4X9QA

Mnsod-3 room temperature structure
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
194
Chain Sequence
KHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn] 2, mitochondrial
publication title The structure of the Caenorhabditis elegans manganese superoxide dismutase MnSOD-3-azide complex.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 74
structure length 194
sequence length 194
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4x9qA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4x9qA02
1AR4A 1LUWA 4JYYA 1AP6A 3AK3A 1IDSA 1I08A 2ADQB 1XUQA 3DC5A 1PL4A 3RN4A 3QVNA 1BS3A 4FFKA 3TJTA 1MA1A 1AR5A 2P4KA 2CE4A 4YIPA 1AVMA 4YIOA 1IXBA 1Y67A 3DC6A 1IX9A 2ADPA 3AK2A 1LUVA 3EVKA 4F6EA 1B06A 3KKYA 5A9GA 5AG2A 1N0NA 1KKCA 1MNGA 4C7UA 2QKCA 1D5NA 1EN5A 1ZUQA 3C3TA 4JZGA 3AK1A 1QNMA 1N0JA 1I0HA 1GN3A 1EN6A 1SZXA 2CDYA 3C3SA 2QKAA 4E4EA 3K9SA 3OT7A 1WB8A 2RCVA 1MSDA 1EN4A 1ZSPA 4GUNA 2AW9A 2GDSA 1AP5A 3IC9A 1ZTEA 1EM1A 1JA8A 1MMMA 1ZLZA 1XDCA 3CEIA 1VARA 1BT8A 1P7GA 3BFRA 3MDSA 4JZ2A 1GN4A 1VEWA 1BSMA 1XILA 4BR6A 1GN2A 1XREA 1PM9A 1JR9A 3LSUA 4X9QA 1GN6A 1WB7A
chains in the Genus database with same CATH superfamily
4FLUA 1RPOA 3G80A 1TUBA 1WPXA 1XMQO 2UU9O 3D36C 5IJ0B 1K9MW 1QU7A 4CZZA 5L3GA 3ZCCA 2VQFO 1LNQA 3WG7C 2AGAA 4GX2A 2IJJA 4QPKA 3OTOO 3DXRB 2P4KA 4UVCA 2VS0A 1AVMA 2B5UA 1K4CC 3JATB 2H3OA 1SQPH 1PNMA 5KA5A 2CUGA 4H33A 3VQWA 4FLZA 1CXZB 2ZM6O 4J9ZB 4EFBA 2X6AA 3A0RA 2MW2B 4LCUC 4PA3A 5CB4B 5KHGA 4MTFA 4QIWF 5LOVA 4MVMA 1IVSA 3I5DA 3OEEG 4AHCA 2G38A 4JI4B 4PD4F 4MTXA 1P84F 2QKAA 3UT5A 3LDEA 4WFGA 1R73A 3ML0A 1YTFD 4B3MO 2CTPA 1YTFB 2AW9A 5EC2C 1SA0B 4D6TH 1YITV 1G8MA 1MMMA 4NVPA 4KFMA 3E8FA 1P7GA 2WLLA 1VQ8V 5LYJA 1V55C 2IJHA 5B1AC 4TQDA 2UXBO 1S5JA 2ZKOA 3APOA 4NXNO 2HVJC 1XMOB 2DJVA 4LF9O 4FM2A 3AK3A 5ITZA 2QM7A 4TV8A 3M99B 4KL1A 4Q6GA 2QJ1A 4FIPC 1OV9A 2P67A 4WFBV 4JI8B 1F51A 1WPBA 4O4HB 1QVGU 3E2EA 4NXMO 4YIOA 5GW7A 2YEVB 4GT1A 1ROPA 5LMUO 3JAWA 1R6NA 4TOIA 3CXHF 5CBGA 4FZ0A 3LDCA 1B06A 3SJQC 5B3SC 2BOCC 2Q5ZA 3SPIA 5J9PC 3OR6C 5D5QA 1N34B 1SQVH 2OWOA 4FZ1A 1W0JG 1HNXB 2HJDA 2EINB 4UCOA 2D3OW 4B3SB 4DR6O 4DR1B 4LFBO 4IL6Z 1K34A 1QLEB 1QNMA 3CWBH 3Q4HB 1ZX3A 2IJIA 1GH6A 4X1KB 3RVYA 5CA3A 2AZ0A 4NYKA 3ETDA 1EN6A 2Q73A 4CC6A 5JQGA 3SPCA 4JYBA 2Q7GA 1EFRG 1O9GA 3RYIB 1Q3EA 1YSCA 4I0XA 4E2LA 2A3QA 1HNWO 3ABKB 2QTOA 3AG4C 1JJ2U 2UUCB 1YDXA 3BPZA 1HWYA 4W4LA 3K04A 1GM7A 5KA6A 2QWRB 1JA8A 2DN9A 2YXHA 2OCHA 4QNHB 1OCCC 3KCYA 5IYZB 1K4DC 3X2QC 3ZEDA 3F5WC 1IXMA 1N33B 4Z1VA 4U7OA 1YVWA 1GN6A 5KUKA 1VF5B 1M57B 3IJ4A 3ZRSA 3FAVB 2CAZC 1XI1A 3ASOC 1M1KW 2ZDIA 1J5EB 4FFBA 5BZBA 3KCXA 1UPGA 1H8EG 4K8XA 4GKKB 4UCRA 1CEZA 4XBFA 2OIEA 3CXCU 4GKJO 4UV8A 3LNNA 1JPXA 1K3EA 4YY3O 4TT3G 4DV7B 4DV2O 3AG3C 1FXKB 2B1GA 1VP7A 3SPGA 3STZC 4LFCO 5IJ0A 3PJSK 5EYPB 1X59A 2Y4TA 2Z0AA 4P2ZA 4FLYA 1R3LC 3RVZA 1Q7YW 4WFHA 5DN6G 4NKGB 2DYRB 4DR5O 1YJNV 2ODMA 2WAMA 2VQFB 3DXRA 3ABLC 1H38A 1EBOA 1QLNA 3JATA 2OTJV 4XDKA 4JI5O 1GN3A 3WU2Z 4IHJB 1GM8A 4LR3A 3CRMA 5H5NA 4NTYA 1ZSPA 1OCZC 2Y0PA 4IYIA 4GX5A 3SR2C 2VWJA 1MABG 1XHXA 1Q5OA 1EM1A 4MS2A 2Y69B 4TSFG 1TAEA 4DRXB 4ZKIA 3JAMN 1JX9A 4JI6B 5JH7B 4I50B 2WA4A 4KUMA 3R66A 4DR7B 3SDLA 1Y6XA 1R3KC 1GN2A 1OCOC 3P30A 1SA0A 1N32O 4UCTA 1WB7A 4UCUA 4MW3A 4AILC 4IYHA 5LP6B 2GV9A 4JYYA 1S5HC 2PI4A 3FD9A 2FMLA 1PV0A 4X66O 2DE0X 4P30A 2QWQB 3E8HA 1N36O 2NLJC 4X64B 3DSQA 3OGIB 4DR4O 2PTMA 3RN4A 5B5EZ 4DV6B 2W0FC 2YUAA 4NR1A 3RYHA 1O9HA 4JAUA 2L35A 4GX0A 3FYEB 4LF9B 4CBCA 4IGGA 4P9OA 5AG2A 2DQ3A 2WLNA 5FNVB 2UUAO 1FOUA 4UCSA 3T4ZA 1DF4A 4O4HA 3H1JH 2KG7B 2BSKB 4UCVA 4BIUA 3ASNC 2YEVA 4WBNB 1P4RA 3ABMB 5FL7G 3TETA 2YICA 4HNAB 1YEWA 2GTSA 1R3IC 5EBLC 2Q7EA 3G6BA 3AG2B 2D2CB 3S3XA 3ZHUA 3JCZA 2ZT9B 1XEQA 3Q4HA 3H1HH 4DR6B 2HLDG 3SGIA 5HFMA 1WNSA 4CC5A 3FX7A 2ARHA 1J95A 1NTZH 1XDCA 2OCCC 4B08A 5BXZA 2DYSB 3RYIA 4LF5B 3OFNG 2XAJA 1FPOA 1HDJA 2VRZA 1KMIZ 4UB8Z 1MZEA 1MZFA 3FB6C 2PGGA 3ZMSA 4O2AB 1HNWB 3CHXA 4GX1A 4LF4O 4LH7A 2OTLV 1RM1B 1SQBH 4DV3O 2OT5A 4UXNA 3W7SA 1WJZA 5IYZA 4K0KB 1NQTA 2Q0AA 2XAQA 5J2TB 1R3JC 2LGWA 1DF5A 1US6A 2FL4A 4U3FH 1YF2A 1PP9H 2W0XA 4TUYB 5ITZB 2A06H 1BQZA 4KP4A 2X6CA 5KHKA 3FAVA 1M56B 1NH2B 4I9WA 1QR8A 2F1MA 4ASUG 2WSSG 4UFZA 2LJ2A 3EVKA 3JD1A 5KHJA 2V4DA 2EIMB 4DUYB 3JAWB 2Z5UA 3P3PA 1FJGB 2IU3A 5LMNO 4XDLA 1FFXB 3QO7A 3K57A 2F95B 3U0ZA 4KHPB 1FS0G 2EJRA 3HR0A 4LF8B 1ORQC 1V54C 1HNZB 2DMXA 4JTCB 5EYPA 4FJCC 2DWDC 2X6BA 2JJ1G 2E76B 1EZJA 4O2BB 4LFCB 3ZRXA 2R70A 2M6YA 5EIBD 2ZDIC 3OT7A 1WB8A 3T2MA 2JGUA 3L73H 1MSDA 3B77A 2ZIOA 3P32A 4PHZA 4DR3B 3CCUV 2UUBB 4UB6Z 4TQFA 4DR2O 2QGNA 3CX5F 2Y48A 5CN0A 1ZWIC 1OJHA 2XHBA 4B3RO 4IHJA 2UXCO 2E5LO 4PELA 3EFFK 3CCLV 1WA8A 4X62O 1Q6UA 2JVDA 1SQGA 3OR7C 4OPHA 1VQPV 1KP3A 3ZHQA 2EZOA 4AI8A 1G6UA 1JR9A 5HFLA 1AR4A 1AJPA 3BVOA 5L3CA 4DRXA 4MTOA 5FPOA 4P9PA 2QM8A 3SJBC 2HR3A 5JH7A 3ABUA 4I50A 3JD0A 4NB5A 1KBHA 4NTWA 2ADQB 1Q6HA 3RYCA 5DM6V 3CCMV 5LP6A 2EJ7A 4NTXA 1Y67A 1SF9A 2O57A 4J42A 3ZRVA 4B3TO 5EC1C 2Y0IA 3RBZA 1MSWD 2VQEO 3CPWU 5A9GA 1N0NA 4X66B 2QKCA 1BL8A 3C3TA 1Z5WA 2JS3A 1FFTB 4I4TB 3HKDA 4J7ZA 1K92A 1T5EA 5IJ9B 2UXDO 2JJ2G 5BY1A 3RYFB 3CYOA 2GUZB 3SYQA 4MVOA 1MG1A 2ZE7A 3ZBHA 1Q82W 4WF9V 3E22B 1B04A 4DUZO 4DV0O 4JYAB 2NR5A 1K5QA 5FNVA 3KG2A 4JI7O 2JEXA 3T1CA 2HG5C 4LFAB 2KG7A 3FB5C 2BSKA 1G4YB 4WBNA 1ZTEA 3CD6V 2QWPB 5LHHA 4CH5A 4BIOA 3E35A 4HNAA 3T1HO 5KAFZ 1L1FA 1L8DA 4ICGA 4RUEA 1I94O 4LBEC 4D7SA 1NU1H 5CA1B 4IT5A 5LHGA 4HYOA 1AI6A 2FYUH 2R9RB 2XOKG 2QM4A 2YIDA 4B7KA 4BAYA 2YIAA 1XNRO 3UKMA 1VQ7V 3WG7B 4O2AA 3K0GA 3K59A 2YSUB 1IBMO 3B8MA 2EINC 2H8PC 4DV4O 1IBLB 1N8RW 3OAAG 1GO3F 5KMGB 4PDRA 4YIPA 4JI0B 4X65O 3KZIZ 1VQLV 1QR9A 2ZXWC 5J2TA 3APQA 1SC5B 3RYHB 1PL0A 1Z5VA 4DV5O 4RQEA 4TUYA 3OTFA 1GM9A 2HJFC 1RFYA 3W7TA 2QDOA 3DTUB 3LSQA 1JNBA 4N23A 3ABKC 2ZNIA 4H37A 2KSDA 1I0HA 2ZINA 1GMGA 4MSWC 1Y66A 3ZMTA 3FFQA 3C3SA 1FFXA 4K3AA 1GTOA 2RCVA 3TCUA 2JK5C 4DYLA 5LMNB 1XNQO 5L3DA 5IYDO 4JI2B 1BHBA 1M57C 2HHHO 4O2BA 1HR0B 1PNLA 1URFA 1Z2GA 3OMIB 3BCCH 4YJ2B 3FKSG 4RQFA 3CCSV 1CPYA 2X7RB 2Y4UA 1YJ9V 5JJNB 3RWRD 1SESA 4BR6A 1IURA 5IWAO 1XREA 1N4CA 1SZTA 1AI4A 4PA6A 2KQXA 2QWOB 2ZE5A 2R72A 4Z1MG 1JJOA 1FXKC 2AXTZ 3R65A 2E5LB 3A0HZ 3LDDA 1L0NH 4JV5O 2F93B 3AEIA 3QTCA 5GTIZ 3ETQA 1S0VA 2P6JA 1OCRB 3RGBA 2F4VO 2ZR2A 1AILA 1H2MA 5BR8O 4DXWA 3VQVA 1YI2V 4PI2A 4L87A 3CRAA 1LR1A 3W7XA 1SS3A 3BRCA 5JJJB 4U3JB 1MNGA 2Z3YA 4JI1O 1EN5A 4X88A 2DWEC 5H9CA 3VOUA 3JASB 3ZS8C 5IT9N 1IBKO 3BY6A 5FLXN 1NI8A 4MT8A 1VF7A 2IM9A 1FYJA 5JCOC 1XMQB 2EIJC 2UU9B 3JSLA 4PDLA 4I4TA 4MVSA 2YI9A 1AJQA 1R1BA 5IJ9A 1D5AA 3RYFA 2GUZA 3GVMA 1Q8IA 4WCEV 2LFRA 2UXDB 3OTOB 5L3FA 2E3CA 5LBQA 3E22A 5LP6C 4LF7O 1BT8A 1S3JA 2CGOA 4BWAA 2L6LA 5H2FZ 3CP1A 1BZKA 1WA8B 2ZM6B 3UO3A 3CMAV 4FM1A 1D2DA 2EIKB 1YIJV 4X9QA 3MHHC 3KDRA 4XDJA 2RJZA 4PDVA 3CCEV 5B1BB 1KYOF 2IU0A 4MW8A 5C8YB 2YIBA 4JI3O 1NVPB 4PA9A 5LHIA 2RNBA 3K08A 3AG7A 5K1PA 2P4VA 4B3MB 5CA1A 5CBHA 3UM7A 3OUSA 2GHYA 1I7FA 2CTQA 5EK0A 1TVKB 3F7VC 4CH3A 4FFKA 4LF6O 1AR5A 3K03A 4GCZA 4J41A 3RYCB 2IBZH 3D36A 3I56V 1M9NA 3K79A 2H94A 4X20B 3H1LH 2QE7G 3CCRV 4ZOLB 1QBZA 3ABMC 1XNRB 4EFEA 2IH3C 2XTAA 3ZMVA 4EKWA 3CS5A 1XHZA 4LWSB 1R6KA 4R8CA 1ZAUA 5KMGA 5LGUA 1KB9F 2UXBB 3HKDB 1AJNA 3JAKB 3U10A 4GLXA 3QO8A 4X89A 5LL6Y 3D3QA 1SZXA 3CRRA 4NXNB 4X65B 2LW1A 2DYSC 1OCZB 1M5IA 3ZRWB 4J7JA 3EHBB 5EBMC 1RP3B 4L8JA 1V9PA 1M93A 2LP7A 5D5PA 2GDSA 4WFFA 4CH6A 3IC9A 3MHSC 3OEHG 3CEIA 1RM1C 4NXMB 1VIBA 4N21A 3HB3B 2QR4A 1H8HG 1GN4A 2K1EA 3B09A 3HKBB 5LMUB 1AI7A 2K9PA 4ZHQB 1BHAA 3BEHA 1RSOB 1Q43A 2DOSA 1H2SB 4I55B 2ZQMA 2M7WA 3LSUA 4ZIBA 2CH7B 4LFBB 3WB0A 5L3EA 4JASA 4I9QA 3L74H 3K06A 1SKVA 4FLWA 2E74B 4YJ2A 1K97A 2CK3G 4PDMA 4X1YB 2Q68A 2ZE8A 4O4JB 5KLVH 4JAVA 4F6RB 1K5SA 1XOUA 3QVNA 5IDJA 4CH4A 4BW9A 2LFSA 1HP8A 2XASA 4MTGA 2EILC 2YXLA 1LUVA 1YCIA 4F6EA 1JMKC 2F43G 2GSMB 4TWKA 4JTAB 3ZHTA 1NH2D 4FVMA 1TUEB 1KQSU 3CB2A 3K5OA 3K3WA 3STLC 3AK1A 5EIBC 1XMOO 1GRJA 2ITDC 1NKDA 4X1IB 4O4IB 3B2EE 2WLJA 2XUMA 3K9SA 1VF6A 4U3JA 5H6RA 4YHHO 3JD4A 4OGQB 3NXSA 2ATKC 4JI8O 3IGAC 3JASA 1DTOA 2DW4A 1DGSA 2QKSA 4GKJB 5IY5B 4YY3B 4DV2B 3ZX6A 1ZL8B 2PUSA 3JD3A 2JDIG 1B6QA 3H01A 4G2KA 1N34O 2PZSA 4JAAA 3DGEA 3ZIAG 1HNXO 3A2FA 2BTOA 1BSMA 3K0DA 4DR1O 2JS5A 3AG1B 1FAFA 1MOFA 2V1DA 1KD1W 1PM9A 4QE9A 2BTQB 4DR5B 1U97A 3OUFA 2XNDG 1BQ0A 1SQXH 3TGUH 5B66Z 2IH1C 3ZMUA 1JFFB 3F5TA 3VBBA 4JI5B 1IDSA 4LF7B 1PD3A 1KP2A 5FPRA 3OMAB 4R50A 3B40A 5LXTB 5L3BA 3H1KH 4D7TA 3ZHVA 3J81N 1BS3A 2OYQA 1NR7A 5C8YA 4MVQA 2FTKA 3L9DA 4K35A 4LNUB 3DC6A 1NR1A 2LW7A 2YC0A 4PA4A 3CCQV 3SYOA 4MVZA 2QSAA 4QJFB 1GK9A 2E75B 3FB7C 1N33O 3LNMB 3MAQA 1I5XA 4QE7A 1KKCA 1JOYA 3SPJA 1TVKA 1U96A 1I5YA 1VQ6V 3N2GB 4I5SA 4OX9O 1Y74B 2WLKA 1N32B 4X20A 2P5OA 5LGNA 2JRIA 2W6IG 3HKEB 2CDYA 5CBFA 4ZOLA 4GKKO 4RO2A 3P3NA 2Q67A 4DV7O 4LWSA 3T4DA 1PPJH 2EX3A 2VWKA 1N36B 2R9IA 4H13B 4H44B 4DR4B 3JAKA 5E1AC 1ZLZA 2RQ6A 3W7WA 1KU9A 2UXNA 1RPRA 1W59A 2CGNA 3ZRWA 4JZ2A 4UUJC 3BHPA 3JCUZ 3LSSA 4DK1A 2AHZA 3GWOA 1AI5A 3L75H 2P90A 2F66C 2CTWA 2UUAB 1H2KA 3RT3C 1CP9A 2LQTA 2ILMA 3OW2U 2PY5A 5H6QA 3JYCA 2YIBD 3N27A 5KX5B 5JJEB 3HKBA 2HFEC 4ZHQA 2BOBC 1RSOA 4G28B 2LGQA 4I55A 3G67A 2F23A 4CS4A 2CH7A 4JYCA 4LC1A 1KECA 3T1YO 4ZI7B 4JI6O 1IX9A 2ADPA 3SYPA 4BIZA 3A0BZ 4X1YA 4O4LB 2C2AA 4DR7O 3SPHA 3PN1A 4O4JA 3KKYA 1GKFA 1SETA 4F6RA 5IYBO 1D5NA 1SQFA 1QQCA 1ZUQA 4JZGA 1VQNV 3WB1A 3S3WA 2N04A 1W0KG 1BMFG 2XAHA 4LF4B 1WLEA 1QLEC 4FM0A 4QPJA 4J9YB 4DV3B 3TK1A 2WLIB 1VQ4V 1H5WA 4X64O 2IW5A 4FPPA 1XQ8A 1XBLA 3W7UA 1Y76B 4DV6O 5EZYB 3VQXA 4LP8A 3TXSA 3K5LA 1R6TA 4J10A 4X1IA 4O4IA 4EEQA 2Q8VA 5E79Z 4KXRA 5LA6B 2JEUA 3ABTA 1WAZA 4CS2A 3BFRA 3OD4A 3QO5A 4GZRB 4ZBMA 2EZPA 3BABA 1F7YA 4QGPA 1THZA 1XILA 2JGDB 2HP8A 3GB7C 4YHHB 3OMNB 2A7WA 2XT9A 4UVAA 3M8AA 1OCRC 2GBOA 1ZL8A 1W2BU 2V7QG 3L71H 1AP6A 3ZJZA 5J2UA 1G1XB 2Q4PA 2JIZG 3JARB 4FK5C 1V55B 4CS3A 3U11A 3CCJV 3F7YC 3J80N 3IFXA 5B1AB 3E86A 1Q90D 2BTQA 3ZHRA 1VF6C 1S76D 1Y4MA 1FD9A 3HKCB 4DR2B 2P7TC 2ZXWB 1UJWB 4LF5O 4DV1O 1AB3A 1IXBA 1NBMG 1JFFA 3E83A 3ZN1A 1HW7A 4B3RB 1IZ3A 2UXCB 2EULA 5LXTA 3H1IH 4IIJB 4ABMA 2MK3A 4X62B 1B3QA 1H2NA 1WP8A 4Q20A 3K5NA 1DK1A 3B8NA 2DYRC 4LNUA 2YI8A 3G6EV 4K0KO 1EZVH 1H2LA 3CSXA 2FB5A 1XL6A 5B3SB 1UFIA 2LO1A 4BW5A 5A2QN 4DW1A 2IJKA 5JWPA 3JSNA 1A32A 2QWNB 4FLTA 3IC7A 3N2GA 1YZBA 2Q0OC 1Y74A 4AQYO 2EIKC 3L72H 4OX9B 3HKEA 5DECA 2BE3A 4DK0A 4DUYO 1QHTA 5B1BC 1FJGO 1Q81W 2ZCEA 3OM3B 4EB6B 2Y69C 4B3TB 3AG4B 2VQEB 3M7MX 4KHPO 3CJHB 4LF8O 1SRYA 1HNZO 1WN7A 1VQ9V 4YJ3B 3SJAC 2WLMA 2WA3A 3B4SA 4G27B 1KC8W 3O65A 1OCCB 5DEDA 3X2QB 4FLXA 4U7NA 1AROP 3THOA 2AHYA 4W4KA 5KUMA 3BA8A 1BGYH 4J80A 4DR3O 2CTRA 2UUBO 4DUZB 4DV0B 1S77D 2ETNA 4JI7B 5CA0B 1E79G 1TGOA 3DC5A 1PL4A 3ASOB 2QA4V 3UCSC 4HAMA 3C90A 5KX5A 1K8AW 2CE4A 1E1RG 1NVPD 1KKDA 1COWG 4TV9B 1M90W 1YJWV 2B1IA 3K9AA 5GONB 4K8ZA 1PKXA 2FKXA 1K73W 3QG5A 3JALB 3ZHSA 5CB4A 3T1HB 4B7EA 5JVDB 5KHIA 1F4MA 4I7ZB 3AG3B 3NR7A 1I94B 3JD2A 3SYCA 3G71V 1N0JA 1JQ0A 4UV9A 4ZI7A 1JCHA 2AZ2A 3T1YB 3EXAA 4O4LA 2A0LA 3QF7A 4WFEA 5GTHZ 2EIJB 4J7KA 3CRQA 2RN9A 3MD0A 3A8TA 2A79B 3K58A 3HPLC 3ABLB 2B9ZA 2UXXA 5K1XA 5BMVB 1QCEA 3N2KB 4LH6A 3AG2C 4MVUA 5B1OA 3CC2V 1IBMB 4DV4B 4OPAA 3GWKC 3CRCA 4RUFA 2WLIA 2YXYA 1TUBB 2HVKC 1SQQH 3J7AU 2YDEA 4J11A 4PI0A 2NN4A 5B1NA 1IJGA 2ITCC 4DV5B 1Y76A 1S72V 2WPDG 5EZYA 3OE7G 1DLBA 2NNUA 3ETEA 5LA6A 1P49A 1LUWA 2EBOA 3K5MA 4JYAO 4YXWG 4PV1B 3ETGA 2HEPA 3WFVA 3ICXA 5IE9A 3TXQA 1TA8A 3CMEV 4LFAO 1I08A 1NTKH 2JGDA 2Q69A 2QEXV 3ZMZA 3FYIB 1OCOB 5LGTA 3CE2A 3TJTA 1NT2B 5KHHA 2PYJA 4H0LB 1XNQB 2R9AA 3E8BA 1M56C 4JI4O 5LOVB 1E1QG 2A9HA 1FXVA 3JARA 1NZ6A 2QTSA 1X4TA 2HHHB 3QNEA 4DO2A 3UT5B 1YHQV 1VQKV 3D8CA 2EIMC 5CMUA 4FMTA 4C7UA 2P06A 3HKCA 4Z2WA 4X1KA 2PI5A 5IWAB 1SERA 4HBNA 2PF4E 2ZE6A 4JGSA 1P7BA 4FLVA 4OXSA 4RWUA 1QVFU 5IY5C 4DV1B 2X0LA 4IIJA 4E4EA 1VMGA 2Q7HA 2ZNJA 1FKAO 4JV5B 3OGCC 2WLLB 1EN4A 2ZR3A 1H2GA 5LYJB 1VQOV 1IBLO 1K33A 4JPRA 3IAYA 3ASNB 3AG1C 4JI0O 5IYCO 2F4VB 2XAFA 3RFRA 5BR8B 5EBWC 3UO2A 2YS8A 1JVMA 2DQ0A 1VQ5V 1FXHA 3G4SV 4TV8B 4A5UB 3BA9A 2ZIMA 1ENVA 1M4UA 2ZD9A 4JI1B 2OIGA 2OCCB 4AQYB 3LUTB 1L0LH 3CC7V 1Q86W 1IBKB 4EB6A 3CCVV 3D3IA 2HKOA 2N74A 2Q9LA 5J2UB 3I55V 3SJCC 4RAIA 1XUQA 3CJHA 4B3SO 1NTMH 4YJ3A 1FXKA 3BAAA 1PNKA 4JI2O 4PJ0Z 4WFAV 1MA1A 2GTAA 2EILB 1HR0O 4F4LA 3AK2A 3ZN0A 1Q6IA 2XAGA 3E89A 5JQGB 1KUQA 4UVBA 2KKWA 3FB8C 1NJIW 3E8GA 4GYCB 1VQMV 5CA0A 4I0XB 2UUCO 4HZ3A 1F4NA 2PYLA 2RDCA 1WP7A 1BE3H 2Q6AA 3O9OA 5C93A 3UQ8A 1S5LZ 1AR1B 2WWWA 4TV9A 1K7DA 2BCCH 2WLHA 4JTDB 5GONA 2RMKB 3RW0A 3SYAA 3JALA 1NS1A 2KB1A 1F23A 5KAIZ 1OZ0A 4JI3B 4R7CA 3H9VA 5JVDA 4GUNA 5F2VO 1V54B 1YXBA 4MVRA 4DW0A 1AP5A 4PA7A 3L70H 3VQYA 1J5EO 5JCOA 4LF6B 2W6JG 1VARA 5TISZ 1BCCH 1XL4A 3MDSA 4R6ZA 3CC4V 4FFBB 1OHHG 1VEWA 1GAXA 3WB2A 4X8AA 4JF3A 5BMVA 2N05A 3N2KA 2P22C
chains in the Genus database with same CATH topology
3KDRA 1AR4A 1LUWA 4JYYA 1AP6A 3AK3A 1IDSA 1I08A 2ADQB 1XUQA 3DC5A 1PL4A 3RN4A 3QVNA 1BS3A 4FFKA 3TJTA 1MA1A 1AR5A 2P4KA 2CE4A 4YIPA 1AVMA 4YIOA 1IXBA 1Y67A 3DC6A 1IX9A 2ADPA 3AK2A 1LUVA 3EVKA 4F6EA 1B06A 3KKYA 5A9GA 5AG2A 1N0NA 1KKCA 1MNGA 4C7UA 2QKCA 1D5NA 1EN5A 1ZUQA 3C3TA 4JZGA 3AK1A 1QNMA 1N0JA 1I0HA 1GN3A 1EN6A 1SZXA 2CDYA 3C3SA 2QKAA 4E4EA 3K9SA 3OT7A 1WB8A 2RCVA 1MSDA 1EN4A 1ZSPA 4GUNA 2AW9A 2GDSA 1AP5A 3IC9A 1ZTEA 1EM1A 1JA8A 1MMMA 1ZLZA 1XDCA 3CEIA 1VARA 1BT8A 1P7GA 3BFRA 3MDSA 4JZ2A 1GN4A 1VEWA 1BSMA 1XILA 4BR6A 1GN2A 1XREA 1PM9A 1JR9A 3LSUA 4X9QA 1GN6A 1WB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR4 A;  1LUW A;  4JYY A;  1AP6 A;  3AK3 A;  1IDS A;  1I08 A;  2ADQ B;  1XUQ A;  3DC5 A;  1PL4 A;  3RN4 A;  3QVN A;  1BS3 A;  4FFK A;  3TJT A;  1MA1 A;  1AR5 A;  2P4K A;  2CE4 A;  4YIP A;  1AVM A;  4YIO A;  1IXB A;  1Y67 A;  3DC6 A;  1IX9 A;  2ADP A;  3AK2 A;  1LUV A;  3EVK A;  4F6E A;  1B06 A;  3KKY A;  5A9G A;  5AG2 A;  1N0N A;  1KKC A;  1MNG A;  4C7U A;  2QKC A;  1D5N A;  1EN5 A;  1ZUQ A;  3C3T A;  4JZG A;  3AK1 A;  1QNM A;  1N0J A;  1I0H A;  1GN3 A;  1EN6 A;  1SZX A;  2CDY A;  3C3S A;  2QKA A;  4E4E A;  3K9S A;  3OT7 A;  1WB8 A;  2RCV A;  1MSD A;  1EN4 A;  1ZSP A;  4GUN A;  2AW9 A;  2GDS A;  1AP5 A;  3IC9 A;  1ZTE A;  1EM1 A;  1JA8 A;  1MMM A;  1ZLZ A;  1XDC A;  3CEI A;  1VAR A;  1BT8 A;  1P7G A;  3BFR A;  3MDS A;  4JZ2 A;  1GN4 A;  1VEW A;  1BSM A;  1XIL A;  4BR6 A;  1GN2 A;  1XRE A;  1PM9 A;  1JR9 A;  3LSU A;  4X9Q A;  1GN6 A;  1WB7 A; 
#chains in the Genus database with same CATH topology
 4FLU A;  1RPO A;  3G80 A;  1TUB A;  1WPX A;  1XMQ O;  2UU9 O;  3D36 C;  5IJ0 B;  1K9M W;  1QU7 A;  4CZZ A;  5L3G A;  3ZCC A;  2VQF O;  1LNQ A;  3WG7 C;  2AGA A;  4GX2 A;  2IJJ A;  4QPK A;  3OTO O;  3DXR B;  2P4K A;  4UVC A;  2VS0 A;  1AVM A;  2B5U A;  1K4C C;  3JAT B;  2H3O A;  1SQP H;  1PNM A;  5KA5 A;  2CUG A;  4H33 A;  3VQW A;  4FLZ A;  1CXZ B;  2ZM6 O;  4J9Z B;  4EFB A;  2X6A A;  3A0R A;  2MW2 B;  4LCU C;  4PA3 A;  5CB4 B;  5KHG A;  4MTF A;  4QIW F;  5LOV A;  4MVM A;  1IVS A;  3I5D A;  3OEE G;  4AHC A;  2G38 A;  4JI4 B;  4PD4 F;  4MTX A;  1P84 F;  2QKA A;  3UT5 A;  3LDE A;  4WFG A;  1R73 A;  3ML0 A;  1YTF D;  4B3M O;  2CTP A;  1YTF B;  2AW9 A;  5EC2 C;  1SA0 B;  4D6T H;  1YIT V;  1G8M A;  1MMM A;  4NVP A;  4KFM A;  3E8F A;  1P7G A;  2WLL A;  1VQ8 V;  5LYJ A;  1V55 C;  2IJH A;  5B1A C;  4TQD A;  2UXB O;  1S5J A;  2ZKO A;  3APO A;  4NXN O;  2HVJ C;  1XMO B;  2DJV A;  4LF9 O;  4FM2 A;  3AK3 A;  5ITZ A;  2QM7 A;  4TV8 A;  3M99 B;  4KL1 A;  4Q6G A;  2QJ1 A;  4FIP C;  1OV9 A;  2P67 A;  4WFB V;  4JI8 B;  1F51 A;  1WPB A;  4O4H B;  1QVG U;  3E2E A;  4NXM O;  4YIO A;  5GW7 A;  2YEV B;  4GT1 A;  1ROP A;  5LMU O;  3JAW A;  1R6N A;  4TOI A;  3CXH F;  5CBG A;  4FZ0 A;  3LDC A;  1B06 A;  3SJQ C;  5B3S C;  2BOC C;  2Q5Z A;  3SPI A;  5J9P C;  3OR6 C;  5D5Q A;  1N34 B;  1SQV H;  2OWO A;  4FZ1 A;  1W0J G;  1HNX B;  2HJD A;  2EIN B;  4UCO A;  2D3O W;  4B3S B;  4DR6 O;  4DR1 B;  4LFB O;  4IL6 Z;  1K34 A;  1QLE B;  1QNM A;  3CWB H;  3Q4H B;  1ZX3 A;  2IJI A;  1GH6 A;  4X1K B;  3RVY A;  5CA3 A;  2AZ0 A;  4NYK A;  3ETD A;  1EN6 A;  2Q73 A;  4CC6 A;  5JQG A;  3SPC A;  4JYB A;  2Q7G A;  1EFR G;  1O9G A;  3RYI B;  1Q3E A;  1YSC A;  4I0X A;  4E2L A;  2A3Q A;  1HNW O;  3ABK B;  2QTO A;  3AG4 C;  1JJ2 U;  2UUC B;  1YDX A;  3BPZ A;  1HWY A;  4W4L A;  3K04 A;  1GM7 A;  5KA6 A;  2QWR B;  1JA8 A;  2DN9 A;  2YXH A;  2OCH A;  4QNH B;  1OCC C;  3KCY A;  5IYZ B;  1K4D C;  3X2Q C;  3ZED A;  3F5W C;  1IXM A;  1N33 B;  4Z1V A;  4U7O A;  1YVW A;  1GN6 A;  5KUK A;  1VF5 B;  1M57 B;  3IJ4 A;  3ZRS A;  3FAV B;  2CAZ C;  1XI1 A;  3ASO C;  1M1K W;  2ZDI A;  1J5E B;  4FFB A;  5BZB A;  3KCX A;  1UPG A;  1H8E G;  4K8X A;  4GKK B;  4UCR A;  1CEZ A;  4XBF A;  2OIE A;  3CXC U;  4GKJ O;  4UV8 A;  3LNN A;  1JPX A;  1K3E A;  4YY3 O;  4TT3 G;  4DV7 B;  4DV2 O;  3AG3 C;  1FXK B;  2B1G A;  1VP7 A;  3SPG A;  3STZ C;  4LFC O;  5IJ0 A;  3PJS K;  5EYP B;  1X59 A;  2Y4T A;  2Z0A A;  4P2Z A;  4FLY A;  1R3L C;  3RVZ A;  1Q7Y W;  4WFH A;  5DN6 G;  4NKG B;  2DYR B;  4DR5 O;  1YJN V;  2ODM A;  2WAM A;  2VQF B;  3DXR A;  3ABL C;  1H38 A;  1EBO A;  1QLN A;  3JAT A;  2OTJ V;  4XDK A;  4JI5 O;  1GN3 A;  3WU2 Z;  4IHJ B;  1GM8 A;  4LR3 A;  3CRM A;  5H5N A;  4NTY A;  1ZSP A;  1OCZ C;  2Y0P A;  4IYI A;  4GX5 A;  3SR2 C;  2VWJ A;  1MAB G;  1XHX A;  1Q5O A;  1EM1 A;  4MS2 A;  2Y69 B;  4TSF G;  1TAE A;  4DRX B;  4ZKI A;  3JAM N;  1JX9 A;  4JI6 B;  5JH7 B;  4I50 B;  2WA4 A;  4KUM A;  3R66 A;  4DR7 B;  3SDL A;  1Y6X A;  1R3K C;  1GN2 A;  1OCO C;  3P30 A;  1SA0 A;  1N32 O;  4UCT A;  1WB7 A;  4UCU A;  4MW3 A;  4AIL C;  4IYH A;  5LP6 B;  2GV9 A;  4JYY A;  1S5H C;  2PI4 A;  3FD9 A;  2FML A;  1PV0 A;  4X66 O;  2DE0 X;  4P30 A;  2QWQ B;  3E8H A;  1N36 O;  2NLJ C;  4X64 B;  3DSQ A;  3OGI B;  4DR4 O;  2PTM A;  3RN4 A;  5B5E Z;  4DV6 B;  2W0F C;  2YUA A;  4NR1 A;  3RYH A;  1O9H A;  4JAU A;  2L35 A;  4GX0 A;  3FYE B;  4LF9 B;  4CBC A;  4IGG A;  4P9O A;  5AG2 A;  2DQ3 A;  2WLN A;  5FNV B;  2UUA O;  1FOU A;  4UCS A;  3T4Z A;  1DF4 A;  4O4H A;  3H1J H;  2KG7 B;  2BSK B;  4UCV A;  4BIU A;  3ASN C;  2YEV A;  4WBN B;  1P4R A;  3ABM B;  5FL7 G;  3TET A;  2YIC A;  4HNA B;  1YEW A;  2GTS A;  1R3I C;  5EBL C;  2Q7E A;  3G6B A;  3AG2 B;  2D2C B;  3S3X A;  3ZHU A;  3JCZ A;  2ZT9 B;  1XEQ A;  3Q4H A;  3H1H H;  4DR6 B;  2HLD G;  3SGI A;  5HFM A;  1WNS A;  4CC5 A;  3FX7 A;  2ARH A;  1J95 A;  1NTZ H;  1XDC A;  2OCC C;  4B08 A;  5BXZ A;  2DYS B;  3RYI A;  4LF5 B;  3OFN G;  2XAJ A;  1FPO A;  1HDJ A;  2VRZ A;  1KMI Z;  4UB8 Z;  1MZE A;  1MZF A;  3FB6 C;  2PGG A;  3ZMS A;  4O2A B;  1HNW B;  3CHX A;  4GX1 A;  4LF4 O;  4LH7 A;  2OTL V;  1RM1 B;  1SQB H;  4DV3 O;  2OT5 A;  4UXN A;  3W7S A;  1WJZ A;  5IYZ A;  4K0K B;  1NQT A;  2Q0A A;  2XAQ A;  5J2T B;  1R3J C;  2LGW A;  1DF5 A;  1US6 A;  2FL4 A;  4U3F H;  1YF2 A;  1PP9 H;  2W0X A;  4TUY B;  5ITZ B;  2A06 H;  1BQZ A;  4KP4 A;  2X6C A;  5KHK A;  3FAV A;  1M56 B;  1NH2 B;  4I9W A;  1QR8 A;  2F1M A;  4ASU G;  2WSS G;  4UFZ A;  2LJ2 A;  3EVK A;  3JD1 A;  5KHJ A;  2V4D A;  2EIM B;  4DUY B;  3JAW B;  2Z5U A;  3P3P A;  1FJG B;  2IU3 A;  5LMN O;  4XDL A;  1FFX B;  3QO7 A;  3K57 A;  2F95 B;  3U0Z A;  4KHP B;  1FS0 G;  2EJR A;  3HR0 A;  4LF8 B;  1ORQ C;  1V54 C;  1HNZ B;  2DMX A;  4JTC B;  5EYP A;  4FJC C;  2DWD C;  2X6B A;  2JJ1 G;  2E76 B;  1EZJ A;  4O2B B;  4LFC B;  3ZRX A;  2R70 A;  2M6Y A;  5EIB D;  2ZDI C;  3OT7 A;  1WB8 A;  3T2M A;  2JGU A;  3L73 H;  1MSD A;  3B77 A;  2ZIO A;  3P32 A;  4PHZ A;  4DR3 B;  3CCU V;  2UUB B;  4UB6 Z;  4TQF A;  4DR2 O;  2QGN A;  3CX5 F;  2Y48 A;  5CN0 A;  1ZWI C;  1OJH A;  2XHB A;  4B3R O;  4IHJ A;  2UXC O;  2E5L O;  4PEL A;  3EFF K;  3CCL V;  1WA8 A;  4X62 O;  1Q6U A;  2JVD A;  1SQG A;  3OR7 C;  4OPH A;  1VQP V;  1KP3 A;  3ZHQ A;  2EZO A;  4AI8 A;  1G6U A;  1JR9 A;  5HFL A;  1AR4 A;  1AJP A;  3BVO A;  5L3C A;  4DRX A;  4MTO A;  5FPO A;  4P9P A;  2QM8 A;  3SJB C;  2HR3 A;  5JH7 A;  3ABU A;  4I50 A;  3JD0 A;  4NB5 A;  1KBH A;  4NTW A;  2ADQ B;  1Q6H A;  3RYC A;  5DM6 V;  3CCM V;  5LP6 A;  2EJ7 A;  4NTX A;  1Y67 A;  1SF9 A;  2O57 A;  4J42 A;  3ZRV A;  4B3T O;  5EC1 C;  2Y0I A;  3RBZ A;  1MSW D;  2VQE O;  3CPW U;  5A9G A;  1N0N A;  4X66 B;  2QKC A;  1BL8 A;  3C3T A;  1Z5W A;  2JS3 A;  1FFT B;  4I4T B;  3HKD A;  4J7Z A;  1K92 A;  1T5E A;  5IJ9 B;  2UXD O;  2JJ2 G;  5BY1 A;  3RYF B;  3CYO A;  2GUZ B;  3SYQ A;  4MVO A;  1MG1 A;  2ZE7 A;  3ZBH A;  1Q82 W;  4WF9 V;  3E22 B;  1B04 A;  4DUZ O;  4DV0 O;  4JYA B;  2NR5 A;  1K5Q A;  5FNV A;  3KG2 A;  4JI7 O;  2JEX A;  3T1C A;  2HG5 C;  4LFA B;  2KG7 A;  3FB5 C;  2BSK A;  1G4Y B;  4WBN A;  1ZTE A;  3CD6 V;  2QWP B;  5LHH A;  4CH5 A;  4BIO A;  3E35 A;  4HNA A;  3T1H O;  5KAF Z;  1L1F A;  1L8D A;  4ICG A;  4RUE A;  1I94 O;  4LBE C;  4D7S A;  1NU1 H;  5CA1 B;  4IT5 A;  5LHG A;  4HYO A;  1AI6 A;  2FYU H;  2R9R B;  2XOK G;  2QM4 A;  2YID A;  4B7K A;  4BAY A;  2YIA A;  1XNR O;  3UKM A;  1VQ7 V;  3WG7 B;  4O2A A;  3K0G A;  3K59 A;  2YSU B;  1IBM O;  3B8M A;  2EIN C;  2H8P C;  4DV4 O;  1IBL B;  1N8R W;  3OAA G;  1GO3 F;  5KMG B;  4PDR A;  4YIP A;  4JI0 B;  4X65 O;  3KZI Z;  1VQL V;  1QR9 A;  2ZXW C;  5J2T A;  3APQ A;  1SC5 B;  3RYH B;  1PL0 A;  1Z5V A;  4DV5 O;  4RQE A;  4TUY A;  3OTF A;  1GM9 A;  2HJF C;  1RFY A;  3W7T A;  2QDO A;  3DTU B;  3LSQ A;  1JNB A;  4N23 A;  3ABK C;  2ZNI A;  4H37 A;  2KSD A;  1I0H A;  2ZIN A;  1GMG A;  4MSW C;  1Y66 A;  3ZMT A;  3FFQ A;  3C3S A;  1FFX A;  4K3A A;  1GTO A;  2RCV A;  3TCU A;  2JK5 C;  4DYL A;  5LMN B;  1XNQ O;  5L3D A;  5IYD O;  4JI2 B;  1BHB A;  1M57 C;  2HHH O;  4O2B A;  1HR0 B;  1PNL A;  1URF A;  1Z2G A;  3OMI B;  3BCC H;  4YJ2 B;  3FKS G;  4RQF A;  3CCS V;  1CPY A;  2X7R B;  2Y4U A;  1YJ9 V;  5JJN B;  3RWR D;  1SES A;  4BR6 A;  1IUR A;  5IWA O;  1XRE A;  1N4C A;  1SZT A;  1AI4 A;  4PA6 A;  2KQX A;  2QWO B;  2ZE5 A;  2R72 A;  4Z1M G;  1JJO A;  1FXK C;  2AXT Z;  3R65 A;  2E5L B;  3A0H Z;  3LDD A;  1L0N H;  4JV5 O;  2F93 B;  3AEI A;  3QTC A;  5GTI Z;  3ETQ A;  1S0V A;  2P6J A;  1OCR B;  3RGB A;  2F4V O;  2ZR2 A;  1AIL A;  1H2M A;  5BR8 O;  4DXW A;  3VQV A;  1YI2 V;  4PI2 A;  4L87 A;  3CRA A;  1LR1 A;  3W7X A;  1SS3 A;  3BRC A;  5JJJ B;  4U3J B;  1MNG A;  2Z3Y A;  4JI1 O;  1EN5 A;  4X88 A;  2DWE C;  5H9C A;  3VOU A;  3JAS B;  3ZS8 C;  5IT9 N;  1IBK O;  3BY6 A;  5FLX N;  1NI8 A;  4MT8 A;  1VF7 A;  2IM9 A;  1FYJ A;  5JCO C;  1XMQ B;  2EIJ C;  2UU9 B;  3JSL A;  4PDL A;  4I4T A;  4MVS A;  2YI9 A;  1AJQ A;  1R1B A;  5IJ9 A;  1D5A A;  3RYF A;  2GUZ A;  3GVM A;  1Q8I A;  4WCE V;  2LFR A;  2UXD B;  3OTO B;  5L3F A;  2E3C A;  5LBQ A;  3E22 A;  5LP6 C;  4LF7 O;  1BT8 A;  1S3J A;  2CGO A;  4BWA A;  2L6L A;  5H2F Z;  3CP1 A;  1BZK A;  1WA8 B;  2ZM6 B;  3UO3 A;  3CMA V;  4FM1 A;  1D2D A;  2EIK B;  1YIJ V;  4X9Q A;  3MHH C;  3KDR A;  4XDJ A;  2RJZ A;  4PDV A;  3CCE V;  5B1B B;  1KYO F;  2IU0 A;  4MW8 A;  5C8Y B;  2YIB A;  4JI3 O;  1NVP B;  4PA9 A;  5LHI A;  2RNB A;  3K08 A;  3AG7 A;  5K1P A;  2P4V A;  4B3M B;  5CA1 A;  5CBH A;  3UM7 A;  3OUS A;  2GHY A;  1I7F A;  2CTQ A;  5EK0 A;  1TVK B;  3F7V C;  4CH3 A;  4FFK A;  4LF6 O;  1AR5 A;  3K03 A;  4GCZ A;  4J41 A;  3RYC B;  2IBZ H;  3D36 A;  3I56 V;  1M9N A;  3K79 A;  2H94 A;  4X20 B;  3H1L H;  2QE7 G;  3CCR V;  4ZOL B;  1QBZ A;  3ABM C;  1XNR B;  4EFE A;  2IH3 C;  2XTA A;  3ZMV A;  4EKW A;  3CS5 A;  1XHZ A;  4LWS B;  1R6K A;  4R8C A;  1ZAU A;  5KMG A;  5LGU A;  1KB9 F;  2UXB B;  3HKD B;  1AJN A;  3JAK B;  3U10 A;  4GLX A;  3QO8 A;  4X89 A;  5LL6 Y;  3D3Q A;  1SZX A;  3CRR A;  4NXN B;  4X65 B;  2LW1 A;  2DYS C;  1OCZ B;  1M5I A;  3ZRW B;  4J7J A;  3EHB B;  5EBM C;  1RP3 B;  4L8J A;  1V9P A;  1M93 A;  2LP7 A;  5D5P A;  2GDS A;  4WFF A;  4CH6 A;  3IC9 A;  3MHS C;  3OEH G;  3CEI A;  1RM1 C;  4NXM B;  1VIB A;  4N21 A;  3HB3 B;  2QR4 A;  1H8H G;  1GN4 A;  2K1E A;  3B09 A;  3HKB B;  5LMU B;  1AI7 A;  2K9P A;  4ZHQ B;  1BHA A;  3BEH A;  1RSO B;  1Q43 A;  2DOS A;  1H2S B;  4I55 B;  2ZQM A;  2M7W A;  3LSU A;  4ZIB A;  2CH7 B;  4LFB B;  3WB0 A;  5L3E A;  4JAS A;  4I9Q A;  3L74 H;  3K06 A;  1SKV A;  4FLW A;  2E74 B;  4YJ2 A;  1K97 A;  2CK3 G;  4PDM A;  4X1Y B;  2Q68 A;  2ZE8 A;  4O4J B;  5KLV H;  4JAV A;  4F6R B;  1K5S A;  1XOU A;  3QVN A;  5IDJ A;  4CH4 A;  4BW9 A;  2LFS A;  1HP8 A;  2XAS A;  4MTG A;  2EIL C;  2YXL A;  1LUV A;  1YCI A;  4F6E A;  1JMK C;  2F43 G;  2GSM B;  4TWK A;  4JTA B;  3ZHT A;  1NH2 D;  4FVM A;  1TUE B;  1KQS U;  3CB2 A;  3K5O A;  3K3W A;  3STL C;  3AK1 A;  5EIB C;  1XMO O;  1GRJ A;  2ITD C;  1NKD A;  4X1I B;  4O4I B;  3B2E E;  2WLJ A;  2XUM A;  3K9S A;  1VF6 A;  4U3J A;  5H6R A;  4YHH O;  3JD4 A;  4OGQ B;  3NXS A;  2ATK C;  4JI8 O;  3IGA C;  3JAS A;  1DTO A;  2DW4 A;  1DGS A;  2QKS A;  4GKJ B;  5IY5 B;  4YY3 B;  4DV2 B;  3ZX6 A;  1ZL8 B;  2PUS A;  3JD3 A;  2JDI G;  1B6Q A;  3H01 A;  4G2K A;  1N34 O;  2PZS A;  4JAA A;  3DGE A;  3ZIA G;  1HNX O;  3A2F A;  2BTO A;  1BSM A;  3K0D A;  4DR1 O;  2JS5 A;  3AG1 B;  1FAF A;  1MOF A;  2V1D A;  1KD1 W;  1PM9 A;  4QE9 A;  2BTQ B;  4DR5 B;  1U97 A;  3OUF A;  2XND G;  1BQ0 A;  1SQX H;  3TGU H;  5B66 Z;  2IH1 C;  3ZMU A;  1JFF B;  3F5T A;  3VBB A;  4JI5 B;  1IDS A;  4LF7 B;  1PD3 A;  1KP2 A;  5FPR A;  3OMA B;  4R50 A;  3B40 A;  5LXT B;  5L3B A;  3H1K H;  4D7T A;  3ZHV A;  3J81 N;  1BS3 A;  2OYQ A;  1NR7 A;  5C8Y A;  4MVQ A;  2FTK A;  3L9D A;  4K35 A;  4LNU B;  3DC6 A;  1NR1 A;  2LW7 A;  2YC0 A;  4PA4 A;  3CCQ V;  3SYO A;  4MVZ A;  2QSA A;  4QJF B;  1GK9 A;  2E75 B;  3FB7 C;  1N33 O;  3LNM B;  3MAQ A;  1I5X A;  4QE7 A;  1KKC A;  1JOY A;  3SPJ A;  1TVK A;  1U96 A;  1I5Y A;  1VQ6 V;  3N2G B;  4I5S A;  4OX9 O;  1Y74 B;  2WLK A;  1N32 B;  4X20 A;  2P5O A;  5LGN A;  2JRI A;  2W6I G;  3HKE B;  2CDY A;  5CBF A;  4ZOL A;  4GKK O;  4RO2 A;  3P3N A;  2Q67 A;  4DV7 O;  4LWS A;  3T4D A;  1PPJ H;  2EX3 A;  2VWK A;  1N36 B;  2R9I A;  4H13 B;  4H44 B;  4DR4 B;  3JAK A;  5E1A C;  1ZLZ A;  2RQ6 A;  3W7W A;  1KU9 A;  2UXN A;  1RPR A;  1W59 A;  2CGN A;  3ZRW A;  4JZ2 A;  4UUJ C;  3BHP A;  3JCU Z;  3LSS A;  4DK1 A;  2AHZ A;  3GWO A;  1AI5 A;  3L75 H;  2P90 A;  2F66 C;  2CTW A;  2UUA B;  1H2K A;  3RT3 C;  1CP9 A;  2LQT A;  2ILM A;  3OW2 U;  2PY5 A;  5H6Q A;  3JYC A;  2YIB D;  3N27 A;  5KX5 B;  5JJE B;  3HKB A;  2HFE C;  4ZHQ A;  2BOB C;  1RSO A;  4G28 B;  2LGQ A;  4I55 A;  3G67 A;  2F23 A;  4CS4 A;  2CH7 A;  4JYC A;  4LC1 A;  1KEC A;  3T1Y O;  4ZI7 B;  4JI6 O;  1IX9 A;  2ADP A;  3SYP A;  4BIZ A;  3A0B Z;  4X1Y A;  4O4L B;  2C2A A;  4DR7 O;  3SPH A;  3PN1 A;  4O4J A;  3KKY A;  1GKF A;  1SET A;  4F6R A;  5IYB O;  1D5N A;  1SQF A;  1QQC A;  1ZUQ A;  4JZG A;  1VQN V;  3WB1 A;  3S3W A;  2N04 A;  1W0K G;  1BMF G;  2XAH A;  4LF4 B;  1WLE A;  1QLE C;  4FM0 A;  4QPJ A;  4J9Y B;  4DV3 B;  3TK1 A;  2WLI B;  1VQ4 V;  1H5W A;  4X64 O;  2IW5 A;  4FPP A;  1XQ8 A;  1XBL A;  3W7U A;  1Y76 B;  4DV6 O;  5EZY B;  3VQX A;  4LP8 A;  3TXS A;  3K5L A;  1R6T A;  4J10 A;  4X1I A;  4O4I A;  4EEQ A;  2Q8V A;  5E79 Z;  4KXR A;  5LA6 B;  2JEU A;  3ABT A;  1WAZ A;  4CS2 A;  3BFR A;  3OD4 A;  3QO5 A;  4GZR B;  4ZBM A;  2EZP A;  3BAB A;  1F7Y A;  4QGP A;  1THZ A;  1XIL A;  2JGD B;  2HP8 A;  3GB7 C;  4YHH B;  3OMN B;  2A7W A;  2XT9 A;  4UVA A;  3M8A A;  1OCR C;  2GBO A;  1ZL8 A;  1W2B U;  2V7Q G;  3L71 H;  1AP6 A;  3ZJZ A;  5J2U A;  1G1X B;  2Q4P A;  2JIZ G;  3JAR B;  4FK5 C;  1V55 B;  4CS3 A;  3U11 A;  3CCJ V;  3F7Y C;  3J80 N;  3IFX A;  5B1A B;  3E86 A;  1Q90 D;  2BTQ A;  3ZHR A;  1VF6 C;  1S76 D;  1Y4M A;  1FD9 A;  3HKC B;  4DR2 B;  2P7T C;  2ZXW B;  1UJW B;  4LF5 O;  4DV1 O;  1AB3 A;  1IXB A;  1NBM G;  1JFF A;  3E83 A;  3ZN1 A;  1HW7 A;  4B3R B;  1IZ3 A;  2UXC B;  2EUL A;  5LXT A;  3H1I H;  4IIJ B;  4ABM A;  2MK3 A;  4X62 B;  1B3Q A;  1H2N A;  1WP8 A;  4Q20 A;  3K5N A;  1DK1 A;  3B8N A;  2DYR C;  4LNU A;  2YI8 A;  3G6E V;  4K0K O;  1EZV H;  1H2L A;  3CSX A;  2FB5 A;  1XL6 A;  5B3S B;  1UFI A;  2LO1 A;  4BW5 A;  5A2Q N;  4DW1 A;  2IJK A;  5JWP A;  3JSN A;  1A32 A;  2QWN B;  4FLT A;  3IC7 A;  3N2G A;  1YZB A;  2Q0O C;  1Y74 A;  4AQY O;  2EIK C;  3L72 H;  4OX9 B;  3HKE A;  5DEC A;  2BE3 A;  4DK0 A;  4DUY O;  1QHT A;  5B1B C;  1FJG O;  1Q81 W;  2ZCE A;  3OM3 B;  4EB6 B;  2Y69 C;  4B3T B;  3AG4 B;  2VQE B;  3M7M X;  4KHP O;  3CJH B;  4LF8 O;  1SRY A;  1HNZ O;  1WN7 A;  1VQ9 V;  4YJ3 B;  3SJA C;  2WLM A;  2WA3 A;  3B4S A;  4G27 B;  1KC8 W;  3O65 A;  1OCC B;  5DED A;  3X2Q B;  4FLX A;  4U7N A;  1ARO P;  3THO A;  2AHY A;  4W4K A;  5KUM A;  3BA8 A;  1BGY H;  4J80 A;  4DR3 O;  2CTR A;  2UUB O;  4DUZ B;  4DV0 B;  1S77 D;  2ETN A;  4JI7 B;  5CA0 B;  1E79 G;  1TGO A;  3DC5 A;  1PL4 A;  3ASO B;  2QA4 V;  3UCS C;  4HAM A;  3C90 A;  5KX5 A;  1K8A W;  2CE4 A;  1E1R G;  1NVP D;  1KKD A;  1COW G;  4TV9 B;  1M90 W;  1YJW V;  2B1I A;  3K9A A;  5GON B;  4K8Z A;  1PKX A;  2FKX A;  1K73 W;  3QG5 A;  3JAL B;  3ZHS A;  5CB4 A;  3T1H B;  4B7E A;  5JVD B;  5KHI A;  1F4M A;  4I7Z B;  3AG3 B;  3NR7 A;  1I94 B;  3JD2 A;  3SYC A;  3G71 V;  1N0J A;  1JQ0 A;  4UV9 A;  4ZI7 A;  1JCH A;  2AZ2 A;  3T1Y B;  3EXA A;  4O4L A;  2A0L A;  3QF7 A;  4WFE A;  5GTH Z;  2EIJ B;  4J7K A;  3CRQ A;  2RN9 A;  3MD0 A;  3A8T A;  2A79 B;  3K58 A;  3HPL C;  3ABL B;  2B9Z A;  2UXX A;  5K1X A;  5BMV B;  1QCE A;  3N2K B;  4LH6 A;  3AG2 C;  4MVU A;  5B1O A;  3CC2 V;  1IBM B;  4DV4 B;  4OPA A;  3GWK C;  3CRC A;  4RUF A;  2WLI A;  2YXY A;  1TUB B;  2HVK C;  1SQQ H;  3J7A U;  2YDE A;  4J11 A;  4PI0 A;  2NN4 A;  5B1N A;  1IJG A;  2ITC C;  4DV5 B;  1Y76 A;  1S72 V;  2WPD G;  5EZY A;  3OE7 G;  1DLB A;  2NNU A;  3ETE A;  5LA6 A;  1P49 A;  1LUW A;  2EBO A;  3K5M A;  4JYA O;  4YXW G;  4PV1 B;  3ETG A;  2HEP A;  3WFV A;  3ICX A;  5IE9 A;  3TXQ A;  1TA8 A;  3CME V;  4LFA O;  1I08 A;  1NTK H;  2JGD A;  2Q69 A;  2QEX V;  3ZMZ A;  3FYI B;  1OCO B;  5LGT A;  3CE2 A;  3TJT A;  1NT2 B;  5KHH A;  2PYJ A;  4H0L B;  1XNQ B;  2R9A A;  3E8B A;  1M56 C;  4JI4 O;  5LOV B;  1E1Q G;  2A9H A;  1FXV A;  3JAR A;  1NZ6 A;  2QTS A;  1X4T A;  2HHH B;  3QNE A;  4DO2 A;  3UT5 B;  1YHQ V;  1VQK V;  3D8C A;  2EIM C;  5CMU A;  4FMT A;  4C7U A;  2P06 A;  3HKC A;  4Z2W A;  4X1K A;  2PI5 A;  5IWA B;  1SER A;  4HBN A;  2PF4 E;  2ZE6 A;  4JGS A;  1P7B A;  4FLV A;  4OXS A;  4RWU A;  1QVF U;  5IY5 C;  4DV1 B;  2X0L A;  4IIJ A;  4E4E A;  1VMG A;  2Q7H A;  2ZNJ A;  1FKA O;  4JV5 B;  3OGC C;  2WLL B;  1EN4 A;  2ZR3 A;  1H2G A;  5LYJ B;  1VQO V;  1IBL O;  1K33 A;  4JPR A;  3IAY A;  3ASN B;  3AG1 C;  4JI0 O;  5IYC O;  2F4V B;  2XAF A;  3RFR A;  5BR8 B;  5EBW C;  3UO2 A;  2YS8 A;  1JVM A;  2DQ0 A;  1VQ5 V;  1FXH A;  3G4S V;  4TV8 B;  4A5U B;  3BA9 A;  2ZIM A;  1ENV A;  1M4U A;  2ZD9 A;  4JI1 B;  2OIG A;  2OCC B;  4AQY B;  3LUT B;  1L0L H;  3CC7 V;  1Q86 W;  1IBK B;  4EB6 A;  3CCV V;  3D3I A;  2HKO A;  2N74 A;  2Q9L A;  5J2U B;  3I55 V;  3SJC C;  4RAI A;  1XUQ A;  3CJH A;  4B3S O;  1NTM H;  4YJ3 A;  1FXK A;  3BAA A;  1PNK A;  4JI2 O;  4PJ0 Z;  4WFA V;  1MA1 A;  2GTA A;  2EIL B;  1HR0 O;  4F4L A;  3AK2 A;  3ZN0 A;  1Q6I A;  2XAG A;  3E89 A;  5JQG B;  1KUQ A;  4UVB A;  2KKW A;  3FB8 C;  1NJI W;  3E8G A;  4GYC B;  1VQM V;  5CA0 A;  4I0X B;  2UUC O;  4HZ3 A;  1F4N A;  2PYL A;  2RDC A;  1WP7 A;  1BE3 H;  2Q6A A;  3O9O A;  5C93 A;  3UQ8 A;  1S5L Z;  1AR1 B;  2WWW A;  4TV9 A;  1K7D A;  2BCC H;  2WLH A;  4JTD B;  5GON A;  2RMK B;  3RW0 A;  3SYA A;  3JAL A;  1NS1 A;  2KB1 A;  1F23 A;  5KAI Z;  1OZ0 A;  4JI3 B;  4R7C A;  3H9V A;  5JVD A;  4GUN A;  5F2V O;  1V54 B;  1YXB A;  4MVR A;  4DW0 A;  1AP5 A;  4PA7 A;  3L70 H;  3VQY A;  1J5E O;  5JCO A;  4LF6 B;  2W6J G;  1VAR A;  5TIS Z;  1BCC H;  1XL4 A;  3MDS A;  4R6Z A;  3CC4 V;  4FFB B;  1OHH G;  1VEW A;  1GAX A;  3WB2 A;  4X8A A;  4JF3 A;  5BMV A;  2N05 A;  3N2K A;  2P22 C; 
#chains in the Genus database with same CATH homology
 3KDR A;  1AR4 A;  1LUW A;  4JYY A;  1AP6 A;  3AK3 A;  1IDS A;  1I08 A;  2ADQ B;  1XUQ A;  3DC5 A;  1PL4 A;  3RN4 A;  3QVN A;  1BS3 A;  4FFK A;  3TJT A;  1MA1 A;  1AR5 A;  2P4K A;  2CE4 A;  4YIP A;  1AVM A;  4YIO A;  1IXB A;  1Y67 A;  3DC6 A;  1IX9 A;  2ADP A;  3AK2 A;  1LUV A;  3EVK A;  4F6E A;  1B06 A;  3KKY A;  5A9G A;  5AG2 A;  1N0N A;  1KKC A;  1MNG A;  4C7U A;  2QKC A;  1D5N A;  1EN5 A;  1ZUQ A;  3C3T A;  4JZG A;  3AK1 A;  1QNM A;  1N0J A;  1I0H A;  1GN3 A;  1EN6 A;  1SZX A;  2CDY A;  3C3S A;  2QKA A;  4E4E A;  3K9S A;  3OT7 A;  1WB8 A;  2RCV A;  1MSD A;  1EN4 A;  1ZSP A;  4GUN A;  2AW9 A;  2GDS A;  1AP5 A;  3IC9 A;  1ZTE A;  1EM1 A;  1JA8 A;  1MMM A;  1ZLZ A;  1XDC A;  3CEI A;  1VAR A;  1BT8 A;  1P7G A;  3BFR A;  3MDS A;  4JZ2 A;  1GN4 A;  1VEW A;  1BSM A;  1XIL A;  4BR6 A;  1GN2 A;  1XRE A;  1PM9 A;  1JR9 A;  3LSU A;  4X9Q A;  1GN6 A;  1WB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...