3B 3CCUV 4O2BB 1QVFU 4TSFG 2GDSA 3C3TA 1NI8A 1WJZA 2Y0PA 5IYDO 2N05A 2F4VB 1RSOB 2PI4A 3J81N 3APQA 4LF5O 4YJ2A 4XDKA 1WB7A 4IHJB 1ZLZA 2ZR3A 3KCXA 2HHHO 5GW7A 4F6EA 4PHZA 4FFBA 4U7OA 5EBWC 5L3CA 1XMQB 2QWPB 2ITDC 2EILB 3T1HB 4NB5A 5IWAO 1AB3A 1Y74B 3ZJZA 4JI0B 3CMAV 3G6BA 3W7WA 1Q82W 4OX9O 1FPOA 3FB7C 3ETGA 3BAAA 4I0XA 5J2TA 2EULA 4P30A 2E5LO 5GONA 1NVPB 4MTFA 4O4IB 1AVMA 2VWKA 5IE9A 2F95B 3SJCC 1H2LA 4X20B 4QJFB 1P49A 3ZRSA 3K3WA 4MSWC 2QSAA 2Q6AA 1G8MA 3OTFA 2IH1C 2DMXA 1Q86W 4O2AB 1XL6A 3J7AU 5L3FA 1GMGA 2A06H 4OPAA 3MHSC 5IDJA 2OTJV 5BZBA 1UJWB 2JK5C 5EBLC 4JI4O 1VEWA 3H1KH 3UT5B 4GX1A 4UV8A 3H1JH 1S5LZ 3FYIB 2DN9A 3JAWA 5EYPA 3CC4V 2CK3G 2ZCEA 4WFAV 4DV3O 2YICA 1S5JA 4DV0O 3HKCA 5JVDA 1OCCB 4GKJO 3K5NA 1K4DC 4L87A 1XILA 3CC2V 4J9ZB 5EK0A 3ASOB 2Q7HA 4KL1A 4MT8A 4NKGB 4K3AA 4DV4B 5KA6A 1EM1A 3LSUA 2OIGA 5C8YB 4DV7O 1O9GA 3DTUB 3GWOA 3ZX6A 2LW1A 3W7SA 3QF7A 4LF4O 1U96A 4X1YA 3DGEA 1QVGU 2B5UA 1GAXA 5KAIZ 2H94A 3JATB 3VQVA 2EINC 3G4SV 1BE3H 1YXBA 2HR3A 2UXDB 4DYLA 2FKXA 5B3SC 2DQ0A 3NR7A 4RQEA 2X6CA 4DV6O 3B77A 3HKEA 1M56C 3SPGA 5KHJA 2FB5A 3AK2A 4IYIA 1OZ0A 1RSOA 2UXBB 1WN7A 4KHPO 3CXCU 4F4LA 5J2UA 3G6EV 1NS1A 2BCCH 1AI7A 2JGUA 4DV4O 3T2MA 2N74A 3MHHC 1HR0B 4BR6A 3EFFK 1JOYA 4TOIA 3H1IH 2LFRA 1XMOB 4X1KB 1W2BU 1J95A 1QLNA 2A3QA 1QNMA 1XNQB 4R50A 1TGOA 2ILMA 4TV8A 5IY5B 4D6TH 4LF8B 4JAUA 1M57C 4JI5B 1Q6IA 3APOA 4G28B 3RYHB 2GUZA 3BY6A 2VRZA 4O4IA 4CC5A 1XOUA 2UXDO 3N27A 4LNUB 5LHIA 2WLIA 4FLXA 2OCHA 1NR1A 4DV5O 2VQEB 3W7TA 4MVUA 1GKFA 1JJOA 3KZIZ 1IDSA 2CGNA 3CCRV 1J5EB 4DUYB 1P7GA 5KAFZ 2BTQB 2A7WA 3N2GB 2OIEA 2C2AA 5D5PA 5GTHZ 4DK1A 1Y66A 3FKSG 2A0LA 2Y48A 5KHGA 2YIAA 1D2DA 4RO2A 1TVKA 3A8TA 5B1OA 5IYZB 3C3SA 3K5OA 2HJFC 4LFAB 4DRXA 1I0HA 3OW2U 1MOFA 1S5HC 4U3FH 4TWKA 1L1FA 5L3EA 4UFZA 4IL6Z 3AG3B 1RM1C 1R3IC 1MZFA 3OMIB 4JI5O 1NH2D 2F93B 3CXHF 4TQFA 3CD6V 1XNRB 2CH7B 3TXQA 3OMNB 2NLJC 1R6TA 5LL6Y 1H2KA 2WWWA 3N2KA 1F7YA 3DC6A 2XUMA 4K35A 4WFHA 3K5MA 3O9OA 2BE3A 5CA0A 4DV1B 4FZ1A 3BRCA 4JV5B 5KHKA 2LFSA 5ITZB 1NTMH 4J7KA 5LGUA 3KG2A 5CB4A 1VP7A 4DUYO 4JI7B 3CRCA 2OCCB 4U7NA 4H33A 4MVRA 3WU2Z 4X62B 2CTRA 1JCHA 1OCOB 2XT9A 1N8RW 1URFA 2GBOA 4NXNB 1Y76B 1HWYA 4O4JA 1KBHA 2R9RB 3K9SA 2ZNJA 2F1MA 1D5AA 4DUZB 4UCRA 1NTZH 1N36O 3UQ8A 2ZDIA 5BMVA 1KQSU 5LYJA 4JZGA 5LXTA 2GV9A 1GN4A 3SDLA 2OTLV 4J42A 3AK3A 4PA6A 3U11A 2BSKA 3UCSC 1B04A 4FZ0A 2YDEA 5HFMA 4Z1VA 4O4HB 3M99B 5C93A 1IVSA 4WBNA 3RYIB 4AHCA 2WA4A 3RW0A 4W4KA 1WA8B 1HP8A 2X7RB 4DR5O 2PY5A 1M9NA 3OEEG 3CCLV 2UUAB 2LGQA 3CRRA 4L8JA 5J9PC 5H9CA 5IT9N 1SA0A 1BHBA 1OCZB 1PD3A 2QWQB 3LNNA 3ML0A 1FXVA 5H6QA 1XHXA 2B9ZA 1F51A 1IBMB 3ABKB 4A5UB 4LFCO 2DYRB 3ZMTA 2YI9A 1HNXB 1QHTA 3E8BA 4JGSA 2EBOA 3MAQA 3ETEA 3E83A 1ENVA 4JI3B 4YJ3B 3FAVA 4Z1MG 2D3OW 4H44B 4J11A 2Y0IA 3AG7A 2UXCO 5IJ9A 2YC0A 2YIBD 4DR4O 2M6YA 3E8GA 2Y69C 2IBZH 4JI1O 3ZMSA 1GN2A 5B1AB 1I5YA 1SF9A 1YHQV 2UUAO 2WLKA 3LDCA 1VF6C 3X2QB 2JS5A 2YUAA 5DECA 2UUBO 3K0GA 3EHBB 4I7ZB 1Q8IA 1I7FA 3JARA 3A0BZ 2UU9O 2XAHA 1IBLO 5KHHA 2EJ7A 2ZR2A 4DR2B 1E79G 3P32A 4FFBB 1S76D 3FB6C 3ICXA 2HVJC 4DR3O 5BR8B 2WLLA 1ROPA 5B1NA 4JI3O 5LMUO 4FM2A 3ZBHA 1JNBA 2RDCA 4LF6B 4J9YB 2FL4A 4LFBB 1M93A 5J2TB 4LWSB 2ZM6B 4G27B 1AR4A 4R6ZA 2VQFB 2H3OA 4UB8Z 2PYLA 4WFBV 4FLUA 3QO8A 1H8EG 4LC1A 2R9AA 5LP6C 4KP4A 1G1XB 3B4SA 4JYBA 2PZSA 2YSUB 3CS5A
chains in the Genus database with same CATH topology
1JA8A 1XUQA 1AVMA 4JYYA 3AK2A 1BS3A 4GUNA 1EN6A 3DC5A 2AW9A 1IX9A 1MSDA 1AP5A 2P4KA 4BR6A 1D5NA 1PM9A 1XDCA 1BSMA 1LUWA 1GN3A 1QNMA 1VARA 1XREA 4FFKA 3RN4A 3K9SA 1VEWA 1EN5A 4YIPA 1MMMA 3TJTA 1EN4A 2ADPA 1GN2A 1WB8A 3CEIA 4E4EA 1MA1A 4JZ2A 1IXBA 1AR5A 3OT7A 4C7UA 4JZGA 1GN4A 2RCVA 1XILA 1Y67A 1IDSA 3AK3A 1MNGA 1JR9A 1PL4A 1P7GA 1ZUQA 2GDSA 3C3TA 1B06A 1EM1A 4YIOA 3KKYA 3LSUA 4X9QA 3KDRA 1BT8A 2CDYA 3C3SA 1I08A 2QKCA 1LUVA 1WB7A 1GN6A 1ZLZA 1N0JA 1I0HA 1KKCA 3EVKA 4F6EA 1SZXA 3MDSA 3AK1A 1N0NA 1AR4A 3IC9A 1ZTEA 1AP6A 2ADQB 3QVNA 1ZSPA 3BFRA 5AG2A 2CE4A 3DC6A 2QKAA 5A9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JA8 A;  1XUQ A;  1AVM A;  4JYY A;  3AK2 A;  1BS3 A;  4GUN A;  1EN6 A;  3DC5 A;  2AW9 A;  1IX9 A;  1MSD A;  1AP5 A;  2P4K A;  4BR6 A;  1D5N A;  1PM9 A;  1XDC A;  1BSM A;  1LUW A;  1GN3 A;  1QNM A;  1VAR A;  1XRE A;  4FFK A;  3RN4 A;  3K9S A;  1VEW A;  1EN5 A;  4YIP A;  1MMM A;  3TJT A;  1EN4 A;  2ADP A;  1GN2 A;  1WB8 A;  3CEI A;  4E4E A;  1MA1 A;  4JZ2 A;  1IXB A;  1AR5 A;  3OT7 A;  4C7U A;  4JZG A;  1GN4 A;  2RCV A;  1XIL A;  1Y67 A;  1IDS A;  3AK3 A;  1MNG A;  1JR9 A;  1PL4 A;  1P7G A;  1ZUQ A;  2GDS A;  3C3T A;  1B06 A;  1EM1 A;  4YIO A;  3KKY A;  3LSU A;  4X9Q A;  1BT8 A;  2CDY A;  3C3S A;  1I08 A;  2QKC A;  1LUV A;  1WB7 A;  1GN6 A;  1ZLZ A;  1N0J A;  1I0H A;  1KKC A;  3EVK A;  4F6E A;  1SZX A;  3MDS A;  3AK1 A;  1N0N A;  1AR4 A;  3IC9 A;  1ZTE A;  1AP6 A;  2ADQ B;  3QVN A;  1ZSP A;  3BFR A;  5AG2 A;  2CE4 A;  3DC6 A;  2QKA A;  5A9G A; 
#chains in the Genus database with same CATH topology
 4HBN A;  1XUQ A;  1NTK H;  4JAV A;  2CTQ A;  1G6U A;  3LNM B;  4O4H A;  4ZI7 A;  1TUB A;  4I9Q A;  1SQF A;  3K5L A;  3GB7 C;  3G71 V;  1MSD A;  1VF6 A;  2E3C A;  1P84 F;  3KCY A;  1QLE C;  1VQL V;  3HR0 A;  1YEW A;  2EZO A;  4H0L B;  1K97 A;  1V55 C;  3JAW B;  1F4M A;  5A2Q N;  3CRM A;  5BY1 A;  5LHH A;  3DSQ A;  1Q3E A;  1RPO A;  1E1Q G;  5JVD B;  1MMM A;  4RWU A;  3TJT A;  5H6R A;  4X1I A;  2VQF O;  4U3J A;  4B7K A;  2YXH A;  4D7S A;  1MSW D;  4LF5 B;  3I56 V;  2X0L A;  4JYA O;  1AR5 A;  2YEV A;  4JYC A;  1S72 V;  2HHH B;  1TAE A;  5D5Q A;  3RYC A;  3UKM A;  3B2E E;  2DYS C;  3O65 A;  1H2G A;  4CH6 A;  4QPK A;  5IWA B;  2AZ2 A;  1B06 A;  5L3D A;  5LP6 A;  4OX9 B;  4X1Y B;  2YXL A;  2ZE6 A;  1THZ A;  3AG2 C;  3OMA B;  2JIZ G;  2QKC A;  2E5L B;  3EVK A;  3F7Y C;  4OPH A;  4PDL A;  3F5W C;  2QWO B;  4FMT A;  3E8F A;  5DM6 V;  3HKE B;  5L3B A;  1Z5W A;  3IAY A;  3S3W A;  1Q81 W;  5JCO A;  4D7T A;  3H1H H;  4JI8 O;  5J2U B;  3UO3 A;  4FLT A;  4BW5 A;  3E2E A;  4FM1 A;  1VQ7 V;  2P22 C;  5CA1 A;  3ZHQ A;  1Q7Y W;  3JCZ A;  2G38 A;  4JI4 B;  5JQG A;  4UCU A;  3OR7 C;  2OWO A;  1M5I A;  1RP3 B;  4TV8 B;  4MVS A;  2P4K A;  3SPJ A;  1V54 C;  2EZP A;  4PA3 A;  3OGI B;  4DV2 B;  4DV3 B;  3K04 A;  4MTX A;  2HJD A;  4K0K O;  4DV0 B;  4NTW A;  1AJP A;  4LWS A;  4GKJ B;  2GUZ B;  4KUM A;  1XRE A;  1Y6X A;  1BQZ A;  3G67 A;  4UVA A;  1Q5O A;  4X88 A;  4CS2 A;  3C90 A;  5LA6 A;  4UXN A;  2HFE C;  3ABM B;  3I55 V;  1KMI Z;  2WLI B;  4PJ0 Z;  3WG7 B;  1L0N H;  3RFR A;  1SES A;  2IM9 A;  3A2F A;  1HNW O;  4PI2 A;  1RPR A;  4DV7 B;  4IIJ A;  1W59 A;  3A0R A;  4LF4 B;  3JD3 A;  5BXZ A;  1TVK B;  3B09 A;  2R70 A;  3E89 A;  3E8H A;  1ZUQ A;  2WPD G;  1S0V A;  1IUR A;  1M56 B;  5KUM A;  1K34 A;  4DRX B;  2JS3 A;  3ASN B;  1DLB A;  2JJ1 G;  4ZOL A;  5K1X A;  4DV2 O;  4DV6 B;  1JFF B;  3CCJ V;  1WLE A;  3ZMZ A;  3ZRW B;  3IJ4 A;  4QIW F;  2BTO A;  3N2K B;  1KUQ A;  4KHP B;  3JAS A;  2P90 A;  5KMG B;  4TV9 A;  1ZTE A;  5CA0 B;  2P7T C;  4TT3 G;  5IYC O;  1R3J C;  1M57 B;  4CH3 A;  4I9W A;  2CAZ C;  5CB4 B;  2UXX A;  1JPX A;  4CC6 A;  2Z0A A;  1H2N A;  1H2S B;  3OE7 G;  2NR5 A;  3P3P A;  1TUE B;  3JCU Z;  4GT1 A;  4YHH B;  3AG1 C;  4O4J B;  2R72 A;  2L6L A;  2DQ3 A;  1IX9 A;  2QM4 A;  2IH3 C;  4BW9 A;  1XL4 A;  1ZWI C;  1D5N A;  1PM9 A;  1BSM A;  2Q7G A;  4FPP A;  4DV5 B;  1N33 B;  3RVY A;  5FPO A;  1K33 A;  1SC5 B;  3L71 H;  1WP8 A;  4QNH B;  2EIJ B;  1ZL8 A;  2QR4 A;  2ETN A;  1WPX A;  5BMV B;  1BGY H;  1UFI A;  2GSM B;  4QGP A;  1EN4 A;  5LYJ B;  2ADP A;  2YIB A;  3LSS A;  5IJ0 A;  1NKD A;  5LXT B;  1S77 D;  4QPJ A;  1X4T A;  1UPG A;  3CYO A;  3FYE B;  1PNK A;  2BSK B;  3G80 A;  1Q43 A;  4DW0 A;  2IW5 A;  2EX3 A;  4NXM B;  1ZAU A;  4Q6G A;  4J41 A;  4WBN B;  4B3R O;  4YHH O;  1M4U A;  2PI5 A;  3RGB A;  1KP2 A;  3ZCC A;  1KD1 W;  1COW G;  1BMF G;  2A79 B;  1YZB A;  3FB8 C;  1FJG O;  3T1Y B;  2QTO A;  4WF9 V;  4MVM A;  1FOU A;  1AI6 A;  4K8X A;  3CCM V;  1SA0 B;  1N33 O;  1XQ8 A;  1CP9 A;  1L8D A;  3L75 H;  3OTO O;  4H37 A;  3EXA A;  5B1B B;  2JDI G;  3L72 H;  3ZRX A;  4N23 A;  2E76 B;  4J7J A;  1N4C A;  1E1R G;  5LOV A;  2AZ0 A;  3FX7 A;  4LF9 O;  4NXM O;  1L0L H;  3GVM A;  4YY3 B;  4PA9 A;  2HKO A;  3FAV B;  1CXZ B;  1HW7 A;  1JFF A;  2P6J A;  1GO3 F;  2BOB C;  2ZXW C;  5IJ9 B;  3ZRW A;  3CPW U;  1N36 B;  4NYK A;  1SZT A;  3CWB H;  2Q0A A;  4E2L A;  3D3Q A;  3T1Y O;  4GKK O;  4G2K A;  4GCZ A;  5KMG A;  1DK1 A;  1WPB A;  3D36 C;  2IJH A;  1VAR A;  3M7M X;  4JI6 O;  4HAM A;  2ZE7 A;  1NU1 H;  4LF7 O;  1O9H A;  1K5S A;  1Q90 D;  4DR6 O;  2XOK G;  3LDE A;  1KKD A;  3SYA A;  1WB8 A;  1SET A;  3JAR B;  1N32 O;  1YTF D;  4WFE A;  2QDO A;  2YI8 A;  2V4D A;  4P2Z A;  4DW1 A;  1PV0 A;  4DR5 B;  2X6A A;  3ABT A;  1DGS A;  4B3M B;  2YS8 A;  3ZMU A;  2XAS A;  4YY3 O;  2WLL B;  5JJJ B;  4UVB A;  1AJN A;  4HNA A;  2QWN B;  3CME V;  1Q6U A;  4MS2 A;  1SQB H;  4CBC A;  4UCS A;  3ZN0 A;  1AR1 B;  1EZV H;  3PN1 A;  2PUS A;  2W0X A;  4PV1 B;  1K92 A;  4LFC B;  3IC9 A;  4DO2 A;  1A32 A;  2KQX A;  4BIO A;  1YIT V;  5EC1 C;  4WCE V;  4O4L A;  3CSX A;  2KSD A;  4ZI7 B;  1TUB B;  3H01 A;  3AG3 C;  1R73 A;  5EZY A;  1VMG A;  5CMU A;  2UXC B;  3SPI A;  4DR4 B;  4B3M O;  2XND G;  3T1C A;  2ZQM A;  2EIM C;  4JI1 B;  5CA3 A;  3OAA G;  2L35 A;  2RN9 A;  2UXN A;  1K7D A;  1VIB A;  2DWE C;  1XDC A;  4I55 A;  2UUB B;  3WB2 A;  4X1I B;  1NZ6 A;  5FL7 G;  4U3J B;  1GTO A;  4PEL A;  2OCC C;  1VQO V;  2UU9 B;  1IBL B;  4YIP A;  2YEV B;  4PA4 A;  5LBQ A;  1OCR C;  4XDL A;  1VQN V;  3RYC B;  4X65 B;  3CCQ V;  4QE7 A;  1MG1 A;  4X8A A;  3CEI A;  4OGQ B;  3ABL B;  4JZ2 A;  2IJJ A;  2LO1 A;  4Z2W A;  5KUK A;  2EJR A;  4DR3 B;  1DTO A;  4JTC B;  1I94 B;  4PA7 A;  4FLV A;  4AIL C;  5LMU B;  2PYJ A;  5LP6 B;  1R1B A;  2DJV A;  2ITC C;  2JJ2 G;  1P4R A;  2E75 B;  1AI4 A;  3SJB C;  4I50 A;  4FM0 A;  4JI2 O;  4LBE C;  4LR3 A;  2XAF A;  3SYP A;  2ZIN A;  4J10 A;  2EIK C;  2AGA A;  3ZED A;  2XAG A;  3AG4 B;  4FK5 C;  1QLE B;  1NH2 B;  1PNM A;  4DK0 A;  2LW7 A;  1VQ6 V;  3SYO A;  2B1G A;  5CA1 B;  3P30 A;  1VQP V;  3VQW A;  5L3G A;  3TGU H;  1SKV A;  4X65 O;  3CJH A;  3OUS A;  5JQG B;  2DOS A;  2AXT Z;  4FJC C;  4BIZ A;  4FLW A;  4EB6 A;  1I94 O;  2A9H A;  2DE0 X;  3JSL A;  1OCZ C;  1CPY A;  1K8A W;  3WB0 A;  2OT5 A;  3BAB A;  1NVP D;  1EN6 A;  2AW9 A;  4LCU C;  1AP5 A;  3AEI A;  5LA6 B;  2JEU A;  2N04 A;  3TCU A;  2PTM A;  1YVW A;  4MVQ A;  3K06 A;  4JYA B;  2DYR C;  4X89 A;  4MTO A;  2JRI A;  4ZKI A;  4FFK A;  5JH7 A;  3RN4 A;  4XDJ A;  1WP7 A;  4PD4 F;  3ZS8 C;  4IIJ B;  1QCE A;  1GM9 A;  2HG5 C;  3OEH G;  4IGG A;  3QO5 A;  4R7C A;  4NVP A;  5DED A;  4FLZ A;  2CUG A;  3ZMV A;  1XEQ A;  2X6B A;  4FVM A;  4X64 O;  1SQP H;  1YJN V;  1Z2G A;  3FD9 A;  4DR7 O;  3D3I A;  3E22 B;  4I4T B;  3P3N A;  5KX5 A;  3X2Q C;  4ZOL B;  3RVZ A;  2JGD A;  3K57 A;  3IC7 A;  3Q4H A;  1PKX A;  2V1D A;  4X66 O;  4JI8 B;  4JF3 A;  1FD9 A;  3JAS B;  4P9O A;  4UV9 A;  2WAM A;  4TV9 B;  1LUV A;  4AQY O;  1N0J A;  2Y4T A;  4TUY A;  3HKD A;  1SZX A;  1FXK C;  2RMK B;  3BA8 A;  3QO7 A;  2Q0O C;  2LJ2 A;  3ZHS A;  5LMN O;  2AHY A;  2DW4 A;  2KG7 B;  4GX0 A;  4R8C A;  1FFX A;  1U97 A;  4K0K B;  1GM7 A;  4ZHQ B;  4Q20 A;  1JA8 A;  3HPL C;  2Q68 A;  3FB5 C;  3CB2 A;  4UUJ C;  3L70 H;  5CBG A;  4CH5 A;  3OGC C;  5EBM C;  3OD4 A;  1HNW B;  1ZL8 B;  1K9M W;  1VQ5 V;  2AHZ A;  2ZIM A;  4JTA B;  3K79 A;  5IJ0 B;  1ZX3 A;  3QG5 A;  4NTY A;  1OHH G;  2WLH A;  3K9A A;  2ODM A;  4LP8 A;  3ZHT A;  2Z5U A;  1US6 A;  1SRY A;  2Q5Z A;  3W7X A;  1QQC A;  3JD1 A;  4RAI A;  2LQT A;  2QA4 V;  4EEQ A;  1MA1 A;  1GM8 A;  1LNQ A;  4RUF A;  3OFN G;  4DXW A;  5KHI A;  5HFL A;  4BAY A;  4CS3 A;  4DR1 O;  3SGI A;  1FXK A;  2GTA A;  3CP1 A;  5FNV B;  3TK1 A;  2OYQ A;  3ZIA G;  4MW3 A;  3F5T A;  3DXR A;  2B1I A;  3CCS V;  3KKY A;  1R6K A;  4X9Q A;  3AG1 B;  1QU7 A;  3SJA C;  2MW2 B;  4N21 A;  3ETD A;  1SQV H;  2M7W A;  1Y4M A;  3JD0 A;  3RYF A;  2FML A;  2EIN B;  2QE7 G;  1SER A;  4B3T O;  5B3S B;  2RJZ A;  3CCV V;  5LOV B;  3JAL B;  1AP6 A;  2QWR B;  2ARH A;  3QVN A;  2F4V O;  3E22 A;  4I4T A;  1GH6 A;  1JJ2 U;  5JJE B;  3JD2 A;  4FIP C;  4JAA A;  2E74 B;  4JYY A;  4RQF A;  3SR2 C;  1QR8 A;  1XMQ O;  3K0D A;  1I5X A;  2YXY A;  3JAK A;  3T1H O;  1HNZ B;  2ATK C;  1Q6H A;  1K5Q A;  2Q4P A;  5EIB D;  4JI0 O;  4RUE A;  2HEP A;  3D8C A;  5LHG A;  3STL C;  3U0Z A;  4PDV A;  1YJW V;  4PDM A;  5IYB O;  2EIL C;  2F23 A;  5F2V O;  2KG7 A;  3HKB B;  1JMK C;  5B66 Z;  1VQ8 V;  1VQK V;  2ZKO A;  4B3R B;  3FFQ A;  3CE2 A;  1VF7 A;  3CCE V;  3VQY A;  5B5E Z;  4ZHQ A;  5TIS Z;  1KYO F;  4BIU A;  1FJG B;  2R9I A;  3ABM C;  1Z5V A;  2RQ6 A;  1FS0 G;  4HNA B;  3WG7 C;  5DN6 G;  3WFV A;  3ZHR A;  3L9D A;  3K08 A;  4B08 A;  4MVZ A;  1LR1 A;  1PNL A;  3OTO B;  1PL4 A;  2XAJ A;  2ZNI A;  1HNZ O;  3RBZ A;  5E79 Z;  3QTC A;  1OV9 A;  3JSN A;  2O57 A;  3B40 A;  3OUF A;  4LH6 A;  1RM1 B;  1BQ0 A;  4O2B A;  3LSQ A;  3VQX A;  2ZXW B;  4LF9 B;  2RNB A;  1GK9 A;  2WLN A;  1DF5 A;  4UVC A;  3ASN C;  4O4L B;  2ZE8 A;  1G4Y B;  1DF4 A;  4I5S A;  2V7Q G;  5EZY B;  5FLX N;  4IHJ A;  4YXW G;  2ADQ B;  1OCC C;  3BPZ A;  3PJS K;  5AG2 A;  3S3X A;  5FNV A;  3QNE A;  3T4Z A;  2W6J G;  4GKK B;  1KB9 F;  3ASO C;  1YJ9 V;  5A9G A;  1Y74 A;  4GZR B;  4JI6 B;  3BEH A;  1NJI W;  3I5D A;  3E35 A;  4LF7 B;  4I55 B;  1K73 W;  4DR6 B;  1JQ0 A;  4ZBM A;  1WNS A;  4GX2 A;  1N32 B;  4GLX A;  3H9V A;  1H8H G;  1YF2 A;  4X20 A;  1YCI A;  5FPR A;  3JAL A;  4XBF A;  2ZE5 A;  1R6N A;  5LGT A;  4O2A A;  4FLY A;  1EN5 A;  2UXB O;  3ABU A;  2IJI A;  2JVD A;  2FTK A;  3JYC A;  5JJN B;  1NBM G;  2EIJ C;  1HR0 O;  1VQ4 V;  4WFF A;  4I50 B;  1FKA O;  2ZDI C;  1YI2 V;  1B6Q A;  3OM3 B;  3K59 A;  1XMO O;  4MW8 A;  3UT5 A;  2BOC C;  4CS4 A;  1XNQ O;  3CRQ A;  1OJH A;  1PL0 A;  4EKW A;  1MNG A;  1B3Q A;  2ZT9 B;  4LF8 O;  1H2M A;  1AI5 A;  4IYH A;  3HKB A;  2CDY A;  4F6R B;  1FAF A;  2EIM B;  2Q7E A;  1NQT A;  1SQG A;  3ZHV A;  5IY5 C;  1I08 A;  1BL8 A;  1WAZ A;  1GN6 A;  4J80 A;  2VQE O;  3L74 H;  3CJH B;  2IJK A;  1J5E O;  2QKS A;  5C8Y A;  5KA5 A;  5LGN A;  4EB6 B;  3VBB A;  2WSS G;  4JPR A;  5E1A C;  4TQD A;  3UO2 A;  2ZD9 A;  3ETQ A;  1F4N A;  1GRJ A;  2CGO A;  1OCR B;  1EZJ A;  4LFA O;  1BZK A;  1H38 A;  1BCC H;  3JAT A;  4KXR A;  5B1B C;  1IBK B;  1XBL A;  3K58 A;  4PDR A;  1M90 W;  2DWD C;  3K03 A;  2Z3Y A;  3IFX A;  4ABM A;  2FYU H;  5JH7 B;  1XNR O;  2D2C B;  3F7V C;  5GTI Z;  2Y69 B;  3R65 A;  3JD4 A;  1VQM V;  3NXS A;  1XI1 A;  2CTW A;  3SPC A;  1N34 B;  4EFE A;  3D36 A;  4DV1 O;  3BHP A;  2XAQ A;  2F43 G;  2K9P A;  2QM8 A;  4JV5 O;  1AIL A;  2IU3 A;  1PPJ H;  1K4C C;  1HDJ A;  2EIK B;  2KB1 A;  4JI2 B;  4X1K A;  3E86 A;  4LH7 A;  4JI7 O;  1P7B A;  3SYQ A;  5KX5 B;  2UUC B;  3JAM N;  4X62 O;  1BHA A;  1SQQ H;  2JGD B;  5EIB C;  4NXN O;  1IXB A;  2ZIO A;  3Q4H B;  3CX5 F;  1XHZ A;  5JWP A;  3BA9 A;  4IT5 A;  1JX9 A;  3RYH A;  3U10 A;  2HLD G;  2IU0 A;  1MZE A;  3RWR D;  1JVM A;  4CH4 A;  1OCO C;  2P5O A;  1IBK O;  3WB1 A;  1MAB G;  2Q9L A;  4GX5 A;  4LNU A;  4DUZ O;  3B8N A;  2QM7 A;  3HKD B;  4TUY B;  5KLV H;  1NR7 A;  1FYJ A;  4H13 B;  3SYC A;  2QGN A;  1H5W A;  2P06 A;  2QJ1 A;  2BTQ A;  2Q73 A;  3N2G A;  3ZN1 A;  1FFX B;  4ZIB A;  4K8Z A;  1N34 O;  3THO A;  5CN0 A;  4UB6 Z;  1ORQ C;  3MDS A;  1KP3 A;  2P4V A;  1X59 A;  2KKW A;  5IYZ A;  1N0N A;  1NT2 B;  3SJQ C;  3TXS A;  4B3S B;  3W7U A;  4AI8 A;  4B7E A;  1ZSP A;  4ICG A;  2UUC O;  3A0H Z;  4NTX A;  2Q67 A;  1T5E A;  3BCC H;  4UCV A;  3IGA C;  2YID A;  4MTG A;  2CH7 A;  1EBO A;  1F23 A;  2CTP A;  4JAS A;  4F6R A;  2W0F C;  4CZZ A;  3DC5 A;  1V55 B;  3CHX A;  2VWJ A;  3LUT B;  3TET A;  3ZHU A;  4NR1 A;  5ITZ A;  1R3K C;  1VF5 B;  4X64 B;  2QEX V;  1YDX A;  2XHB A;  4DR7 B;  1GN3 A;  2GHY A;  1IBM O;  4YJ2 B;  1CEZ A;  2PF4 E;  1Y76 A;  2W6I G;  4B3S O;  2MK3 A;  1HNX O;  1YTF B;  5K1P A;  4W4L A;  1FXK B;  2DYS B;  4X66 B;  3RT3 C;  3DXR B;  3OT7 A;  4AQY B;  3ABK C;  1YSC A;  4J7Z A;  4C7U A;  5CBH A;  4I0X B;  1IXM A;  3AG2 B;  5LMN B;  2F66 C;  1KU9 A;  3ABL C;  1JR9 A;  1VQ9 V;  3H1L H;  4QE9 A;  1RFY A;  1IZ3 A;  3RYF B;  5GON B;  4P9P A;  2WLJ A;  2QTS A;  1KEC A;  2JEX A;  4YIO A;  2GTS A;  2VS0 A;  1BT8 A;  3KDR A;  3J80 N;  4UCT A;  1W0J G;  1YIJ V;  1KKC A;  2PGG A;  1M1K W;  3ZRV A;  5B1A C;  1EFR G;  2Y4U A;  2XTA A;  3R66 A;  3AK1 A;  2Q8V A;  4KFM A;  2HVK C;  2Q69 A;  3SPH A;  3MD0 A;  3RYI A;  1KC8 W;  1K3E A;  4WFG A;  4DR2 O;  3GWK C;  4HYO A;  5H5N A;  1IJG A;  3BFR A;  1WA8 A;  3B8M A;  5JCO C;  3AG4 C;  5H2F Z;  3VOU A;  2CE4 A;  2HP8 A;  3JAK B;  2QKA A;  1PP9 H;  3M8A A;  1R3L C;  1QBZ A;  5EC2 C;  3STZ C;  5BR8 O;  5EYP B;  2K1E A;  3BVO A;  3L73 H;  1FXH A;  4JTD B;  1V54 B;  3OR6 C;  1BS3 A;  1AJQ A;  4OXS A;  4GUN A;  4LF6 O;  4LFB O;  4PI0 A;  2NNU A;  3HKC B;  2ZM6 O;  3T4D A;  4UCO A;  2NN4 A;  2WA3 A;  4EFB A;  1LUW A;  3LDD A;  4DR1 B;  2WLM A;  3CC7 V;  5CBF A;  1TA8 A;  2LGW A;  2P67 A;  4BWA A;  2LP7 A;  4YJ3 A;  2H8P C;  1W0K G;  1SS3 A;  4MVO A;  4HZ3 A;  1FFT B;  4E4E A;  4GYC B;  3UM7 A;  1V9P A;  1SQX H;  1ARO P;  3CRA A;  4ASU G;  4B3T B;  2RCV A;  1Y67 A;  1S3J A;  1QR9 A;  3HB3 B;  3CCU V;  4O2B B;  1QVF U;  4TSF G;  2GDS A;  3C3T A;  1NI8 A;  1WJZ A;  2Y0P A;  5IYD O;  2N05 A;  2F4V B;  1RSO B;  2PI4 A;  3J81 N;  3APQ A;  4LF5 O;  4YJ2 A;  4XDK A;  1WB7 A;  4IHJ B;  1ZLZ A;  2ZR3 A;  3KCX A;  2HHH O;  5GW7 A;  4F6E A;  4PHZ A;  4FFB A;  4U7O A;  5EBW C;  5L3C A;  1XMQ B;  2QWP B;  2ITD C;  2EIL B;  3T1H B;  4NB5 A;  5IWA O;  1AB3 A;  1Y74 B;  3ZJZ A;  4JI0 B;  3CMA V;  3G6B A;  3W7W A;  1Q82 W;  4OX9 O;  1FPO A;  3FB7 C;  3ETG A;  3BAA A;  4I0X A;  5J2T A;  2EUL A;  4P30 A;  2E5L O;  5GON A;  1NVP B;  4MTF A;  4O4I B;  1AVM A;  2VWK A;  5IE9 A;  2F95 B;  3SJC C;  1H2L A;  4X20 B;  4QJF B;  1P49 A;  3ZRS A;  3K3W A;  4MSW C;  2QSA A;  2Q6A A;  1G8M A;  3OTF A;  2IH1 C;  2DMX A;  1Q86 W;  4O2A B;  1XL6 A;  3J7A U;  5L3F A;  1GMG A;  2A06 H;  4OPA A;  3MHS C;  5IDJ A;  2OTJ V;  5BZB A;  1UJW B;  2JK5 C;  5EBL C;  4JI4 O;  1VEW A;  3H1K H;  3UT5 B;  4GX1 A;  4UV8 A;  3H1J H;  1S5L Z;  3FYI B;  2DN9 A;  3JAW A;  5EYP A;  3CC4 V;  2CK3 G;  2ZCE A;  4WFA V;  4DV3 O;  2YIC A;  1S5J A;  4DV0 O;  3HKC A;  5JVD A;  1OCC B;  4GKJ O;  3K5N A;  1K4D C;  4L87 A;  1XIL A;  3CC2 V;  4J9Z B;  5EK0 A;  3ASO B;  2Q7H A;  4KL1 A;  4MT8 A;  4NKG B;  4K3A A;  4DV4 B;  5KA6 A;  1EM1 A;  3LSU A;  2OIG A;  5C8Y B;  4DV7 O;  1O9G A;  3DTU B;  3GWO A;  3ZX6 A;  2LW1 A;  3W7S A;  3QF7 A;  4LF4 O;  1U96 A;  4X1Y A;  3DGE A;  1QVG U;  2B5U A;  1GAX A;  5KAI Z;  2H94 A;  3JAT B;  3VQV A;  2EIN C;  3G4S V;  1BE3 H;  1YXB A;  2HR3 A;  2UXD B;  4DYL A;  2FKX A;  5B3S C;  2DQ0 A;  3NR7 A;  4RQE A;  2X6C A;  4DV6 O;  3B77 A;  3HKE A;  1M56 C;  3SPG A;  5KHJ A;  2FB5 A;  3AK2 A;  4IYI A;  1OZ0 A;  1RSO A;  2UXB B;  1WN7 A;  4KHP O;  3CXC U;  4F4L A;  5J2U A;  3G6E V;  1NS1 A;  2BCC H;  1AI7 A;  2JGU A;  4DV4 O;  3T2M A;  2N74 A;  3MHH C;  1HR0 B;  4BR6 A;  3EFF K;  1JOY A;  4TOI A;  3H1I H;  2LFR A;  1XMO B;  4X1K B;  1W2B U;  1J95 A;  1QLN A;  2A3Q A;  1QNM A;  1XNQ B;  4R50 A;  1TGO A;  2ILM A;  4TV8 A;  5IY5 B;  4D6T H;  4LF8 B;  4JAU A;  1M57 C;  4JI5 B;  1Q6I A;  3APO A;  4G28 B;  3RYH B;  2GUZ A;  3BY6 A;  2VRZ A;  4O4I A;  4CC5 A;  1XOU A;  2UXD O;  3N27 A;  4LNU B;  5LHI A;  2WLI A;  4FLX A;  2OCH A;  1NR1 A;  4DV5 O;  2VQE B;  3W7T A;  4MVU A;  1GKF A;  1JJO A;  3KZI Z;  1IDS A;  2CGN A;  3CCR V;  1J5E B;  4DUY B;  1P7G A;  5KAF Z;  2BTQ B;  2A7W A;  3N2G B;  2OIE A;  2C2A A;  5D5P A;  5GTH Z;  4DK1 A;  1Y66 A;  3FKS G;  2A0L A;  2Y48 A;  5KHG A;  2YIA A;  1D2D A;  4RO2 A;  1TVK A;  3A8T A;  5B1O A;  5IYZ B;  3C3S A;  3K5O A;  2HJF C;  4LFA B;  4DRX A;  1I0H A;  3OW2 U;  1MOF A;  1S5H C;  4U3F H;  4TWK A;  1L1F A;  5L3E A;  4UFZ A;  4IL6 Z;  3AG3 B;  1RM1 C;  1R3I C;  1MZF A;  3OMI B;  4JI5 O;  1NH2 D;  2F93 B;  3CXH F;  4TQF A;  3CD6 V;  1XNR B;  2CH7 B;  3TXQ A;  3OMN B;  2NLJ C;  1R6T A;  5LL6 Y;  1H2K A;  2WWW A;  3N2K A;  1F7Y A;  3DC6 A;  2XUM A;  4K35 A;  4WFH A;  3K5M A;  3O9O A;  2BE3 A;  5CA0 A;  4DV1 B;  4FZ1 A;  3BRC A;  4JV5 B;  5KHK A;  2LFS A;  5ITZ B;  1NTM H;  4J7K A;  5LGU A;  3KG2 A;  5CB4 A;  1VP7 A;  4DUY O;  4JI7 B;  3CRC A;  2OCC B;  4U7N A;  4H33 A;  4MVR A;  3WU2 Z;  4X62 B;  2CTR A;  1JCH A;  1OCO B;  2XT9 A;  1N8R W;  1URF A;  2GBO A;  4NXN B;  1Y76 B;  1HWY A;  4O4J A;  1KBH A;  2R9R B;  3K9S A;  2ZNJ A;  2F1M A;  1D5A A;  4DUZ B;  4UCR A;  1NTZ H;  1N36 O;  3UQ8 A;  2ZDI A;  5BMV A;  1KQS U;  5LYJ A;  4JZG A;  5LXT A;  2GV9 A;  1GN4 A;  3SDL A;  2OTL V;  4J42 A;  3AK3 A;  4PA6 A;  3U11 A;  2BSK A;  3UCS C;  1B04 A;  4FZ0 A;  2YDE A;  5HFM A;  4Z1V A;  4O4H B;  3M99 B;  5C93 A;  1IVS A;  4WBN A;  3RYI B;  4AHC A;  2WA4 A;  3RW0 A;  4W4K A;  1WA8 B;  1HP8 A;  2X7R B;  4DR5 O;  2PY5 A;  1M9N A;  3OEE G;  3CCL V;  2UUA B;  2LGQ A;  3CRR A;  4L8J A;  5J9P C;  5H9C A;  5IT9 N;  1SA0 A;  1BHB A;  1OCZ B;  1PD3 A;  2QWQ B;  3LNN A;  3ML0 A;  1FXV A;  5H6Q A;  1XHX A;  2B9Z A;  1F51 A;  1IBM B;  3ABK B;  4A5U B;  4LFC O;  2DYR B;  3ZMT A;  2YI9 A;  1HNX B;  1QHT A;  3E8B A;  4JGS A;  2EBO A;  3MAQ A;  3ETE A;  3E83 A;  1ENV A;  4JI3 B;  4YJ3 B;  3FAV A;  4Z1M G;  2D3O W;  4H44 B;  4J11 A;  2Y0I A;  3AG7 A;  2UXC O;  5IJ9 A;  2YC0 A;  2YIB D;  4DR4 O;  2M6Y A;  3E8G A;  2Y69 C;  2IBZ H;  4JI1 O;  3ZMS A;  1GN2 A;  5B1A B;  1I5Y A;  1SF9 A;  1YHQ V;  2UUA O;  2WLK A;  3LDC A;  1VF6 C;  3X2Q B;  2JS5 A;  2YUA A;  5DEC A;  2UUB O;  3K0G A;  3EHB B;  4I7Z B;  1Q8I A;  1I7F A;  3JAR A;  3A0B Z;  2UU9 O;  2XAH A;  1IBL O;  5KHH A;  2EJ7 A;  2ZR2 A;  4DR2 B;  1E79 G;  3P32 A;  4FFB B;  1S76 D;  3FB6 C;  3ICX A;  2HVJ C;  4DR3 O;  5BR8 B;  2WLL A;  1ROP A;  5B1N A;  4JI3 O;  5LMU O;  4FM2 A;  3ZBH A;  1JNB A;  2RDC A;  4LF6 B;  4J9Y B;  2FL4 A;  4LFB B;  1M93 A;  5J2T B;  4LWS B;  2ZM6 B;  4G27 B;  1AR4 A;  4R6Z A;  2VQF B;  2H3O A;  4UB8 Z;  2PYL A;  4WFB V;  4FLU A;  3QO8 A;  1H8E G;  4LC1 A;  2R9A A;  5LP6 C;  4KP4 A;  1G1X B;  3B4S A;  4JYB A;  2PZS A;  2YSU B;  3CS5 A; 
#chains in the Genus database with same CATH homology
 1JA8 A;  1XUQ A;  1AVM A;  4JYY A;  3AK2 A;  1BS3 A;  4GUN A;  1EN6 A;  3DC5 A;  2AW9 A;  1IX9 A;  1MSD A;  1AP5 A;  2P4K A;  4BR6 A;  1D5N A;  1PM9 A;  1XDC A;  1BSM A;  1LUW A;  1GN3 A;  1QNM A;  1VAR A;  1XRE A;  4FFK A;  3RN4 A;  3K9S A;  1VEW A;  1EN5 A;  4YIP A;  1MMM A;  3TJT A;  1EN4 A;  2ADP A;  1GN2 A;  1WB8 A;  3CEI A;  4E4E A;  1MA1 A;  4JZ2 A;  1IXB A;  1AR5 A;  3OT7 A;  4C7U A;  4JZG A;  1GN4 A;  2RCV A;  1XIL A;  1Y67 A;  1IDS A;  3AK3 A;  1MNG A;  1JR9 A;  1PL4 A;  1P7G A;  1ZUQ A;  2GDS A;  3C3T A;  1B06 A;  1EM1 A;  4YIO A;  3KKY A;  3LSU A;  4X9Q A;  3KDR A;  1BT8 A;  2CDY A;  3C3S A;  1I08 A;  2QKC A;  1LUV A;  1WB7 A;  1GN6 A;  1ZLZ A;  1N0J A;  1I0H A;  1KKC A;  3EVK A;  4F6E A;  1SZX A;  3MDS A;  3AK1 A;  1N0N A;  1AR4 A;  3IC9 A;  1ZTE A;  1AP6 A;  2ADQ B;  3QVN A;  1ZSP A;  3BFR A;  5AG2 A;  2CE4 A;  3DC6 A;  2QKA A;  5A9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...