4F6EA

Crystal structure of the k182r, a183p mutant manganese superoxide dismutase from sacchromyces cerevisiae
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
192
Chain Sequence
VTLPDLWDFGALEPYISGQINELHYTHHQTYVNGFNTAVDQFQELSDLLAEPSPANARMIAIQQNIFHGGGFTNHCLFWENLAPESQGGGEPPTGALAAIDEQFGSLDELILTNTLAGVQGSGWAFIVNLSNGGLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNRPDYFAIWNVVNWEASRRFDAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the K182R, A183P mutant manganese superoxide dismutase from Sacchromyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn], mitochondrial
total genus 65
structure length 192
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4f6eA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4f6eA02
2QKAA 1JA8A 3KKYA 3OT7A 1B06A 3EVKA 3BFRA 1N0NA 2P4KA 1AVMA 1IDSA 1IXBA 1EN4A 1JR9A 4YIPA 1AP5A 1VEWA 1MSDA 2RCVA 1AR5A 1D5NA 1SZXA 1XREA 1P7GA 3AK3A 1MNGA 1MMMA 1I08A 1QNMA 3AK1A 1KKCA 1BT8A 1ZSPA 1XUQA 4E4EA 1PL4A 2CDYA 3C3SA 1AR4A 1EN6A 1VARA 1MA1A 1ZTEA 2QKCA 1PM9A 2ADPA 2GDSA 1IX9A 4FFKA 3LSUA 1AP6A 4JZ2A 1GN2A 1N0JA 4F6EA 1LUVA 3K9SA 4X9QA 2AW9A 1WB7A 3DC5A 3CEIA 1GN6A 5A9GA 1ZLZA 1ZUQA 1EM1A 1BS3A 1BSMA 2CE4A 3AK2A 4C7UA 4BR6A 1XDCA 4GUNA 5AG2A 3QVNA 1Y67A 3TJTA 1XILA 4JZGA 3MDSA 1EN5A 1GN4A 2ADQB 3IC9A 1LUWA 4YIOA 4JYYA 1WB8A 1I0HA 1GN3A 3C3TA 3DC6A 3RN4A
chains in the Genus database with same CATH superfamily
3A0HZ 2OCCC 4X65O 2GTSA 3F7YC 1H8HG 2LJ2A 4ZI7B 4X65B 2Q0OC 1YSCA 3FYEB 1IBMO 4RQFA 1R6KA 3VQXA 3L75H 5IWAB 2IU0A 3FX7A 2YDEA 1PV0A 1YVWA 4FMTA 2L35A 3TXSA 3ETQA 3F5WC 1V55C 2CGOA 1ZSPA 1K33A 2AGAA 2ARHA 1MG1A 2ZE6A 3CB2A 2QKSA 1PNKA 2CUGA 2X0LA 4LF8O 1OCCB 3SR2C 1EN6A 1VARA 4RWUA 2PI5A 2OYQA 4PI2A 2Y48A 2F95B 1DK1A 4KL1A 2GV9A 3OAAG 5IWAO 1DGSA 3U0ZA 2ADPA 2GDSA 3LSUA 2EBOA 1HW7A 3OW2U 1YDXA 1SETA 4X9QA 4X1KA 2AW9A 2UU9B 1M4UA 5BMVB 3LNNA 4NXMB 3CJHA 4ASUG 4BIOA 4NXMO 2DYRB 5EIBC 2BSKB 5HFMA 1AILA 3KDRA 4H13B 3B40A 4GKJB 1AROP 2XAGA 3QNEA 4MTOA 5EC2C 1XDCA 5AG2A 5JVDA 3TJTA 2CTQA 2P7TC 1HR0B 1GN4A 1H5WA 4JGSA 4I9WA 3A0BZ 5LGNA 2YSUB 4CS2A 5F2VO 4DV6O 4PDLA 1YCIA 4ZOLA 2A7WA 1FFXA 4YJ2B 4O4HA 1JJOA 1S76D 5JH7B 1SF9A 1W0JG 3FKSG 1JX9A 3JAMN 4TV9B 5IJ0A 3D3QA 3ZRWA 2EIJB 1G8MA 4LF5O 2ZR3A 4FLXA 3GWKC 2O57A 2KKWA 3JYCA 1JFFA 4H33A 2YC0A 5LOVB 3JAKA 1IDSA 1W2BU 2ZKOA 4X66B 1VQOV 1VEWA 1WJZA 2JJ2G 4LH6A 5CBFA 4G28B 1NTKH 1QBZA 2HFEC 1OCRC 1P7GA 1X59A 3BHPA 1N33B 1FFTB 3ZMTA 4K8ZA 5BMVA 1MABG 1SQFA 2AZ0A 1KKCA 4JI5B 1T5EA 3JATB 1HWYA 4P9PA 1XUQA 4GZRB 2CH7B 2WA4A 2WA3A 1EBOA 4I9QA 2EX3A 5KA6A 1JQ0A 2KG7A 1BQ0A 3BRCA 3SJCC 2AHZA 3KCXA 1JNBA 4YY3O 3L71H 4FLTA 2Y0IA 1FS0G 4WCEV 2XUMA 1QCEA 1XBLA 4O2BA 1VQ7V 4WFGA 1HP8A 2ZNJA 4B3MB 1VF5B 4FLWA 4UCVA 5C93A 2H3OA 3K5OA 5BR8B 4OPHA 1DLBA 2R72A 1QU7A 4TSFG 1K9MW 1RPOA 1N32B 2YIBA 1CEZA 3ICXA 3ABMC 1NH2B 4JYBA 4F4LA 5LYJA 1XNQO 1NR7A 4RUFA 3B8NA 2R9RB 4FZ1A 1D5AA 4ZBMA 3B2EE 2EILB 4I7ZB 3HKCB 2XHBA 3DXRA 3RN4A 4DW0A 1P49A 1ZX3A 3HKBA 3N27A 3EFFK 4FM0A 3VBBA 5J2TB 3D3IA 1AVMA 5H6QA 1DF4A 1TUEB 4U3JB 2EJRA 3IJ4A 1UPGA 1RM1B 2KB1A 2ZQMA 2Y69C 3VQWA 1R3IC 1VQKV 2BTOA 3SYQA 2YIAA 3JARB 3MHHC 1OCZB 1YI2V 4H37A 3P3NA 5LHHA 3K57A 5EYPA 3OUFA 1DTOA 4H44B 5L3EA 2LQTA 5IYZB 4NTYA 1Q5OA 2JIZG 4KFMA 3D36A 3AG2B 2K1EA 5ITZB 1PL4A 5GTHZ 1KMIZ 5LXTA 1SQBH 2QWQB 5L3CA 4DV3O 4Q6GA 3ZIAG 2JEXA 2VQEB 3ZHRA 2CTWA 4DV7B 2MW2B 3JAWB 2UXXA 3K9SA 2Q69A 3D8CA 2ZR2A 1RFYA 3CCLV 5FPRA 4DRXB 2JJ1G 1FJGB 2ZT9B 5IYBO 1CXZB 3OTOO 3QO8A 4UCTA 2X7RB 3RFRA 2Q7EA 4JI2B 1JVMA 4G27B 3AG3C 3T1HB 3CCSV 4MVOA 4JYAB 4KUMA 4C7UA 4IIJA 1KECA 2BCCH 2VQEO 1Y76A 4JPRA 4YJ3A 3RT3C 5EIBD 3RYFB 2ATKC 3SYCA 1PL0A 4LF4O 2AHYA 3APQA 1J5EB 4ZKIA 4K3AA 5EK0A 5GW7A 2VQFO 1WB8A 1JOYA 2C2AA 2A9HA 2WPDG 3ABLB 4I50A 1B3QA 3F5TA 1XMQO 4OPAA 5HFLA 5CA3A 4JI7O 3CXCU 4B3SB 4TUYA 5CA1A 2P4KA 1Y74A 1Q90D 1DF5A 4DV4B 3JCZA 4DV5B 5B3SB 1K8AW 3OR6C 3H1JH 3T4DA 1L8DA 3AG1B 1N34B 2ZIMA 4NYKA 4XDKA 1CP9A 3ASNB 1M57B 5KUMA 4FIPC 4U7NA 3ZMZA 4R50A 3OMNB 4LFBB 5KX5A 2HVJC 4JI5O 2QSAA 4DR5O 1YITV 5L3GA 2Y4TA 4B3SO 3A2FA 2JS3A 2AZ2A 3RVYA 2YXLA 3TK1A 3J7AU 4WF9V 1JMKC 4JI6O 1WLEA 4UVCA 1PM9A 4DR4B 1LNQA 2X6BA 3UKMA 5LP6A 4FFBB 1N0JA 4MVZA 4DYLA 5FPOA 1WB7A 3DC5A 4FM1A 1M5IA 1PNMA 3OR7C 4NTXA 2HKOA 4AQYO 1ZLZA 1ZUQA 2QR4A 3R65A 4FJCC 2WLLA 3AG2C 1N33O 2ZCEA 1PD3A 1BSMA 1M56C 3E8BA 4JI1O 4X64B 1KC8W 5D5PA 1H2LA 4DR7B 1GH6A 1L0NH 1WPXA 3RVZA 1D2DA 2YEVA 1V54B 3LNMB 2DQ3A 2X6CA 1TAEA 3E89A 4MW8A 4X1IA 4OGQB 4JI0B 2ODMA 3RGBA 3JASA 3DC6A 4DUZB 2HG5C 5L3DA 1IURA 2BOCC 4ICGA 5KX5B 3OT7A 1US6A 4EEQA 1FFXB 4YJ2A 4O4HB 1BGYH 1QVFU 1X4TA 3H9VA 1N0NA 3BABA 2XAFA 3L74H 2DJVA 3ZRWB 1YIJV 3E35A 1GAXA 1SQGA 5D5QA 4P30A 5BXZA 2WLKA 1JFFB 4B3RB 4UV9A 3A0RA 2GTAA 4CH4A 3EHBB 1O9HA 2WAMA 4P2ZA 1OV9A 3O9OA 1HDJA 1YHQV 2XOKG 1H2KA 3IFXA 1RM1C 2CDYA 3WG7C 2HHHO 1M9NA 5EBLC 1VQ6V 1VQ5V 1WA8A 4JAUA 5B1NA 4PA7A 3UQ8A 4H0LB 1SESA 2HEPA 4TOIA 4NXNO 3A8TA 2YIBD 3TCUA 3HR0A 4QNHB 1LUVA 1XHZA 2GUZB 3ZHQA 5GONA 5LHIA 3CWBH 1Q82W 2KG7B 2IU3A 1B04A 2E5LB 4J41A 4X1IB 4DV0O 4FLZA 1VQMV 1BHAA 3LDCA 1IBLB 4LH7A 3BCCH 4G2KA 3QO7A 3AK2A 2UUBO 5B66Z 4TV8A 2ZE8A 4MVRA 2LP7A 5DEDA 3JSLA 3G67A 1V55B 4JZGA 1COWG 2Z3YA 1R1BA 3WB0A 3RBZA 4KP4A 5LL6Y 3K04A 4LNUB 1NS1A 4EKWA 3L73H 2Q9LA 4X89A 3ZBHA 5J2UB 1E79G 1N4CA 1I5XA 4DV0B 2DYSB 4K0KB 4LF9O 1NVPB 3L9DA 4JV5O 4FLVA 1XHXA 1M56B 1Q3EA 3DGEA 4IHJA 3LDDA 1G1XB 4X66O 2KQXA 4WFAV 2D2CB 2E75B 1AJNA 2UUCB 3HB3B 1AP5A 2Q7GA 4GX2A 3SJQC 2DWDC 2IW5A 1SQPH 4TQDA 3FFQA 5BR8O 3H1LH 3B8MA 3J81N 1YXBA 1ZAUA 3ZHSA 3OTFA 1M93A 3ZHTA 4PA9A 4RAIA 4NR1A 2YXHA 5KLVH 1B6QA 1FYJA 2JGDA 3PJSK 2ZE7A 1NVPD 3DTUB 2JDIG 2GSMB 1R6TA 2EJ7A 1FXKB 4PDMA 4CH6A 2Z5UA 4J42A 3ASNC 2HJDA 1WAZA 4DUZO 1SQVH 5FL7G 3P30A 1P4RA 3ZEDA 1Z2GA 2DWEC 4UV8A 2D3OW 4HYOA 2WWWA 2QJ1A 4B7EA 3K59A 1Q43A 2CE4A 4O2AB 4QJFB 1OCOC 4IHJB 3HPLC 1KP2A 5CBGA 2F43G 4AILC 5KAIZ 3X2QB 2P06A 1XILA 1FKAO 4BIZA 4B08A 3JD1A 2PUSA 4DR1O 4LWSA 4YIOA 1RP3B 3E22B 1ZL8B 2GHYA 4PDVA 3BAAA 1R3JC 4FLYA 1BHBA 3UO2A 5KHIA 5LA6A 2DQ0A 1I94O 4J11A 2N05A 1IBKO 3MAQA 4XBFA 4RUEA 2IJHA 2PGGA 4D7TA 1QVGU 1FXKA 3S3XA 4MW3A 3ZMSA 4LCUC 5L3FA 5LMNB 5H2FZ 4TUYB 4HNAA 5CA1B 1Y74B 3CCUV 1MMMA 4PA3A 3RYHA 1I08A 3K5NA 4LP8A 1S5LZ 4QPKA 3OGCC 4X1YB 3N2KB 4IYIA 4R6ZA 3HKDA 3C90A 1FXHA 4ZHQB 3CCMV 4NTWA 2N74A 3FAVA 4E4EA 1YTFD 2RMKB 2UXBO 1S5JA 3JD3A 4MVSA 4DV7O 1KD1W 3CRMA 3K03A 2KSDA 5LHGA 4LF7O 1Z5WA 4DR3O 2ZIOA 1H2NA 4MSWC 4DV6B 3FB5C 1ZL8A 5JCOA 4F6RA 4JASA 5FNVB 1Z5VA 3ZN0A 5A9GA 1BS3A 1VF6A 4UCRA 2MK3A 4LFAO 4CH5A 2FL4A 5B3SC 3FD9A 1SS3A 3PN1A 1PKXA 2F66C 2F23A 2Q6AA 2WLLB 5BY1A 3QG5A 3W7UA 1VQNV 2ZM6B 1LUWA 3ABTA 4LFBO 3K5LA 3RYHB 4NXNB 2NR5A 1SERA 4UVBA 1BZKA 3ABKC 1R6NA 1VF7A 5LMUO 2OTLV 2HP8A 4DR5B 3EVKA 2FKXA 1HNXO 3R66A 1KYOF 5CB4A 5KMGA 1FD9A 3ZCCA 1MOFA 5IJ9B 4YY3B 4UUJC 2RCVA 4J7KA 4EB6A 1I94B 1D5NA 4JI4B 1NTZH 4WFEA 1VMGA 3E86A 3T1YB 3L72H 5CA0A 4F6RB 2QTOA 4DR6B 4L87A 2JVDA 1S72V 3OMIB 1UFIA 1KKDA 3F7VC 4O4LA 4DR1B 3K9AA 2YXYA 1MA1A 5JVDB 4LC1A 3ZRVA 3GWOA 2P4VA 1YJWV 1K4DC 2LGQA 4PDRA 1IBKB 1WA8B 3EXAA 3QF7A 5JH7A 3KZIZ 1NT2B 2V4DA 2YICA 4I5SA 4TQFA 4Z1MG 4TV9A 4NVPA 3ZRSA 3CPWU 2UU9O 5IE9A 1F51A 4FPPA 1OCRB 1Y67A 4MVQA 5KMGB 3JD2A 4DK0A 3OTOB 1Y66A 4J7ZA 4JI3B 1AI5A 4JI0O 4J10A 4WFHA 1NJIW 2WLMA 5B1OA 1TGOA 1AR1B 2ZINA 4LFCO 5CA0B 1Q6UA 2XAQA 1JCHA 1GM7A 4BW9A 2UXCB 2VRZA 4LNUA 5K1PA 4WBNA 3CCQV 1Q6HA 2H94A 2ZDIA 4MVUA 4O4LB 1ENVA 1XL6A 5E1AC 1H2SB 2VQFB 5KHHA 2E5LO 4X62O 1MZFA 1NQTA 1SZXA 4DO2A 2Z0AA 4I0XA 3CD6V 5LMNO 3AG4B 4MVMA 3BVOA 4IL6Z 4DR4O 1BT8A 1GO3F 5LP6C 3ZX6A 1VQ8V 3SPCA 3ASOC 3SPGA 4EFEA 1F7YA 2PI4A 2YIDA 2NLJC 1MSWD 3JALA 3RYCA 2W0FC 4AI8A 2VWKA 3X2QC 4I4TB 2QKCA 3CC4V 4UCUA 4UCSA 2B5UA 1XEQA 3UO3A 2Q7HA 2QWRB 4LF9B 2ITCC 5L3BA 1TUBA 3H01A 5C8YA 3ZHVA 1N36B 5LYJB 3G6BA 2OWOA 4CC6A 4WBNB 2UUCO 3HKBB 5EC1C 3UM7A 5JJNB 4O4IA 2XNDG 5EZYB 1RSOA 1WPBA 2LO1A 3T1YO 2Q4PA 3B09A 1K97A 1P7BA 2QWOB 1SC5B 3RYIA 1N34O 2EINC 3OGIB 2YI9A 2A0LA 4JI1B 4X64O 1GTOA 1TA8A 1EZJA 4J7JA 2IJIA 2Q8VA 5CMUA 1HNZO 3C3TA 4LWSB 3CCRV 1JA8A 5LBQA 3E22A 3ABUA 4UCOA 3ASOB 5LA6B 2B9ZA 2PYLA 2WLJA 1JR9A 3IGAC 3STLC 2LFRA 1H2MA 2N04A 3P32A 4GKJO 3NXSA 4DV1O 1OJHA 1AR5A 4W4LA 3E2EA 3CSXA 3JAWA 4HZ3A 3CCVV 3CYOA 3IC7A 2R9AA 3ABKB 3AEIA 1V9PA 1QLEC 3L70H 3E8GA 5C8YB 2B1GA 4DR2O 1F4MA 2V7QG 3SYPA 3CS5A 4JI3O 1AR4A 3I56V 1IXMA 3E8FA 4FLUA 2YS8A 1BCCH 1RSOB 1K3EA 3T4ZA 1F23A 1M90W 1Y76B 1PPJH 2WLIA 3FAVB 3N2GA 3ZJZA 2UXCO 3BEHA 1Q7YW 2Q67A 4U3FH 1A32A 1QHTA 1OHHG 3CXHF 1HR0O 5EBWC 2Y0PA 1NI8A 1SA0B 3LSSA 4QGPA 3E8HA 5FNVA 4BR6A 3JCUZ 3CC7V 1SZTA 4OXSA 1FXVA 2BSKA 2QM7A 5IDJA 3MDSA 1GM8A 3MHSC 3CC2V 3CX5F 1M57C 3OD4A 5EBMC 1XMOO 3AG7A 4I55B 3CE2A 1JJ2U 2RQ6A 1Q6IA 1MZEA 5KHGA 2W6IG 2QDOA 4LF6O 2JS5A 4ZOLB 3WB1A 4LF4B 5LGUA 2QWPB 4DR7O 5FLXN 1L0LH 1HNZB 4YHHO 1RPRA 3K5MA 4K0KO 1MSDA 2WLIB 1TVKA 3N2GB 5B1BC 4YHHB 3VOUA 5LOVA 1GK9A 3JAKB 2ZXWC 1XNRO 1S3JA 1EFRG 1XNRB 4LF8B 5IJ0B 4LFCB 3W7WA 3W7TA 1L1FA 3J80N 1SA0A 4P9OA 1GRJA 2JGUA 4PA4A 3RWRD 2RNBA 3G71V 1R3LC 4B3MO 3SPIA 3JD4A 2M6YA 1GN2A 3M99B 4QE7A 3FB8C 4AHCA 1GMGA 3OMAB 3CEIA 1S0VA 2P5OA 1BQZA 1NH2D 1NBMG 4PJ0Z 3M8AA 1OZ0A 5IYCO 2JEUA 3JASB 3JSNA 3JATA 4JI6B 2ITDC 1EM1A 1AJPA 2BTQA 4JV5B 3STZC 4KXRA 2CTRA 4L8JA 5IYDO 4J9YB 4DXWA 4FVMA 1HNXB 2HVKC 2ZXWB 1R73A 4MTGA 1H8EG 2OT5A 1I5YA 3OUSA 1NKDA 3CP1A 3FYIB 3CCEV 1YJ9V 1I0HA 2FMLA 5KUKA 3FB7C 2LW7A 2ILMA 3QO5A 1QR9A 2UXDO 3DXRB 4D6TH 4RO2A 4YIPA 1LR1A 3AG3B 1SKVA 4GX5A 4LF6B 3CRAA 2QEXV 1AJQA 2XTAA 2DYRC 2IBZH 3SYAA 2UXBB 3AK3A 1JPXA 1MNGA 2EIKC 1W0KG 1BL8A 4XDLA 4DV2O 1KUQA 3HKCA 2H8PC 1NU1H 1ZWIC 2VS0A 1N8RW 1IBMB 2QM8A 4JF3A 3CRCA 1FAFA 3E83A 2AXTZ 4R8CA 4N21A 3C3SA 5CN0A 1VP7A 5IYZA 4B3RO 4DUYO 5JJEB 4U3JA 3W7XA 1Q81W 2EIMB 5ITZA 4JAAA 2PZSA 3ABMB 1KU9A 4LFAB 2B1IA 1VIBA 3T1HO 5LXTB 5TISZ 5EYPB 4TWKA 1G4YB 4TV8B 2HHHB 3CCJV 3DSQA 4IGGA 4PV1B 1ORQC 4UB6Z 4LF7B 3S3WA 2PY5A 5DECA 3G4SV 3ZMVA 1TUBB 2OIGA 1IVSA 4DRXA 5J2UA 1F4NA 1XMQB 1P84F 2BOBC 3I5DA 1VQ9V 4X8AA 1J95A 4X62B 1XL4A 2Y4UA 3AG4C 3M7MX 5KHJA 3OM3B 5A2QN 1VF6C 4J80A 3SGIA 3U11A 4OX9O 2RJZA 4IIJB 1K92A 5H6RA 1WP8A 4JTCB 5JWPA 2FTKA 5BZBA 2QWNB 3RYFA 4KHPB 2EIKB 5CBHA 3KKYA 3HKEB 4Q20A 2JGDB 2OTJV 4AQYB 2Q73A 4LR3A 4I50B 3ETEA 4DR6O 1AI7A 4NKGB 2WLHA 4YJ3B 4CS3A 2DW4A 1K34A 1PP9H 3GB7C 4DR3B 4UXNA 5K1XA 3T1CA 4GLXA 1GKFA 1QNMA 1VQ4V 1YZBA 2OIEA 4GKKO 4BIUA 4GT1A 1THZA 1AI6A 4EFBA 4JI2O 4B3TB 1UJWB 3WFVA 2EINB 4O4JB 3LUTB 4R7CA 3THOA 2GBOA 4PI0A 1XI1A 2ZD9A 3JD0A 3MD0A 1N32O 3VQYA 4TT3G 2PF4E 4E2LA 4ZIBA 5IY5B 4WFBV 1M1KW 4O2AA 1GN6A 4CZZA 2V1DA 3BY6A 4MTFA 1SQQH 2A06H 4DUYB 1R3KC 2RDCA 4A5UB 3SPHA 3G80A 4IYHA 3K58A 4X20B 2UXDB 1W59A 2F93B 2IH1C 3B4SA 4PD4F 3HKEA 3OE7G 3BA9A 1QR8A 4DV1B 1YTFB 3QVNA 2HLDG 4YXWG 1OCZC 2XASA 3IAYA 2WSSG 3K79A 5LP6B 4FFBA 1FOUA 1QLEB 3ETDA 4FK5C 4CBCA 4MS2A 1OCCC 4JYCA 3K3WA 1FPOA 4JI8O 1HNWO 2NNUA 3CMEV 1GN3A 2XAHA 3T2MA 1AI4A 4MT8A 1HNWB 1CPYA 4JI7B 4Z2WA 2JRIA 4ZHQA 4I55A 2EULA 1Y6XA 2P22C 4UFZA 4GX0A 3D36C 2VWJA 2YEVB 2EZPA 2ZM6O 3ETGA 1XREA 1J5EO 3K0DA 2XT9A 2WLNA 2LFSA 1ROPA 4B7KA 1NTMH 2RN9A 2UXNA 1TVKB 1S5HC 3CHXA 5LMUB 3K06A 3NR7A 1U96A 2UUAB 4U7OA 4X1KB 1ZTEA 4HAMA 4DV4O 4DV5O 4QIWF 5JCOC 3KG2A 2LGWA 3CJHB 4QE9A 4D7SA 5DM6V 2CGNA 1IX9A 1K5SA 4GYCB 4W4KA 1IBLO 3OEHG 3LDEA 3ABLC 4F6EA 1O9GA 1EZVH 4K35A 5KAFZ 3CMAV 4K8XA 4BAYA 3B77A 2DOSA 1V54C 4UB8Z 1QLNA 3TETA 4CH3A 1QQCA 2GUZA 5GONB 3TGUH 2UUAO 4DV2B 1H2GA 3ZS8C 1VQPV 1I7FA 2IH3C 5B1BB 2JK5C 3RW0A 3KCYA 4DK1A 2FYUH 5KA5A 4PHZA 1U97A 2BTQB 1EN5A 1N36O 3TXQA 4JYYA 1YEWA 2ZNIA 4LBEC 2DN9A 5IY5C 1FXKC 3GVMA 1E1QG 3CRQA 4OX9B 1K7DA 3VQVA 5CB4B 5H9CA 1KQSU 2QKAA 5IT9N 2HR3A 1BE3H 5IJ9A 1KBHA 4EB6B 5E79Z 2CTPA 3H1KH 3OEEG 1KB9F 4PELA 1SRYA 2W6JG 1IXBA 1K5QA 1EN4A 3SJAC 4DR2B 2FB5A 3P3PA 4JTDB 3K0GA 1K4CC 2P6JA 3SPJA 3Q4HB 2E76B 2CH7A 4FM2A 2YI8A 3H1IH 1G6UA 4DW1A 1WNSA 1NR1A 2E3CA 2ZDIC 2EIJC 1E1RG 4RQEA 5J9PC 4CS4A 2A79B 4B3TO 4O2BB 4JI8B 5JJJB 4FFKA 3G6EV 4JZ2A 5B1AB 2HJFC 1SQXH 1BMFG 3QTCA 1KP3A 2NN4A 4GCZA 4HBNA 2IJKA 1WN7A 1Q86W 2QGNA 4JTAB 1FJGO 2QA4V 5DN6G 2X6AA 4NB5A 4GKKB 4GUNA 2EZOA 4DV3B 3BPZA 5KHKA 1IZ3A 4JYAO 2DMXA 4GX1A 2ADQB 3IC9A 4ABMA 2R9IA 1XOUA 3UCSC 4X88A 3Q4HA 3ZRXA 2QE7G 5GTIZ 5JQGA 2F4VO 3O65A 5J2TA 1Q8IA 3BA8A 4XDJA 3FB6C 4LF5B 2F4VB 2EIMC 4N23A 2F1MA 4Z1VA 3ZHUA 5B1AC 2P90A 1AB3A 3I55V 2P67A 1XMOB 1B06A 3JALB 3BFRA 1URFA 3JARA 4I0XB 1WP7A 2IJJA 2BE3A 1IJGA 1XQ8A 4I4TA 4BWAA 3CRRA 4UVAA 2XAJA 3ZMUA 3WU2Z 2PTMA 2ETNA 3UT5B 2K9PA 1PNLA 1Y4MA 2CK3G 3SYOA 3AK1A 1YJNV 1S77D 5LGTA 2M7WA 3RYCB 1H38A 2W0XA 2Q68A 4HNAB 4ZI7A 1XNQB 1GM9A 2ZE5A 4X1YA 2E74B 5H5NA 3N2KA 2L6LA 4O4IB 5EZYA 2Q5ZA 2QM4A 2OCCB 3ZN1A 2A3QA 1OCOB 2Y69B 1AP6A 4BW5A 3LSQA 4O4JA 2DYSC 4QPJA 3W7SA 4MTXA 3OFNG 3SJBC 3SDLA 3H1HH 1NZ6A 3AG1C 5JQGB 3HKDB 4JI4O 4J9ZB 2DE0X 4KHPO 2EILC 3ML0A 4WFFA 4FZ0A 3K08A 3RYIB 3APOA 4JAVA 2Q0AA 2R70A 4PA6A 2CAZC 2YUAA 4IT5A 4X20A 4CC5A 3WB2A 2QTSA 3UT5A 3U10A 3WG7B 2LW1A 2PYJA 2OCHA 1K73W 2UUBB 1YF2A 1VQLV 2IM9A 2G38A 5B5EZ
chains in the Genus database with same CATH topology
2QKAA 1JA8A 3KKYA 3OT7A 1B06A 3EVKA 3BFRA 1N0NA 2P4KA 1AVMA 1IDSA 1IXBA 1EN4A 1JR9A 4YIPA 1AP5A 1VEWA 1MSDA 2RCVA 1AR5A 1D5NA 1SZXA 1XREA 1P7GA 3AK3A 1MNGA 1MMMA 1I08A 1QNMA 3AK1A 1KKCA 1BT8A 1ZSPA 1XUQA 4E4EA 1PL4A 2CDYA 3C3SA 1AR4A 1EN6A 1VARA 1MA1A 1ZTEA 2QKCA 1PM9A 2ADPA 2GDSA 1IX9A 4FFKA 3LSUA 1AP6A 4JZ2A 1GN2A 1N0JA 4F6EA 1LUVA 3K9SA 4X9QA 2AW9A 1WB7A 3DC5A 3CEIA 1GN6A 5A9GA 1ZLZA 1ZUQA 1EM1A 1BS3A 3KDRA 1BSMA 2CE4A 3AK2A 4C7UA 4BR6A 1XDCA 4GUNA 5AG2A 3QVNA 1Y67A 3TJTA 1XILA 4JZGA 3MDSA 1EN5A 1GN4A 2ADQB 3IC9A 1LUWA 4YIOA 4JYYA 1WB8A 1I0HA 1GN3A 3C3TA 3DC6A 3RN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKA A;  1JA8 A;  3KKY A;  3OT7 A;  1B06 A;  3EVK A;  3BFR A;  1N0N A;  2P4K A;  1AVM A;  1IDS A;  1IXB A;  1EN4 A;  1JR9 A;  4YIP A;  1AP5 A;  1VEW A;  1MSD A;  2RCV A;  1AR5 A;  1D5N A;  1SZX A;  1XRE A;  1P7G A;  3AK3 A;  1MNG A;  1MMM A;  1I08 A;  1QNM A;  3AK1 A;  1KKC A;  1BT8 A;  1ZSP A;  1XUQ A;  4E4E A;  1PL4 A;  2CDY A;  3C3S A;  1AR4 A;  1EN6 A;  1VAR A;  1MA1 A;  1ZTE A;  2QKC A;  1PM9 A;  2ADP A;  2GDS A;  1IX9 A;  4FFK A;  3LSU A;  1AP6 A;  4JZ2 A;  1GN2 A;  1N0J A;  4F6E A;  1LUV A;  3K9S A;  4X9Q A;  2AW9 A;  1WB7 A;  3DC5 A;  3CEI A;  1GN6 A;  5A9G A;  1ZLZ A;  1ZUQ A;  1EM1 A;  1BS3 A;  1BSM A;  2CE4 A;  3AK2 A;  4C7U A;  4BR6 A;  1XDC A;  4GUN A;  5AG2 A;  3QVN A;  1Y67 A;  3TJT A;  1XIL A;  4JZG A;  3MDS A;  1EN5 A;  1GN4 A;  2ADQ B;  3IC9 A;  1LUW A;  4YIO A;  4JYY A;  1WB8 A;  1I0H A;  1GN3 A;  3C3T A;  3DC6 A;  3RN4 A; 
#chains in the Genus database with same CATH topology
 3A0H Z;  2OCC C;  4X65 O;  2GTS A;  3F7Y C;  1H8H G;  2LJ2 A;  4ZI7 B;  4X65 B;  2Q0O C;  1YSC A;  3FYE B;  1IBM O;  4RQF A;  1R6K A;  3VQX A;  3L75 H;  5IWA B;  2IU0 A;  3FX7 A;  2YDE A;  1PV0 A;  1YVW A;  4FMT A;  2L35 A;  3TXS A;  3ETQ A;  3F5W C;  1V55 C;  2CGO A;  1ZSP A;  1K33 A;  2AGA A;  2ARH A;  1MG1 A;  2ZE6 A;  3CB2 A;  2QKS A;  1PNK A;  2CUG A;  2X0L A;  4LF8 O;  1OCC B;  3SR2 C;  1EN6 A;  1VAR A;  4RWU A;  2PI5 A;  2OYQ A;  4PI2 A;  2Y48 A;  2F95 B;  1DK1 A;  4KL1 A;  2GV9 A;  3OAA G;  5IWA O;  1DGS A;  3U0Z A;  2ADP A;  2GDS A;  3LSU A;  2EBO A;  1HW7 A;  3OW2 U;  1YDX A;  1SET A;  4X9Q A;  4X1K A;  2AW9 A;  2UU9 B;  1M4U A;  5BMV B;  3LNN A;  4NXM B;  3CJH A;  4ASU G;  4BIO A;  4NXM O;  2DYR B;  5EIB C;  2BSK B;  5HFM A;  1AIL A;  3KDR A;  4H13 B;  3B40 A;  4GKJ B;  1ARO P;  2XAG A;  3QNE A;  4MTO A;  5EC2 C;  1XDC A;  5AG2 A;  5JVD A;  3TJT A;  2CTQ A;  2P7T C;  1HR0 B;  1GN4 A;  1H5W A;  4JGS A;  4I9W A;  3A0B Z;  5LGN A;  2YSU B;  4CS2 A;  5F2V O;  4DV6 O;  4PDL A;  1YCI A;  4ZOL A;  2A7W A;  1FFX A;  4YJ2 B;  4O4H A;  1JJO A;  1S76 D;  5JH7 B;  1SF9 A;  1W0J G;  3FKS G;  1JX9 A;  3JAM N;  4TV9 B;  5IJ0 A;  3D3Q A;  3ZRW A;  2EIJ B;  1G8M A;  4LF5 O;  2ZR3 A;  4FLX A;  3GWK C;  2O57 A;  2KKW A;  3JYC A;  1JFF A;  4H33 A;  2YC0 A;  5LOV B;  3JAK A;  1IDS A;  1W2B U;  2ZKO A;  4X66 B;  1VQO V;  1VEW A;  1WJZ A;  2JJ2 G;  4LH6 A;  5CBF A;  4G28 B;  1NTK H;  1QBZ A;  2HFE C;  1OCR C;  1P7G A;  1X59 A;  3BHP A;  1N33 B;  1FFT B;  3ZMT A;  4K8Z A;  5BMV A;  1MAB G;  1SQF A;  2AZ0 A;  1KKC A;  4JI5 B;  1T5E A;  3JAT B;  1HWY A;  4P9P A;  1XUQ A;  4GZR B;  2CH7 B;  2WA4 A;  2WA3 A;  1EBO A;  4I9Q A;  2EX3 A;  5KA6 A;  1JQ0 A;  2KG7 A;  1BQ0 A;  3BRC A;  3SJC C;  2AHZ A;  3KCX A;  1JNB A;  4YY3 O;  3L71 H;  4FLT A;  2Y0I A;  1FS0 G;  4WCE V;  2XUM A;  1QCE A;  1XBL A;  4O2B A;  1VQ7 V;  4WFG A;  1HP8 A;  2ZNJ A;  4B3M B;  1VF5 B;  4FLW A;  4UCV A;  5C93 A;  2H3O A;  3K5O A;  5BR8 B;  4OPH A;  1DLB A;  2R72 A;  1QU7 A;  4TSF G;  1K9M W;  1RPO A;  1N32 B;  2YIB A;  1CEZ A;  3ICX A;  3ABM C;  1NH2 B;  4JYB A;  4F4L A;  5LYJ A;  1XNQ O;  1NR7 A;  4RUF A;  3B8N A;  2R9R B;  4FZ1 A;  1D5A A;  4ZBM A;  3B2E E;  2EIL B;  4I7Z B;  3HKC B;  2XHB A;  3DXR A;  3RN4 A;  4DW0 A;  1P49 A;  1ZX3 A;  3HKB A;  3N27 A;  3EFF K;  4FM0 A;  3VBB A;  5J2T B;  3D3I A;  1AVM A;  5H6Q A;  1DF4 A;  1TUE B;  4U3J B;  2EJR A;  3IJ4 A;  1UPG A;  1RM1 B;  2KB1 A;  2ZQM A;  2Y69 C;  3VQW A;  1R3I C;  1VQK V;  2BTO A;  3SYQ A;  2YIA A;  3JAR B;  3MHH C;  1OCZ B;  1YI2 V;  4H37 A;  3P3N A;  5LHH A;  3K57 A;  5EYP A;  3OUF A;  1DTO A;  4H44 B;  5L3E A;  2LQT A;  5IYZ B;  4NTY A;  1Q5O A;  2JIZ G;  4KFM A;  3D36 A;  3AG2 B;  2K1E A;  5ITZ B;  1PL4 A;  5GTH Z;  1KMI Z;  5LXT A;  1SQB H;  2QWQ B;  5L3C A;  4DV3 O;  4Q6G A;  3ZIA G;  2JEX A;  2VQE B;  3ZHR A;  2CTW A;  4DV7 B;  2MW2 B;  3JAW B;  2UXX A;  3K9S A;  2Q69 A;  3D8C A;  2ZR2 A;  1RFY A;  3CCL V;  5FPR A;  4DRX B;  2JJ1 G;  1FJG B;  2ZT9 B;  5IYB O;  1CXZ B;  3OTO O;  3QO8 A;  4UCT A;  2X7R B;  3RFR A;  2Q7E A;  4JI2 B;  1JVM A;  4G27 B;  3AG3 C;  3T1H B;  3CCS V;  4MVO A;  4JYA B;  4KUM A;  4C7U A;  4IIJ A;  1KEC A;  2BCC H;  2VQE O;  1Y76 A;  4JPR A;  4YJ3 A;  3RT3 C;  5EIB D;  3RYF B;  2ATK C;  3SYC A;  1PL0 A;  4LF4 O;  2AHY A;  3APQ A;  1J5E B;  4ZKI A;  4K3A A;  5EK0 A;  5GW7 A;  2VQF O;  1WB8 A;  1JOY A;  2C2A A;  2A9H A;  2WPD G;  3ABL B;  4I50 A;  1B3Q A;  3F5T A;  1XMQ O;  4OPA A;  5HFL A;  5CA3 A;  4JI7 O;  3CXC U;  4B3S B;  4TUY A;  5CA1 A;  2P4K A;  1Y74 A;  1Q90 D;  1DF5 A;  4DV4 B;  3JCZ A;  4DV5 B;  5B3S B;  1K8A W;  3OR6 C;  3H1J H;  3T4D A;  1L8D A;  3AG1 B;  1N34 B;  2ZIM A;  4NYK A;  4XDK A;  1CP9 A;  3ASN B;  1M57 B;  5KUM A;  4FIP C;  4U7N A;  3ZMZ A;  4R50 A;  3OMN B;  4LFB B;  5KX5 A;  2HVJ C;  4JI5 O;  2QSA A;  4DR5 O;  1YIT V;  5L3G A;  2Y4T A;  4B3S O;  3A2F A;  2JS3 A;  2AZ2 A;  3RVY A;  2YXL A;  3TK1 A;  3J7A U;  4WF9 V;  1JMK C;  4JI6 O;  1WLE A;  4UVC A;  1PM9 A;  4DR4 B;  1LNQ A;  2X6B A;  3UKM A;  5LP6 A;  4FFB B;  1N0J A;  4MVZ A;  4DYL A;  5FPO A;  1WB7 A;  3DC5 A;  4FM1 A;  1M5I A;  1PNM A;  3OR7 C;  4NTX A;  2HKO A;  4AQY O;  1ZLZ A;  1ZUQ A;  2QR4 A;  3R65 A;  4FJC C;  2WLL A;  3AG2 C;  1N33 O;  2ZCE A;  1PD3 A;  1BSM A;  1M56 C;  3E8B A;  4JI1 O;  4X64 B;  1KC8 W;  5D5P A;  1H2L A;  4DR7 B;  1GH6 A;  1L0N H;  1WPX A;  3RVZ A;  1D2D A;  2YEV A;  1V54 B;  3LNM B;  2DQ3 A;  2X6C A;  1TAE A;  3E89 A;  4MW8 A;  4X1I A;  4OGQ B;  4JI0 B;  2ODM A;  3RGB A;  3JAS A;  3DC6 A;  4DUZ B;  2HG5 C;  5L3D A;  1IUR A;  2BOC C;  4ICG A;  5KX5 B;  3OT7 A;  1US6 A;  4EEQ A;  1FFX B;  4YJ2 A;  4O4H B;  1BGY H;  1QVF U;  1X4T A;  3H9V A;  1N0N A;  3BAB A;  2XAF A;  3L74 H;  2DJV A;  3ZRW B;  1YIJ V;  3E35 A;  1GAX A;  1SQG A;  5D5Q A;  4P30 A;  5BXZ A;  2WLK A;  1JFF B;  4B3R B;  4UV9 A;  3A0R A;  2GTA A;  4CH4 A;  3EHB B;  1O9H A;  2WAM A;  4P2Z A;  1OV9 A;  3O9O A;  1HDJ A;  1YHQ V;  2XOK G;  1H2K A;  3IFX A;  1RM1 C;  2CDY A;  3WG7 C;  2HHH O;  1M9N A;  5EBL C;  1VQ6 V;  1VQ5 V;  1WA8 A;  4JAU A;  5B1N A;  4PA7 A;  3UQ8 A;  4H0L B;  1SES A;  2HEP A;  4TOI A;  4NXN O;  3A8T A;  2YIB D;  3TCU A;  3HR0 A;  4QNH B;  1LUV A;  1XHZ A;  2GUZ B;  3ZHQ A;  5GON A;  5LHI A;  3CWB H;  1Q82 W;  2KG7 B;  2IU3 A;  1B04 A;  2E5L B;  4J41 A;  4X1I B;  4DV0 O;  4FLZ A;  1VQM V;  1BHA A;  3LDC A;  1IBL B;  4LH7 A;  3BCC H;  4G2K A;  3QO7 A;  3AK2 A;  2UUB O;  5B66 Z;  4TV8 A;  2ZE8 A;  4MVR A;  2LP7 A;  5DED A;  3JSL A;  3G67 A;  1V55 B;  4JZG A;  1COW G;  2Z3Y A;  1R1B A;  3WB0 A;  3RBZ A;  4KP4 A;  5LL6 Y;  3K04 A;  4LNU B;  1NS1 A;  4EKW A;  3L73 H;  2Q9L A;  4X89 A;  3ZBH A;  5J2U B;  1E79 G;  1N4C A;  1I5X A;  4DV0 B;  2DYS B;  4K0K B;  4LF9 O;  1NVP B;  3L9D A;  4JV5 O;  4FLV A;  1XHX A;  1M56 B;  1Q3E A;  3DGE A;  4IHJ A;  3LDD A;  1G1X B;  4X66 O;  2KQX A;  4WFA V;  2D2C B;  2E75 B;  1AJN A;  2UUC B;  3HB3 B;  1AP5 A;  2Q7G A;  4GX2 A;  3SJQ C;  2DWD C;  2IW5 A;  1SQP H;  4TQD A;  3FFQ A;  5BR8 O;  3H1L H;  3B8M A;  3J81 N;  1YXB A;  1ZAU A;  3ZHS A;  3OTF A;  1M93 A;  3ZHT A;  4PA9 A;  4RAI A;  4NR1 A;  2YXH A;  5KLV H;  1B6Q A;  1FYJ A;  2JGD A;  3PJS K;  2ZE7 A;  1NVP D;  3DTU B;  2JDI G;  2GSM B;  1R6T A;  2EJ7 A;  1FXK B;  4PDM A;  4CH6 A;  2Z5U A;  4J42 A;  3ASN C;  2HJD A;  1WAZ A;  4DUZ O;  1SQV H;  5FL7 G;  3P30 A;  1P4R A;  3ZED A;  1Z2G A;  2DWE C;  4UV8 A;  2D3O W;  4HYO A;  2WWW A;  2QJ1 A;  4B7E A;  3K59 A;  1Q43 A;  2CE4 A;  4O2A B;  4QJF B;  1OCO C;  4IHJ B;  3HPL C;  1KP2 A;  5CBG A;  2F43 G;  4AIL C;  5KAI Z;  3X2Q B;  2P06 A;  1XIL A;  1FKA O;  4BIZ A;  4B08 A;  3JD1 A;  2PUS A;  4DR1 O;  4LWS A;  4YIO A;  1RP3 B;  3E22 B;  1ZL8 B;  2GHY A;  4PDV A;  3BAA A;  1R3J C;  4FLY A;  1BHB A;  3UO2 A;  5KHI A;  5LA6 A;  2DQ0 A;  1I94 O;  4J11 A;  2N05 A;  1IBK O;  3MAQ A;  4XBF A;  4RUE A;  2IJH A;  2PGG A;  4D7T A;  1QVG U;  1FXK A;  3S3X A;  4MW3 A;  3ZMS A;  4LCU C;  5L3F A;  5LMN B;  5H2F Z;  4TUY B;  4HNA A;  5CA1 B;  1Y74 B;  3CCU V;  1MMM A;  4PA3 A;  3RYH A;  1I08 A;  3K5N A;  4LP8 A;  1S5L Z;  4QPK A;  3OGC C;  4X1Y B;  3N2K B;  4IYI A;  4R6Z A;  3HKD A;  3C90 A;  1FXH A;  4ZHQ B;  3CCM V;  4NTW A;  2N74 A;  3FAV A;  4E4E A;  1YTF D;  2RMK B;  2UXB O;  1S5J A;  3JD3 A;  4MVS A;  4DV7 O;  1KD1 W;  3CRM A;  3K03 A;  2KSD A;  5LHG A;  4LF7 O;  1Z5W A;  4DR3 O;  2ZIO A;  1H2N A;  4MSW C;  4DV6 B;  3FB5 C;  1ZL8 A;  5JCO A;  4F6R A;  4JAS A;  5FNV B;  1Z5V A;  3ZN0 A;  5A9G A;  1BS3 A;  1VF6 A;  4UCR A;  2MK3 A;  4LFA O;  4CH5 A;  2FL4 A;  5B3S C;  3FD9 A;  1SS3 A;  3PN1 A;  1PKX A;  2F66 C;  2F23 A;  2Q6A A;  2WLL B;  5BY1 A;  3QG5 A;  3W7U A;  1VQN V;  2ZM6 B;  1LUW A;  3ABT A;  4LFB O;  3K5L A;  3RYH B;  4NXN B;  2NR5 A;  1SER A;  4UVB A;  1BZK A;  3ABK C;  1R6N A;  1VF7 A;  5LMU O;  2OTL V;  2HP8 A;  4DR5 B;  3EVK A;  2FKX A;  1HNX O;  3R66 A;  1KYO F;  5CB4 A;  5KMG A;  1FD9 A;  3ZCC A;  1MOF A;  5IJ9 B;  4YY3 B;  4UUJ C;  2RCV A;  4J7K A;  4EB6 A;  1I94 B;  1D5N A;  4JI4 B;  1NTZ H;  4WFE A;  1VMG A;  3E86 A;  3T1Y B;  3L72 H;  5CA0 A;  4F6R B;  2QTO A;  4DR6 B;  4L87 A;  2JVD A;  1S72 V;  3OMI B;  1UFI A;  1KKD A;  3F7V C;  4O4L A;  4DR1 B;  3K9A A;  2YXY A;  1MA1 A;  5JVD B;  4LC1 A;  3ZRV A;  3GWO A;  2P4V A;  1YJW V;  1K4D C;  2LGQ A;  4PDR A;  1IBK B;  1WA8 B;  3EXA A;  3QF7 A;  5JH7 A;  3KZI Z;  1NT2 B;  2V4D A;  2YIC A;  4I5S A;  4TQF A;  4Z1M G;  4TV9 A;  4NVP A;  3ZRS A;  3CPW U;  2UU9 O;  5IE9 A;  1F51 A;  4FPP A;  1OCR B;  1Y67 A;  4MVQ A;  5KMG B;  3JD2 A;  4DK0 A;  3OTO B;  1Y66 A;  4J7Z A;  4JI3 B;  1AI5 A;  4JI0 O;  4J10 A;  4WFH A;  1NJI W;  2WLM A;  5B1O A;  1TGO A;  1AR1 B;  2ZIN A;  4LFC O;  5CA0 B;  1Q6U A;  2XAQ A;  1JCH A;  1GM7 A;  4BW9 A;  2UXC B;  2VRZ A;  4LNU A;  5K1P A;  4WBN A;  3CCQ V;  1Q6H A;  2H94 A;  2ZDI A;  4MVU A;  4O4L B;  1ENV A;  1XL6 A;  5E1A C;  1H2S B;  2VQF B;  5KHH A;  2E5L O;  4X62 O;  1MZF A;  1NQT A;  1SZX A;  4DO2 A;  2Z0A A;  4I0X A;  3CD6 V;  5LMN O;  3AG4 B;  4MVM A;  3BVO A;  4IL6 Z;  4DR4 O;  1BT8 A;  1GO3 F;  5LP6 C;  3ZX6 A;  1VQ8 V;  3SPC A;  3ASO C;  3SPG A;  4EFE A;  1F7Y A;  2PI4 A;  2YID A;  2NLJ C;  1MSW D;  3JAL A;  3RYC A;  2W0F C;  4AI8 A;  2VWK A;  3X2Q C;  4I4T B;  2QKC A;  3CC4 V;  4UCU A;  4UCS A;  2B5U A;  1XEQ A;  3UO3 A;  2Q7H A;  2QWR B;  4LF9 B;  2ITC C;  5L3B A;  1TUB A;  3H01 A;  5C8Y A;  3ZHV A;  1N36 B;  5LYJ B;  3G6B A;  2OWO A;  4CC6 A;  4WBN B;  2UUC O;  3HKB B;  5EC1 C;  3UM7 A;  5JJN B;  4O4I A;  2XND G;  5EZY B;  1RSO A;  1WPB A;  2LO1 A;  3T1Y O;  2Q4P A;  3B09 A;  1K97 A;  1P7B A;  2QWO B;  1SC5 B;  3RYI A;  1N34 O;  2EIN C;  3OGI B;  2YI9 A;  2A0L A;  4JI1 B;  4X64 O;  1GTO A;  1TA8 A;  1EZJ A;  4J7J A;  2IJI A;  2Q8V A;  5CMU A;  1HNZ O;  3C3T A;  4LWS B;  3CCR V;  1JA8 A;  5LBQ A;  3E22 A;  3ABU A;  4UCO A;  3ASO B;  5LA6 B;  2B9Z A;  2PYL A;  2WLJ A;  1JR9 A;  3IGA C;  3STL C;  2LFR A;  1H2M A;  2N04 A;  3P32 A;  4GKJ O;  3NXS A;  4DV1 O;  1OJH A;  1AR5 A;  4W4L A;  3E2E A;  3CSX A;  3JAW A;  4HZ3 A;  3CCV V;  3CYO A;  3IC7 A;  2R9A A;  3ABK B;  3AEI A;  1V9P A;  1QLE C;  3L70 H;  3E8G A;  5C8Y B;  2B1G A;  4DR2 O;  1F4M A;  2V7Q G;  3SYP A;  3CS5 A;  4JI3 O;  1AR4 A;  3I56 V;  1IXM A;  3E8F A;  4FLU A;  2YS8 A;  1BCC H;  1RSO B;  1K3E A;  3T4Z A;  1F23 A;  1M90 W;  1Y76 B;  1PPJ H;  2WLI A;  3FAV B;  3N2G A;  3ZJZ A;  2UXC O;  3BEH A;  1Q7Y W;  2Q67 A;  4U3F H;  1A32 A;  1QHT A;  1OHH G;  3CXH F;  1HR0 O;  5EBW C;  2Y0P A;  1NI8 A;  1SA0 B;  3LSS A;  4QGP A;  3E8H A;  5FNV A;  4BR6 A;  3JCU Z;  3CC7 V;  1SZT A;  4OXS A;  1FXV A;  2BSK A;  2QM7 A;  5IDJ A;  3MDS A;  1GM8 A;  3MHS C;  3CC2 V;  3CX5 F;  1M57 C;  3OD4 A;  5EBM C;  1XMO O;  3AG7 A;  4I55 B;  3CE2 A;  1JJ2 U;  2RQ6 A;  1Q6I A;  1MZE A;  5KHG A;  2W6I G;  2QDO A;  4LF6 O;  2JS5 A;  4ZOL B;  3WB1 A;  4LF4 B;  5LGU A;  2QWP B;  4DR7 O;  5FLX N;  1L0L H;  1HNZ B;  4YHH O;  1RPR A;  3K5M A;  4K0K O;  1MSD A;  2WLI B;  1TVK A;  3N2G B;  5B1B C;  4YHH B;  3VOU A;  5LOV A;  1GK9 A;  3JAK B;  2ZXW C;  1XNR O;  1S3J A;  1EFR G;  1XNR B;  4LF8 B;  5IJ0 B;  4LFC B;  3W7W A;  3W7T A;  1L1F A;  3J80 N;  1SA0 A;  4P9O A;  1GRJ A;  2JGU A;  4PA4 A;  3RWR D;  2RNB A;  3G71 V;  1R3L C;  4B3M O;  3SPI A;  3JD4 A;  2M6Y A;  1GN2 A;  3M99 B;  4QE7 A;  3FB8 C;  4AHC A;  1GMG A;  3OMA B;  3CEI A;  1S0V A;  2P5O A;  1BQZ A;  1NH2 D;  1NBM G;  4PJ0 Z;  3M8A A;  1OZ0 A;  5IYC O;  2JEU A;  3JAS B;  3JSN A;  3JAT A;  4JI6 B;  2ITD C;  1EM1 A;  1AJP A;  2BTQ A;  4JV5 B;  3STZ C;  4KXR A;  2CTR A;  4L8J A;  5IYD O;  4J9Y B;  4DXW A;  4FVM A;  1HNX B;  2HVK C;  2ZXW B;  1R73 A;  4MTG A;  1H8E G;  2OT5 A;  1I5Y A;  3OUS A;  1NKD A;  3CP1 A;  3FYI B;  3CCE V;  1YJ9 V;  1I0H A;  2FML A;  5KUK A;  3FB7 C;  2LW7 A;  2ILM A;  3QO5 A;  1QR9 A;  2UXD O;  3DXR B;  4D6T H;  4RO2 A;  4YIP A;  1LR1 A;  3AG3 B;  1SKV A;  4GX5 A;  4LF6 B;  3CRA A;  2QEX V;  1AJQ A;  2XTA A;  2DYR C;  2IBZ H;  3SYA A;  2UXB B;  3AK3 A;  1JPX A;  1MNG A;  2EIK C;  1W0K G;  1BL8 A;  4XDL A;  4DV2 O;  1KUQ A;  3HKC A;  2H8P C;  1NU1 H;  1ZWI C;  2VS0 A;  1N8R W;  1IBM B;  2QM8 A;  4JF3 A;  3CRC A;  1FAF A;  3E83 A;  2AXT Z;  4R8C A;  4N21 A;  3C3S A;  5CN0 A;  1VP7 A;  5IYZ A;  4B3R O;  4DUY O;  5JJE B;  4U3J A;  3W7X A;  1Q81 W;  2EIM B;  5ITZ A;  4JAA A;  2PZS A;  3ABM B;  1KU9 A;  4LFA B;  2B1I A;  1VIB A;  3T1H O;  5LXT B;  5TIS Z;  5EYP B;  4TWK A;  1G4Y B;  4TV8 B;  2HHH B;  3CCJ V;  3DSQ A;  4IGG A;  4PV1 B;  1ORQ C;  4UB6 Z;  4LF7 B;  3S3W A;  2PY5 A;  5DEC A;  3G4S V;  3ZMV A;  1TUB B;  2OIG A;  1IVS A;  4DRX A;  5J2U A;  1F4N A;  1XMQ B;  1P84 F;  2BOB C;  3I5D A;  1VQ9 V;  4X8A A;  1J95 A;  4X62 B;  1XL4 A;  2Y4U A;  3AG4 C;  3M7M X;  5KHJ A;  3OM3 B;  5A2Q N;  1VF6 C;  4J80 A;  3SGI A;  3U11 A;  4OX9 O;  2RJZ A;  4IIJ B;  1K92 A;  5H6R A;  1WP8 A;  4JTC B;  5JWP A;  2FTK A;  5BZB A;  2QWN B;  3RYF A;  4KHP B;  2EIK B;  5CBH A;  3KKY A;  3HKE B;  4Q20 A;  2JGD B;  2OTJ V;  4AQY B;  2Q73 A;  4LR3 A;  4I50 B;  3ETE A;  4DR6 O;  1AI7 A;  4NKG B;  2WLH A;  4YJ3 B;  4CS3 A;  2DW4 A;  1K34 A;  1PP9 H;  3GB7 C;  4DR3 B;  4UXN A;  5K1X A;  3T1C A;  4GLX A;  1GKF A;  1QNM A;  1VQ4 V;  1YZB A;  2OIE A;  4GKK O;  4BIU A;  4GT1 A;  1THZ A;  1AI6 A;  4EFB A;  4JI2 O;  4B3T B;  1UJW B;  3WFV A;  2EIN B;  4O4J B;  3LUT B;  4R7C A;  3THO A;  2GBO A;  4PI0 A;  1XI1 A;  2ZD9 A;  3JD0 A;  3MD0 A;  1N32 O;  3VQY A;  4TT3 G;  2PF4 E;  4E2L A;  4ZIB A;  5IY5 B;  4WFB V;  1M1K W;  4O2A A;  1GN6 A;  4CZZ A;  2V1D A;  3BY6 A;  4MTF A;  1SQQ H;  2A06 H;  4DUY B;  1R3K C;  2RDC A;  4A5U B;  3SPH A;  3G80 A;  4IYH A;  3K58 A;  4X20 B;  2UXD B;  1W59 A;  2F93 B;  2IH1 C;  3B4S A;  4PD4 F;  3HKE A;  3OE7 G;  3BA9 A;  1QR8 A;  4DV1 B;  1YTF B;  3QVN A;  2HLD G;  4YXW G;  1OCZ C;  2XAS A;  3IAY A;  2WSS G;  3K79 A;  5LP6 B;  4FFB A;  1FOU A;  1QLE B;  3ETD A;  4FK5 C;  4CBC A;  4MS2 A;  1OCC C;  4JYC A;  3K3W A;  1FPO A;  4JI8 O;  1HNW O;  2NNU A;  3CME V;  1GN3 A;  2XAH A;  3T2M A;  1AI4 A;  4MT8 A;  1HNW B;  1CPY A;  4JI7 B;  4Z2W A;  2JRI A;  4ZHQ A;  4I55 A;  2EUL A;  1Y6X A;  2P22 C;  4UFZ A;  4GX0 A;  3D36 C;  2VWJ A;  2YEV B;  2EZP A;  2ZM6 O;  3ETG A;  1XRE A;  1J5E O;  3K0D A;  2XT9 A;  2WLN A;  2LFS A;  1ROP A;  4B7K A;  1NTM H;  2RN9 A;  2UXN A;  1TVK B;  1S5H C;  3CHX A;  5LMU B;  3K06 A;  3NR7 A;  1U96 A;  2UUA B;  4U7O A;  4X1K B;  1ZTE A;  4HAM A;  4DV4 O;  4DV5 O;  4QIW F;  5JCO C;  3KG2 A;  2LGW A;  3CJH B;  4QE9 A;  4D7S A;  5DM6 V;  2CGN A;  1IX9 A;  1K5S A;  4GYC B;  4W4K A;  1IBL O;  3OEH G;  3LDE A;  3ABL C;  4F6E A;  1O9G A;  1EZV H;  4K35 A;  5KAF Z;  3CMA V;  4K8X A;  4BAY A;  3B77 A;  2DOS A;  1V54 C;  4UB8 Z;  1QLN A;  3TET A;  4CH3 A;  1QQC A;  2GUZ A;  5GON B;  3TGU H;  2UUA O;  4DV2 B;  1H2G A;  3ZS8 C;  1VQP V;  1I7F A;  2IH3 C;  5B1B B;  2JK5 C;  3RW0 A;  3KCY A;  4DK1 A;  2FYU H;  5KA5 A;  4PHZ A;  1U97 A;  2BTQ B;  1EN5 A;  1N36 O;  3TXQ A;  4JYY A;  1YEW A;  2ZNI A;  4LBE C;  2DN9 A;  5IY5 C;  1FXK C;  3GVM A;  1E1Q G;  3CRQ A;  4OX9 B;  1K7D A;  3VQV A;  5CB4 B;  5H9C A;  1KQS U;  2QKA A;  5IT9 N;  2HR3 A;  1BE3 H;  5IJ9 A;  1KBH A;  4EB6 B;  5E79 Z;  2CTP A;  3H1K H;  3OEE G;  1KB9 F;  4PEL A;  1SRY A;  2W6J G;  1IXB A;  1K5Q A;  1EN4 A;  3SJA C;  4DR2 B;  2FB5 A;  3P3P A;  4JTD B;  3K0G A;  1K4C C;  2P6J A;  3SPJ A;  3Q4H B;  2E76 B;  2CH7 A;  4FM2 A;  2YI8 A;  3H1I H;  1G6U A;  4DW1 A;  1WNS A;  1NR1 A;  2E3C A;  2ZDI C;  2EIJ C;  1E1R G;  4RQE A;  5J9P C;  4CS4 A;  2A79 B;  4B3T O;  4O2B B;  4JI8 B;  5JJJ B;  4FFK A;  3G6E V;  4JZ2 A;  5B1A B;  2HJF C;  1SQX H;  1BMF G;  3QTC A;  1KP3 A;  2NN4 A;  4GCZ A;  4HBN A;  2IJK A;  1WN7 A;  1Q86 W;  2QGN A;  4JTA B;  1FJG O;  2QA4 V;  5DN6 G;  2X6A A;  4NB5 A;  4GKK B;  4GUN A;  2EZO A;  4DV3 B;  3BPZ A;  5KHK A;  1IZ3 A;  4JYA O;  2DMX A;  4GX1 A;  2ADQ B;  3IC9 A;  4ABM A;  2R9I A;  1XOU A;  3UCS C;  4X88 A;  3Q4H A;  3ZRX A;  2QE7 G;  5GTI Z;  5JQG A;  2F4V O;  3O65 A;  5J2T A;  1Q8I A;  3BA8 A;  4XDJ A;  3FB6 C;  4LF5 B;  2F4V B;  2EIM C;  4N23 A;  2F1M A;  4Z1V A;  3ZHU A;  5B1A C;  2P90 A;  1AB3 A;  3I55 V;  2P67 A;  1XMO B;  1B06 A;  3JAL B;  3BFR A;  1URF A;  3JAR A;  4I0X B;  1WP7 A;  2IJJ A;  2BE3 A;  1IJG A;  1XQ8 A;  4I4T A;  4BWA A;  3CRR A;  4UVA A;  2XAJ A;  3ZMU A;  3WU2 Z;  2PTM A;  2ETN A;  3UT5 B;  2K9P A;  1PNL A;  1Y4M A;  2CK3 G;  3SYO A;  3AK1 A;  1YJN V;  1S77 D;  5LGT A;  2M7W A;  3RYC B;  1H38 A;  2W0X A;  2Q68 A;  4HNA B;  4ZI7 A;  1XNQ B;  1GM9 A;  2ZE5 A;  4X1Y A;  2E74 B;  5H5N A;  3N2K A;  2L6L A;  4O4I B;  5EZY A;  2Q5Z A;  2QM4 A;  2OCC B;  3ZN1 A;  2A3Q A;  1OCO B;  2Y69 B;  1AP6 A;  4BW5 A;  3LSQ A;  4O4J A;  2DYS C;  4QPJ A;  3W7S A;  4MTX A;  3OFN G;  3SJB C;  3SDL A;  3H1H H;  1NZ6 A;  3AG1 C;  5JQG B;  3HKD B;  4JI4 O;  4J9Z B;  2DE0 X;  4KHP O;  2EIL C;  3ML0 A;  4WFF A;  4FZ0 A;  3K08 A;  3RYI B;  3APO A;  4JAV A;  2Q0A A;  2R70 A;  4PA6 A;  2CAZ C;  2YUA A;  4IT5 A;  4X20 A;  4CC5 A;  3WB2 A;  2QTS A;  3UT5 A;  3U10 A;  3WG7 B;  2LW1 A;  2PYJ A;  2OCH A;  1K73 W;  2UUB B;  1YF2 A;  1VQL V;  2IM9 A;  2G38 A;  5B5E Z; 
#chains in the Genus database with same CATH homology
 2QKA A;  1JA8 A;  3KKY A;  3OT7 A;  1B06 A;  3EVK A;  3BFR A;  1N0N A;  2P4K A;  1AVM A;  1IDS A;  1IXB A;  1EN4 A;  1JR9 A;  4YIP A;  1AP5 A;  1VEW A;  1MSD A;  2RCV A;  1AR5 A;  1D5N A;  1SZX A;  1XRE A;  1P7G A;  3AK3 A;  1MNG A;  1MMM A;  1I08 A;  1QNM A;  3AK1 A;  1KKC A;  1BT8 A;  1ZSP A;  1XUQ A;  4E4E A;  1PL4 A;  2CDY A;  3C3S A;  1AR4 A;  1EN6 A;  1VAR A;  1MA1 A;  1ZTE A;  2QKC A;  1PM9 A;  2ADP A;  2GDS A;  1IX9 A;  4FFK A;  3LSU A;  1AP6 A;  4JZ2 A;  1GN2 A;  1N0J A;  4F6E A;  1LUV A;  3K9S A;  4X9Q A;  2AW9 A;  1WB7 A;  3DC5 A;  3CEI A;  1GN6 A;  5A9G A;  1ZLZ A;  1ZUQ A;  1EM1 A;  1BS3 A;  3KDR A;  1BSM A;  2CE4 A;  3AK2 A;  4C7U A;  4BR6 A;  1XDC A;  4GUN A;  5AG2 A;  3QVN A;  1Y67 A;  3TJT A;  1XIL A;  4JZG A;  3MDS A;  1EN5 A;  1GN4 A;  2ADQ B;  3IC9 A;  1LUW A;  4YIO A;  4JYY A;  1WB8 A;  1I0H A;  1GN3 A;  3C3T A;  3DC6 A;  3RN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...