4X9QA

Mnsod-3 room temperature structure
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
194
Chain Sequence
KHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn] 2, mitochondrial
publication title The structure of the Caenorhabditis elegans manganese superoxide dismutase MnSOD-3-azide complex.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 74
structure length 194
sequence length 194
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4x9qA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4x9qA02
1LUWA 1AP5A 1VEWA 4JZGA 1GN3A 1LUVA 1MA1A 2QKAA 2QKCA 3EVKA 1EM1A 1P7GA 1GN4A 3TJTA 1BSMA 1PL4A 1XDCA 1PM9A 1BS3A 1VARA 2RCVA 4YIPA 1GN6A 2AW9A 5AG2A 4JYYA 3C3SA 2CE4A 5A9GA 4BR6A 2P4KA 1ZUQA 4F6EA 1SZXA 1I0HA 4X9QA 2ADQB 3IC9A 4YIOA 3AK1A 1WB8A 3LSUA 1JA8A 1BT8A 1EN5A 1I08A 1EN4A 1EN6A 2ADPA 1N0JA 1QNMA 1XUQA 4C7UA 1ZLZA 1XILA 1AP6A 1IDSA 1AVMA 1XREA 1ZSPA 1MNGA 4FFKA 1KKCA 4GUNA 3K9SA 3CEIA 1N0NA 2GDSA 3OT7A 1IX9A 1JR9A 1B06A 1Y67A 4E4EA 3AK3A 3KKYA 3MDSA 3BFRA 3AK2A 3DC6A 1AR4A 1MMMA 1WB7A 3RN4A 1IXBA 2CDYA 3DC5A 1GN2A 1D5NA 1ZTEA 1MSDA 1AR5A 3C3TA 3QVNA 4JZ2A
chains in the Genus database with same CATH superfamily
2Q68A 1LNQA 4TOIA 1Q5OA 4JZGA 2JGUA 4BIUA 1QLNA 3IGAC 1LUVA 3AG7A 3KG2A 1MA1A 4RUEA 3CCVV 4B3RB 4DR1B 2HG5C 4X20B 1N34O 3OTOO 4LFBO 1NJIW 2HR3A 2QDOA 1XMOB 4DV2B 3ABLB 3OEHG 3OMNB 3JAKB 1VARA 4O2BB 4ICGA 3K08A 1RP3B 4PELA 4QNHB 4IIJA 4W4KA 2ZXWC 5L3FA 1I94B 3QO8A 4JYYA 1WA8B 4BR6A 2GHYA 4TT3G 2NN4A 2YEVA 5IDJA 1GM9A 4UVBA 1MOFA 5B1BB 1Q3EA 1K33A 3T1HB 1SF9A 2Q73A 2NNUA 1KBHA 2QE7G 3RYFA 2K9PA 5B1AC 2M7WA 1QNMA 4HNAB 5IYCO 3A0BZ 4YJ3B 1ORQC 2Y0PA 3ETGA 3B40A 2Q8VA 3B09A 4O4JB 2ARHA 4LF8O 2KG7A 3L9DA 3MAQA 2V4DA 5LXTB 5GONA 5EBLC 2EILC 4GKJB 4UFZA 1Y67A 4JV5B 5LYJB 3SJAC 5HFLA 2E5LB 3ETEA 4UCTA 5CA3A 1MMMA 1OCRB 2Q7GA 4HZ3A 5EK0A 4I50A 5IYZB 3K5NA 2VRZA 5LA6A 2HVJC 1GM8A 4PA6A 2IJJA 1PNLA 3W7WA 1L1FA 1DK1A 3F7YC 3CCRV 4GX1A 4DV1B 2X6AA 4EFEA 3EFFK 4LH7A 2YS8A 3HKDB 4DUYO 1QQCA 5EBWC 2EIMB 1N36O 5FNVA 3DXRB 4JTCB 4KXRA 1H2LA 4ZI7A 1Q7YW 1QR9A 4KL1A 1W59A 3U11A 4DV4B 5L3CA 1FFTB 3AG1C 4JI5B 4LP8A 2H94A 1YCIA 2AW9A 3SYCA 3HR0A 1F7YA 3SPCA 3CXCU 2BSKA 1UJWB 4B3RO 3JYCA 3IJ4A 2GTSA 2B1GA 1H2SB 5LHGA 4DR1O 1XMOO 4DV2O 1JJOA 3CCUV 2H3OA 1I94O 4QPJA 4FM0A 4EB6B 1VQPV 3K0DA 3E86A 4C7UA 1NU1H 2ATKC 2ZDIA 3ZRXA 1XNQB 2V1DA 2DWEC 2UXBB 1DTOA 5H2FZ 3T1HO 4RAIA 3J80N 3KCYA 4FFKA 4X1YA 5LP6C 1KC8W 3CEIA 3I56V 1HDJA 1OCOC 1YXBA 3FB6C 3D8CA 4J42A 2CAZC 2L6LA 5KLVH 2CGOA 4H0LB 2HEPA 1K4DC 4E2LA 3UKMA 5KHHA 3BFRA 3DC6A 4WFFA 1SETA 2A79B 4I7ZB 3UO2A 1XEQA 3SYAA 2P90A 4JF3A 3HKEA 1W0JG 1K73W 1I5XA 3B4SA 4GKJO 4EEQA 1FFXA 5LGUA 4JV5O 5EIBD 1WLEA 1N4CA 2E5LO 1AI4A 2QJ1A 4JGSA 3X2QC 2LFSA 1QHTA 1S0VA 1V55B 1IBMB 4AQYB 4X65B 4I5SA 4O4LA 3WU2Z 3OGCC 5B3SB 2JGDB 3UCSC 4DV1O 2UUBB 1H8HG 3JASA 5IYBO 4H13B 5BR8B 4FLTA 2Q69A 4UVAA 3HB3B 1ROPA 2KQXA 1DF5A 4PV1B 2EJ7A 5KUKA 1MZEA 1H2GA 2P4KA 1SERA 1WP8A 2ADQB 4DV4O 3ASOC 3ZS8C 2EIKB 3RGBA 1F51A 3M99B 3HPLC 4JI5O 3AK1A 3FB8C 1DLBA 3BVOA 1SA0A 2XAGA 3CCLV 4PI0A 4U7NA 2JDIG 2RNBA 1CXZB 2PUSA 2VQEB 1FS0G 1IBKB 1M57C 1Y76B 1U96A 1FXVA 4X1IB 3W7SA 3BHPA 4U3JA 4KFMA 1VQ4V 5LMUB 2RDCA 3S3WA 4D7SA 1F4NA 3D3QA 3RBZA 4X20A 4J9ZB 1VF5B 3CRCA 3CJHA 3MDSA 2HVKC 1H5WA 3JAKA 1XNQO 4WFEA 1M4UA 2D2CB 2UXBO 3KZIZ 1WB7A 2IU0A 2OTJV 4IIJB 3VQYA 1MG1A 4FLVA 3JCUZ 1VQKV 3ABKB 4BAYA 3B2EE 1N32B 4JYBA 1R6KA 2YEVB 3AG2C 1Q90D 1Z5VA 2YXYA 3E8GA 1F4MA 1YHQV 4MVOA 4YY3B 4CC5A 4JYAB 3ABTA 3DTUB 3EXAA 4Z1VA 2IW5A 3K5OA 2FMLA 2F1MA 3QF7A 1NR1A 1K8AW 3CC2V 1BHBA 3RYFB 2KB1A 4H33A 1XDCA 3CCJV 2Z5UA 3OAAG 2MK3A 3R65A 3OMAB 2WLJA 3CCMV 1GO3F 4LFCB 1SQFA 1XI1A 4AILC 5EC2C 2KG7B 3IAYA 4UUJC 2EJRA 5GONB 3AG3B 1IBMO 4AQYO 1PP9H 2ZE8A 3SJQC 4X65O 3I55V 5BY1A 3AG4C 1Y66A 3O9OA 2UUBO 5B1OA 4QGPA 1ZL8B 3K9AA 5E79Z 5DN6G 4CH4A 4CS4A 1NQTA 5BR8O 2UXXA 1M56B 2ZIOA 1L0LH 2ZT9B 4TSFG 4DR6B 3RYHA 1K5QA 3ZIAG 1EFRG 1EN5A 2ZCEA 1BL8A 4I50B 1I08A 5JVDA 1V54C 1XUQA 1IZ3A 1I7FA 1B04A 1AVMA 3ASNB 3HKDA 1VQOV 5B1NA 4CZZA 1MABG 2GBOA 2F93B 1N0NA 2VQEO 5FNVB 2R9IA 1IBKO 3K0GA 3UT5A 3R66A 4ZI7B 1S5HC 3B77A 3RT3C 3K06A 4IYIA 1QLEC 4LBEC 4DR7B 4DR2B 1SZTA 2QGNA 4FM2A 3H9VA 2VQFB 5LMUO 3WFVA 1WPXA 1XOUA 2P22C 4RWUA 1KUQA 2BSKB 4R50A 3K3WA 4GT1A 4MVZA 1KP3A 1H38A 4BWAA 3E22A 1FJGB 4AI8A 1TVKA 2Y69C 4DV6B 1ZWIC 3AEIA 4DV3B 2LFRA 1R3LC 2DYRC 1N32O 5JJJB 4Q20A 2E76B 3SGIA 4MTOA 3TK1A 2ITCC 2RCVA 4UB6Z 1R1BA 4JI6B 5EYPA 1GN6A 2R9AA 3S3XA 4YY3O 2E75B 4JI3B 1A32A 4PDMA 4R6ZA 4X1YB 2JRIA 3ICXA 3WG7B 3GWOA 1AILA 4TWKA 4QJFB 2NR5A 3CMAV 1AJQA 2DYSB 3ZMTA 4LFCO 3E2EA 3VQWA 3JALA 1GK9A 2EULA 1K5SA 1M5IA 4W4LA 1F23A 2BOBC 2ADPA 1CPYA 1N0JA 3HKEB 2X6CA 4ZKIA 4LH6A 3D36A 4MVRA 4DV0B 3LDCA 1WP7A 1GH6A 1YEWA 1FFXB 1P84F 1R3KC 4PDRA 1CP9A 1FXKC 4FLYA 4DR6O 3DGEA 4LF8B 3UM7A 3K9SA 3TGUH 3ZRVA 1W0KG 1QU7A 2ZIMA 4DYLA 2ZXWB 4O4LB 2P7TC 2JGDA 2RN9A 3WB1A 3AK2A 3JASB 1Y4MA 4AHCA 2GTAA 1AR4A 2H8PC 2Z3YA 3E8FA 4JI7B 2LGWA 3M8AA 4P2ZA 3SDLA 1VQ8V 5JJNB 1AR5A 4NXNB 1PPJH 2IH1C 2R9RB 4TQFA 2OCHA 1K9MW 1Z5WA 2Q0AA 2DWDC 4LF9B 4DR7O 5B1AB 3ZBHA 4DR2O 1EZVH 3TCUA 3L70H 3OEEG 1Q6IA 2QKAA 2UXCB 4UV9A 2EIJB 1XBLA 3JATA 1AROP 2CH7B 5BXZA 1SA0B 2VQFO 1GN4A 3TJTA 1WAZA 1BS3A 1N8RW 4BIOA 3TETA 4LF4O 2PZSA 2OCCB 1B6QA 2ZR3A 1H8EG 3MD0A 1JJ2U 3CRAA 1VF7A 1FJGO 4U3JB 5HFMA 1GMGA 4GX2A 3THOA 4RO2A 4DV6O 2DW4A 4FK5C 4A5UB 1HWYA 4DV3O 5IY5C 4X9QA 5KMGA 1R3IC 2YUAA 4RUFA 5JCOA 4I55A 4FMTA 3CJHB 1GKFA 4JI6O 3RYIA 4JI3O 2XAFA 1H2MA 1OCZC 1HNWB 3CRRA 3E83A 1KQSU 1VQ6V 2JVDA 5LGNA 4PJ0Z 4L87A 2ZR2A 3W7TA 4IHJA 4BW9A 3CC4V 1PNMA 4X66B 4ZOLA 2ZE5A 3RW0A 4MVMA 5L3EA 1DF4A 2A3QA 3SJBC 1S77D 1KD1W 4DV0O 1YJNV 4BW5A 1YZBA 2LP7A 3ZHUA 4NB5A 3C90A 4Z2WA 1IXBA 4CS2A 4JAUA 1PKXA 4FLUA 2BTQB 1D5NA 1GAXA 2JJ2G 3LNNA 1OHHG 2OIEA 2Y4UA 3UQ8A 1AP5A 2OIGA 5J2TA 2OT5A 4EFBA 4YJ2A 1ZL8A 1OCCB 2EZPA 2AGAA 4JI7O 3RYHB 1JOYA 3VQXA 4MVSA 3CCSV 2AXTZ 5JVDB 4NXNO 5EIBC 3JAWA 2WLIA 4UCVA 3W7XA 4HBNA 3VBBA 3ZJZA 4LF9O 2VWJA 1OCOB 4O4IA 1TUEB 4FFBA 3CC7V 2UXCO 2XHBA 4DV5B 1GRJA 2ITDC 5H9CA 5EZYA 3IFXA 4I0XB 1G8MA 2L35A 1P49A 3ABLC 2B9ZA 3UT5B 1NTKH 2FB5A 4UXNA 1THZA 4R8CA 1BHAA 2UUAB 1EN4A 4X62B 1BZKA 3RVZA 5LL6Y 4CH5A 1US6A 1TUBA 5B1BC 1NKDA 4XDKA 3H1KH 4JI1B 3NR7A 2PI4A 1TAEA 3CP1A 2Y4TA 3E22B 4YXWG 1HNWO 2IBZH 3OT7A 1TVKB 4D7TA 1K92A 3IC7A 3HKCA 5ITZB 1HR0B 4XDLA 3A0RA 2QKSA 1FKAO 2YXHA 5EYPB 1OV9A 4WFHA 1XQ8A 4X66O 5H6RA 1X4TA 4NR1A 1YVWA 1AR1B 3ABMB 1DGSA 1U97A 2YC0A 3QVNA 3FX7A 2YI9A 1FD9A 5JQGA 3FYEB 4NYKA 1M57B 1Y6XA 4UCRA 1QVGU 2EINB 4X1KA 3JALB 3KDRA 2QWPB 2IJIA 4B3MB 1O9GA 2PGGA 4MTXA 5K1PA 5AG2A 5LHHA 1PD3A 3FD9A 4UB8Z 2EIMC 1COWG 1RPOA 4PDVA 4JYCA 3T1YO 1HP8A 4MW3A 3RWRD 5IE9A 3CD6V 4X8AA 4OXSA 4G28B 4YIOA 1QR8A 1WB8A 1BQZA 1JA8A 2WLNA 5JJEB 2XNDG 4FVMA 3O65A 1G4YB 4ABMA 4DV5O 2O57A 1GTOA 5LOVA 3FFQA 1IDSA 4OX9B 4J9YB 4NXMB 5H6QA 2UUAO 4X62O 1E79G 2CH7A 3JATB 4N21A 2P4VA 3ETQA 4FM1A 3BA8A 3U0ZA 2CK3G 5CBGA 5JWPA 4DO2A 2PY5A 5L3BA 3OW2U 3JARA 4JI1O 3KCXA 3AG4B 1RM1B 4WCEV 1NVPD 2BE3A 2QM4A 1KP2A 3JSLA 4UCUA 3NXSA 1TGOA 4TV9A 3ZHQA 4KHPB 4MVQA 4FPPA 3UO3A 4DV7B 4J11A 3LDEA 5KMGB 1HR0O 4I55B 4GYCB 4LCUC 3OE7G 3H01A 3RYIB 1WJZA 2YDEA 4CBCA 4LF6B 1HW7A 2BOCC 1Q6UA 3K58A 5KHKA 3ZRWA 2W6JG 3Q4HA 3RVYA 2WPDG 2XTAA 3A2FA 1JCHA 4WF9V 3HKBA 4MT8A 3T2MA 2P5OA 5LGTA 1VMGA 3CWBH 1QVFU 5A9GA 4IHJB 3ZN0A 3M7MX 4ZOLB 1SKVA 1ZUQA 1AJNA 1SQQH 2AHZA 4MTGA 3SYQA 4F6EA 5B3SC 4B3MO 1YI2V 3G71V 4ZIBA 4X89A 2RMKB 1ZX3A 2CTWA 2ETNA 1BQ0A 2OTLV 2MW2B 4LWSB 4FLZA 2P6JA 1PNKA 3LUTB 3ETDA 1J95A 5B66Z 1SQPH 2WLHA 2Q67A 1BE3H 2BTQA 1R73A 1SRYA 2YIBA 4HYOA 3F7VC 5KA5A 2UXDB 2EIKC 3B8MA 1K34A 3E8BA 1VF6C 5EC1C 5J2TB 4YJ2B 5KHIA 2DYRB 4PI2A 1Q6HA 4LFAB 1IURA 2ZE6A 2E3CA 2E74B 1YITV 1M93A 5LMNB 4JI2B 2JS5A 2EZOA 4JTDB 3ZX6A 3KKYA 4L8JA 1AB3A 4HAMA 4O4HB 3JAWB 5LP6A 2FTKA 1D5AA 1NZ6A 1EBOA 2WLIB 2B5UA 4OX9O 2W0XA 2JEXA 3ZRSA 5FPOA 4NXMO 4O4IB 5C93A 2EBOA 4FFBB 2UUCB 3ZHSA 5KAIZ 3L74H 2AZ2A 3JAMN 4H37A 4K8XA 1LUWA 2Q6AA 5EZYB 4I0XA 1VP7A 3K57A 3G80A 3K5MA 2QEXV 1B3QA 2IJKA 2JJ1G 1YIJV 3CYOA 3E89A 4TUYA 4XBFA 3OMIB 4B08A 3ABKC 2FYUH 1WPBA 4KHPO 1FPOA 4CS3A 2JIZG 3LSQA 4DV7O 1KB9F 1TUBB 4YIPA 1NR7A 4LF4B 4TV8A 3C3SA 1Q8IA 2GV9A 4RQEA 3L73H 1KMIZ 4LF6O 3ZMUA 3CMEV 2YIDA 4DK1A 5A2QN 2QM8A 3JSNA 2BTOA 3HKCB 2F66C 5ITZA 3BCCH 2IH3C 3ZMSA 1JFFB 2AZ0A 1NTMH 1K4CC 1IVSA 3AG3C 4UCOA 2C2AA 1AP6A 3P3NA 3J7AU 3SPIA 4WFAV 5CA0A 1M56C 5JQGB 3K79A 2LO1A 1G1XB 5CMUA 3SR2C 2XASA 2Q7HA 3ZHTA 3WB2A 4JASA 4IYHA 4X1KB 2Q4PA 2LQTA 4Z1MG 2LJ2A 5IJ0A 4JTAB 2UXDO 4ZHQA 3ASNC 3BA9A 4UCSA 3RN4A 5IY5B 4WFGA 1L0NH 2DN9A 2OYQA 4LFAO 4J41A 4P9OA 1ZTEA 4PD4F 1Z2GA 2QA4V 5LMNO 4JI2O 3CS5A 1Q82W 2Q7EA 4JAVA 1W2BU 4PA7A 4J80A 4PA9A 1S72V 4B7KA 2A06H 2WLKA 4NTXA 2UUCO 2CUGA 1H2KA 1NH2D 3CCQV 4U3FH 1K3EA 5LOVB 4O2AA 3QTCA 2Y48A 1PL0A 4J7KA 1AI6A 5CA1A 4OGQB 4X64B 1YTFD 4F6RA 1I0HA 3IC9A 1L8DA 2M6YA 1NI8A 1YF2A 2ZDIC 1BT8A 4J7ZA 2EILB 2XAQA 5CBFA 3CHXA 3ZHVA 5J2UA 2CTRA 3ZN1A 3JARB 2R70A 1VQ7V 1S5JA 2V7QG 2K1EA 4QIWF 1VQ9V 3WG7C 4GKKB 1XL4A 2W6IG 3A8TA 2Q5ZA 2WAMA 3SJCC 1V9PA 3E8HA 3K03A 4TV9B 1Y74A 4I4TA 1XREA 1MZFA 4MSWC 3ZMVA 1D2DA 4DR3B 1BMFG 1ZAUA 2ZM6B 2HKOA 3OUSA 5IJ9A 3EHBB 1QBZA 3A0HZ 1KU9A 3JCZA 3CXHF 1P4RA 1IBLB 4F4LA 4NKGB 3K59A 1OZ0A 3OM3B 3ZRWB 3Q4HB 5GTIZ 4K35A 4ZBMA 3HKBB 5L3GA 1S3JA 2LW7A 3DC5A 2DJVA 2VWKA 1CEZA 5CBHA 4B7EA 4JI4B 1VQLV 4MS2A 2A7WA 5IT9N 2PF4E 3T1CA 5JH7A 3AG1B 3LSSA 1WN7A 4D6TH 3D3IA 5KA6A 3STLC 1VQ5V 3ABUA 5IYDO 4LWSA 4Q6GA 2P06A 2DOSA 2QWNB 3FB5C 3EVKA 1XNRO 3CPWU 2XAJA 5LBQA 1NVPB 1PL4A 1J5EB 1KECA 2QSAA 5CN0A 2RQ6A 1SQGA 2F4VB 2ZNIA 4KUMA 4DUZB 4NTYA 4KP4A 1OJHA 2EIJC 2QWRB 5BMVA 1MSWD 1SQVH 1LR1A 4J7JA 4NTWA 5DEDA 4OPHA 3T1YB 1YJ9V 5KX5A 2ILMA 2OCCC 2F95B 4MTFA 4O4HA 1E1RG 5LP6B 5FPRA 3G6BA 5D5QA 1AI7A 4X64O 4JI0B 1XILA 3RYCA 2GUZA 4QPKA 5CB4A 1XL6A 5EBMC 1WNSA 4IL6Z 1MNGA 2PI5A 2QWOB 4PA4A 4K8ZA 4TUYB 3MHSC 3P32A 4E4EA 4GKKO 2CTQA 3OGIB 1FXKA 4MW8A 3G67A 2EX3A 3N2KA 4LF7B 4BIZA 3X2QB 4ASUG 4G2KA 4IGGA 2QM7A 3ZCCA 1O9HA 4DR3O 2ZM6O 4TV8B 2JS3A 1FOUA 2RJZA 5LHIA 3C3TA 2G38A 1IBLO 1S76D 4DR4B 1G6UA 4LC1A 2WLMA 1R6TA 5C8YA 3SPJA 1JFFA 4LNUA 3H1LH 4CH6A 4GX0A 2HP8A 4JI4O 4U7OA 2VS0A 3ASOB 3L71H 4WBNA 3VOUA 3T4DA 4FZ1A 1P7BA 1RSOA 2F43G 1OCCC 2QTSA 3F5WC 3CRMA 3N2GA 5CA0B 2CE4A 2WLLA 3CCEV 1NBMG 2ZKOA 1OCRC 1JMKC 3OR7C 3OUFA 1XHXA 3SYOA 2ZD9A 1J5EO 1BCCH 3E35A 5BZBA 3TXSA 1VQNV 2F4VO 5IJ0B 5KHJA 1FYJA 3LSUA 4ZHQB 3JD4A 5H5NA 4DUZO 3W7UA 3CX5F 2LGQA 2CTPA 4FLWA 2ZQMA 3FAVA 2WWWA 1SQXH 2HLDG 3WB0A 2HJFC 4GUNA 2PYLA 1AI5A 2DE0X 4PDLA 3SPGA 2PYJA 1B06A 4JAAA 2ZE7A 3SYPA 1H2NA 3AG2B 4JI0O 4LF5B 1FAFA 2KKWA 3F5TA 2UU9B 4GCZA 2A9HA 5E1AC 3BY6A 2XOKG 4O2AB 3DSQA 3JD2A 3CB2A 2X0LA 3CRQA 4I9QA 1SQBH 5CA1B 1S5LZ 4IT5A 4JZ2A 2KSDA 2N74A 3LNMB 3GVMA 4F6RB 1X59A 4B3SB 4LF7O 3BAAA 4DRXB 2W0FC 2FKXA 3ZEDA 4X88A 2A0LA 4WFBV 1Q43A 3VQVA 1EM1A 5J2UB 1SESA 2JEUA 1RPRA 3ABMC 4B3TB 4DR4O 3OD4A 2HHHB 2YIBD 3QNEA 1Y74B 4I4TB 3RFRA 4JI8B 2Z0AA 3ZHRA 2EINC 1V54B 2IM9A 2JK5C 3H1JH 4DXWA 4JPRA 3I5DA 4UVCA 1ENVA 3LDDA 5IJ9B 3APQA 1AJPA 1N33B 3FB7C 1JX9A 3D36C 1NH2B 3U10A 2YIAA 2YSUB 3T4ZA 4NVPA 3APOA 3BEHA 5K1XA 3OFNG 1EN6A 3ML0A 4O2BA 1XHZA 3N27A 1V55C 2QWQB 1QLEB 1YTFB 3P30A 2Y0IA 5JH7B 1WA8A 2WA4A 4R7CA 2GSMB 1XMQB 4OPAA 5F2VO 2P67A 3STZC 2DMXA 3CE2A 1KYOF 2X7RB 2ZINA 4PHZA 5KAFZ 2QR4A 2ZNJA 3JD1A 2X6BA 4CC6A 1TA8A 1YDXA 1SC5B 2YI8A 1YJWV 3BABA 3P3PA 4GX5A 2N05A 4FLXA 4DR5B 1NT2B 3GWKC 2CDYA 2Y69B 4HNAA 3FKSG 3K04A 4FZ0A 4YHHB 4YJ3A 3JD0A 5BMVB 1HNXB 4O4JA 4LF5O 2HJDA 4UV8A 2XAHA 5LXTA 2UU9O 1VEWA 5KX5B 5B5EZ 2FL4A 3MHHC 4PA3A 5KUMA 1RM1C 1FXHA 5LYJA 2B1IA 1R6NA 2YXLA 2N04A 2Q9LA 5IYZA 4B3SO 3RYCB 2GUZB 2D3OW 3QO5A 5CB4B 3PJSK 1E1QG 1JQ0A 5JCOC 5LA6B 3FYIB 3J81N 4K0KB 2YICA 3SPHA 4CH3A 1SZXA 5IWAB 4B3TO 2IU3A 1FXKB 3OR6C 1JPXA 3N2KB 2HHHO 3PN1A 3DXRA 1Q81W 1JVMA 5GW7A 4JI8O 1HNZB 3TXQA 1IJGA 5FL7G 1N33O 1JNBA 4H44B 2QTOA 1URFA 4XDJA 1UFIA 5C8YB 1IX9A 4LNUB 2AHYA 3AK3A 2F23A 2WA3A 1UPGA 5DM6V 4LR3A 4WBNB 4EB6A 1RSOB 2LW1A 5KHGA 1M1KW 1XMQO 2XUMA 1YSCA 3N2GB 5GTHZ 1N34B 1MSDA 2CGNA 3QG5A 4I9WA 3OTOB 2WLLB 4LFBB 3OTFA 1T5EA 3JD3A 4MVUA 4JYAO 2NLJC 4J10A 2UXNA 1GN3A 4DR5O 4N23A 4G27B 4DK0A 2QKCA 3K5LA 1P7GA 5TISZ 4YHHO 5L3DA 1BSMA 3BPZA 1PM9A 4QE7A 1HNXO 1XNRB 4GZRB 1I5YA 1IXMA 1BGYH 2BCCH 3GB7C 5J9PC 1PV0A 3FAVB 2WSSG 1OCZB 4P30A 2XT9A 4DW1A 4TQDA 3L75H 3BRCA 1K97A 3B8NA 1VQMV 3H1HH 4FJCC 1M9NA 3L72H 1GM7A 1NS1A 1Q86W 1KKDA 1M90W 2Q0OC 4K0KO 2OWOA 3QO7A 1RFYA 2IJHA 1ZLZA 5IWAO 3G4SV 4RQFA 3H1IH 1SS3A 1QCEA 4GLXA 1ZSPA 3G6EV 4FIPC 4EKWA 5D5PA 4K3AA 4DRXA 1EZJA 2DQ0A 2PTMA 1KKCA 4P9PA 2GDSA 1HNZO 1JR9A 3ZMZA 1R3JC 1VF6A 1VIBA 3CSXA 5DECA 4DUYB 4QE9A 2DQ3A 5FLXN 1GN2A 1N36B 1K7DA 1Y76A 2DYSC 4X1IA 4DW0A 1NTZH 2HFEC 2R72A 2ODMA
chains in the Genus database with same CATH topology
1LUWA 1AP5A 1VEWA 4JZGA 1GN3A 1LUVA 1MA1A 2QKAA 2QKCA 3EVKA 1EM1A 3KDRA 1P7GA 1GN4A 3TJTA 1BSMA 1PL4A 1XDCA 1PM9A 1BS3A 1VARA 2RCVA 4YIPA 1GN6A 2AW9A 5AG2A 4JYYA 3C3SA 2CE4A 5A9GA 4BR6A 2P4KA 1ZUQA 4F6EA 1SZXA 1I0HA 4X9QA 2ADQB 3IC9A 4YIOA 3AK1A 1WB8A 3LSUA 1JA8A 1BT8A 1EN5A 1I08A 1EN4A 1EN6A 2ADPA 1N0JA 1QNMA 1XUQA 4C7UA 1ZLZA 1XILA 1AP6A 1IDSA 1AVMA 1XREA 1ZSPA 1MNGA 4FFKA 1KKCA 4GUNA 3K9SA 3CEIA 1N0NA 2GDSA 3OT7A 1IX9A 1JR9A 1B06A 1Y67A 4E4EA 3AK3A 3KKYA 3MDSA 3BFRA 3AK2A 3DC6A 1AR4A 1MMMA 1WB7A 3RN4A 1IXBA 2CDYA 3DC5A 1GN2A 1D5NA 1ZTEA 1MSDA 1AR5A 3C3TA 3QVNA 4JZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUW A;  1AP5 A;  1VEW A;  4JZG A;  1GN3 A;  1LUV A;  1MA1 A;  2QKA A;  2QKC A;  3EVK A;  1EM1 A;  1P7G A;  1GN4 A;  3TJT A;  1BSM A;  1PL4 A;  1XDC A;  1PM9 A;  1BS3 A;  1VAR A;  2RCV A;  4YIP A;  1GN6 A;  2AW9 A;  5AG2 A;  4JYY A;  3C3S A;  2CE4 A;  5A9G A;  4BR6 A;  2P4K A;  1ZUQ A;  4F6E A;  1SZX A;  1I0H A;  4X9Q A;  2ADQ B;  3IC9 A;  4YIO A;  3AK1 A;  1WB8 A;  3LSU A;  1JA8 A;  1BT8 A;  1EN5 A;  1I08 A;  1EN4 A;  1EN6 A;  2ADP A;  1N0J A;  1QNM A;  1XUQ A;  4C7U A;  1ZLZ A;  1XIL A;  1AP6 A;  1IDS A;  1AVM A;  1XRE A;  1ZSP A;  1MNG A;  4FFK A;  1KKC A;  4GUN A;  3K9S A;  3CEI A;  1N0N A;  2GDS A;  3OT7 A;  1IX9 A;  1JR9 A;  1B06 A;  1Y67 A;  4E4E A;  3AK3 A;  3KKY A;  3MDS A;  3BFR A;  3AK2 A;  3DC6 A;  1AR4 A;  1MMM A;  1WB7 A;  3RN4 A;  1IXB A;  2CDY A;  3DC5 A;  1GN2 A;  1D5N A;  1ZTE A;  1MSD A;  1AR5 A;  3C3T A;  3QVN A;  4JZ2 A; 
#chains in the Genus database with same CATH topology
 2Q68 A;  1LNQ A;  4TOI A;  1Q5O A;  4JZG A;  2JGU A;  4BIU A;  1QLN A;  3IGA C;  1LUV A;  3AG7 A;  3KG2 A;  1MA1 A;  4RUE A;  3CCV V;  4B3R B;  4DR1 B;  2HG5 C;  4X20 B;  1N34 O;  3OTO O;  4LFB O;  1NJI W;  2HR3 A;  2QDO A;  1XMO B;  4DV2 B;  3ABL B;  3OEH G;  3OMN B;  3JAK B;  1VAR A;  4O2B B;  4ICG A;  3K08 A;  1RP3 B;  4PEL A;  4QNH B;  4IIJ A;  4W4K A;  2ZXW C;  5L3F A;  1I94 B;  3QO8 A;  4JYY A;  1WA8 B;  4BR6 A;  2GHY A;  4TT3 G;  2NN4 A;  2YEV A;  5IDJ A;  1GM9 A;  4UVB A;  1MOF A;  5B1B B;  1Q3E A;  1K33 A;  3T1H B;  1SF9 A;  2Q73 A;  2NNU A;  1KBH A;  2QE7 G;  3RYF A;  2K9P A;  5B1A C;  2M7W A;  1QNM A;  4HNA B;  5IYC O;  3A0B Z;  4YJ3 B;  1ORQ C;  2Y0P A;  3ETG A;  3B40 A;  2Q8V A;  3B09 A;  4O4J B;  2ARH A;  4LF8 O;  2KG7 A;  3L9D A;  3MAQ A;  2V4D A;  5LXT B;  5GON A;  5EBL C;  2EIL C;  4GKJ B;  4UFZ A;  1Y67 A;  4JV5 B;  5LYJ B;  3SJA C;  5HFL A;  2E5L B;  3ETE A;  4UCT A;  5CA3 A;  1MMM A;  1OCR B;  2Q7G A;  4HZ3 A;  5EK0 A;  4I50 A;  5IYZ B;  3K5N A;  2VRZ A;  5LA6 A;  2HVJ C;  1GM8 A;  4PA6 A;  2IJJ A;  1PNL A;  3W7W A;  1L1F A;  1DK1 A;  3F7Y C;  3CCR V;  4GX1 A;  4DV1 B;  2X6A A;  4EFE A;  3EFF K;  4LH7 A;  2YS8 A;  3HKD B;  4DUY O;  1QQC A;  5EBW C;  2EIM B;  1N36 O;  5FNV A;  3DXR B;  4JTC B;  4KXR A;  1H2L A;  4ZI7 A;  1Q7Y W;  1QR9 A;  4KL1 A;  1W59 A;  3U11 A;  4DV4 B;  5L3C A;  1FFT B;  3AG1 C;  4JI5 B;  4LP8 A;  2H94 A;  1YCI A;  2AW9 A;  3SYC A;  3HR0 A;  1F7Y A;  3SPC A;  3CXC U;  2BSK A;  1UJW B;  4B3R O;  3JYC A;  3IJ4 A;  2GTS A;  2B1G A;  1H2S B;  5LHG A;  4DR1 O;  1XMO O;  4DV2 O;  1JJO A;  3CCU V;  2H3O A;  1I94 O;  4QPJ A;  4FM0 A;  4EB6 B;  1VQP V;  3K0D A;  3E86 A;  4C7U A;  1NU1 H;  2ATK C;  2ZDI A;  3ZRX A;  1XNQ B;  2V1D A;  2DWE C;  2UXB B;  1DTO A;  5H2F Z;  3T1H O;  4RAI A;  3J80 N;  3KCY A;  4FFK A;  4X1Y A;  5LP6 C;  1KC8 W;  3CEI A;  3I56 V;  1HDJ A;  1OCO C;  1YXB A;  3FB6 C;  3D8C A;  4J42 A;  2CAZ C;  2L6L A;  5KLV H;  2CGO A;  4H0L B;  2HEP A;  1K4D C;  4E2L A;  3UKM A;  5KHH A;  3BFR A;  3DC6 A;  4WFF A;  1SET A;  2A79 B;  4I7Z B;  3UO2 A;  1XEQ A;  3SYA A;  2P90 A;  4JF3 A;  3HKE A;  1W0J G;  1K73 W;  1I5X A;  3B4S A;  4GKJ O;  4EEQ A;  1FFX A;  5LGU A;  4JV5 O;  5EIB D;  1WLE A;  1N4C A;  2E5L O;  1AI4 A;  2QJ1 A;  4JGS A;  3X2Q C;  2LFS A;  1QHT A;  1S0V A;  1V55 B;  1IBM B;  4AQY B;  4X65 B;  4I5S A;  4O4L A;  3WU2 Z;  3OGC C;  5B3S B;  2JGD B;  3UCS C;  4DV1 O;  2UUB B;  1H8H G;  3JAS A;  5IYB O;  4H13 B;  5BR8 B;  4FLT A;  2Q69 A;  4UVA A;  3HB3 B;  1ROP A;  2KQX A;  1DF5 A;  4PV1 B;  2EJ7 A;  5KUK A;  1MZE A;  1H2G A;  2P4K A;  1SER A;  1WP8 A;  2ADQ B;  4DV4 O;  3ASO C;  3ZS8 C;  2EIK B;  3RGB A;  1F51 A;  3M99 B;  3HPL C;  4JI5 O;  3AK1 A;  3FB8 C;  1DLB A;  3BVO A;  1SA0 A;  2XAG A;  3CCL V;  4PI0 A;  4U7N A;  2JDI G;  2RNB A;  1CXZ B;  2PUS A;  2VQE B;  1FS0 G;  1IBK B;  1M57 C;  1Y76 B;  1U96 A;  1FXV A;  4X1I B;  3W7S A;  3BHP A;  4U3J A;  4KFM A;  1VQ4 V;  5LMU B;  2RDC A;  3S3W A;  4D7S A;  1F4N A;  3D3Q A;  3RBZ A;  4X20 A;  4J9Z B;  1VF5 B;  3CRC A;  3CJH A;  3MDS A;  2HVK C;  1H5W A;  3JAK A;  1XNQ O;  4WFE A;  1M4U A;  2D2C B;  2UXB O;  3KZI Z;  1WB7 A;  2IU0 A;  2OTJ V;  4IIJ B;  3VQY A;  1MG1 A;  4FLV A;  3JCU Z;  1VQK V;  3ABK B;  4BAY A;  3B2E E;  1N32 B;  4JYB A;  1R6K A;  2YEV B;  3AG2 C;  1Q90 D;  1Z5V A;  2YXY A;  3E8G A;  1F4M A;  1YHQ V;  4MVO A;  4YY3 B;  4CC5 A;  4JYA B;  3ABT A;  3DTU B;  3EXA A;  4Z1V A;  2IW5 A;  3K5O A;  2FML A;  2F1M A;  3QF7 A;  1NR1 A;  1K8A W;  3CC2 V;  1BHB A;  3RYF B;  2KB1 A;  4H33 A;  1XDC A;  3CCJ V;  2Z5U A;  3OAA G;  2MK3 A;  3R65 A;  3OMA B;  2WLJ A;  3CCM V;  1GO3 F;  4LFC B;  1SQF A;  1XI1 A;  4AIL C;  5EC2 C;  2KG7 B;  3IAY A;  4UUJ C;  2EJR A;  5GON B;  3AG3 B;  1IBM O;  4AQY O;  1PP9 H;  2ZE8 A;  3SJQ C;  4X65 O;  3I55 V;  5BY1 A;  3AG4 C;  1Y66 A;  3O9O A;  2UUB O;  5B1O A;  4QGP A;  1ZL8 B;  3K9A A;  5E79 Z;  5DN6 G;  4CH4 A;  4CS4 A;  1NQT A;  5BR8 O;  2UXX A;  1M56 B;  2ZIO A;  1L0L H;  2ZT9 B;  4TSF G;  4DR6 B;  3RYH A;  1K5Q A;  3ZIA G;  1EFR G;  1EN5 A;  2ZCE A;  1BL8 A;  4I50 B;  1I08 A;  5JVD A;  1V54 C;  1XUQ A;  1IZ3 A;  1I7F A;  1B04 A;  1AVM A;  3ASN B;  3HKD A;  1VQO V;  5B1N A;  4CZZ A;  1MAB G;  2GBO A;  2F93 B;  1N0N A;  2VQE O;  5FNV B;  2R9I A;  1IBK O;  3K0G A;  3UT5 A;  3R66 A;  4ZI7 B;  1S5H C;  3B77 A;  3RT3 C;  3K06 A;  4IYI A;  1QLE C;  4LBE C;  4DR7 B;  4DR2 B;  1SZT A;  2QGN A;  4FM2 A;  3H9V A;  2VQF B;  5LMU O;  3WFV A;  1WPX A;  1XOU A;  2P22 C;  4RWU A;  1KUQ A;  2BSK B;  4R50 A;  3K3W A;  4GT1 A;  4MVZ A;  1KP3 A;  1H38 A;  4BWA A;  3E22 A;  1FJG B;  4AI8 A;  1TVK A;  2Y69 C;  4DV6 B;  1ZWI C;  3AEI A;  4DV3 B;  2LFR A;  1R3L C;  2DYR C;  1N32 O;  5JJJ B;  4Q20 A;  2E76 B;  3SGI A;  4MTO A;  3TK1 A;  2ITC C;  2RCV A;  4UB6 Z;  1R1B A;  4JI6 B;  5EYP A;  1GN6 A;  2R9A A;  3S3X A;  4YY3 O;  2E75 B;  4JI3 B;  1A32 A;  4PDM A;  4R6Z A;  4X1Y B;  2JRI A;  3ICX A;  3WG7 B;  3GWO A;  1AIL A;  4TWK A;  4QJF B;  2NR5 A;  3CMA V;  1AJQ A;  2DYS B;  3ZMT A;  4LFC O;  3E2E A;  3VQW A;  3JAL A;  1GK9 A;  2EUL A;  1K5S A;  1M5I A;  4W4L A;  1F23 A;  2BOB C;  2ADP A;  1CPY A;  1N0J A;  3HKE B;  2X6C A;  4ZKI A;  4LH6 A;  3D36 A;  4MVR A;  4DV0 B;  3LDC A;  1WP7 A;  1GH6 A;  1YEW A;  1FFX B;  1P84 F;  1R3K C;  4PDR A;  1CP9 A;  1FXK C;  4FLY A;  4DR6 O;  3DGE A;  4LF8 B;  3UM7 A;  3K9S A;  3TGU H;  3ZRV A;  1W0K G;  1QU7 A;  2ZIM A;  4DYL A;  2ZXW B;  4O4L B;  2P7T C;  2JGD A;  2RN9 A;  3WB1 A;  3AK2 A;  3JAS B;  1Y4M A;  4AHC A;  2GTA A;  1AR4 A;  2H8P C;  2Z3Y A;  3E8F A;  4JI7 B;  2LGW A;  3M8A A;  4P2Z A;  3SDL A;  1VQ8 V;  5JJN B;  1AR5 A;  4NXN B;  1PPJ H;  2IH1 C;  2R9R B;  4TQF A;  2OCH A;  1K9M W;  1Z5W A;  2Q0A A;  2DWD C;  4LF9 B;  4DR7 O;  5B1A B;  3ZBH A;  4DR2 O;  1EZV H;  3TCU A;  3L70 H;  3OEE G;  1Q6I A;  2QKA A;  2UXC B;  4UV9 A;  2EIJ B;  1XBL A;  3JAT A;  1ARO P;  2CH7 B;  5BXZ A;  1SA0 B;  2VQF O;  1GN4 A;  3TJT A;  1WAZ A;  1BS3 A;  1N8R W;  4BIO A;  3TET A;  4LF4 O;  2PZS A;  2OCC B;  1B6Q A;  2ZR3 A;  1H8E G;  3MD0 A;  1JJ2 U;  3CRA A;  1VF7 A;  1FJG O;  4U3J B;  5HFM A;  1GMG A;  4GX2 A;  3THO A;  4RO2 A;  4DV6 O;  2DW4 A;  4FK5 C;  4A5U B;  1HWY A;  4DV3 O;  5IY5 C;  4X9Q A;  5KMG A;  1R3I C;  2YUA A;  4RUF A;  5JCO A;  4I55 A;  4FMT A;  3CJH B;  1GKF A;  4JI6 O;  3RYI A;  4JI3 O;  2XAF A;  1H2M A;  1OCZ C;  1HNW B;  3CRR A;  3E83 A;  1KQS U;  1VQ6 V;  2JVD A;  5LGN A;  4PJ0 Z;  4L87 A;  2ZR2 A;  3W7T A;  4IHJ A;  4BW9 A;  3CC4 V;  1PNM A;  4X66 B;  4ZOL A;  2ZE5 A;  3RW0 A;  4MVM A;  5L3E A;  1DF4 A;  2A3Q A;  3SJB C;  1S77 D;  1KD1 W;  4DV0 O;  1YJN V;  4BW5 A;  1YZB A;  2LP7 A;  3ZHU A;  4NB5 A;  3C90 A;  4Z2W A;  1IXB A;  4CS2 A;  4JAU A;  1PKX A;  4FLU A;  2BTQ B;  1D5N A;  1GAX A;  2JJ2 G;  3LNN A;  1OHH G;  2OIE A;  2Y4U A;  3UQ8 A;  1AP5 A;  2OIG A;  5J2T A;  2OT5 A;  4EFB A;  4YJ2 A;  1ZL8 A;  1OCC B;  2EZP A;  2AGA A;  4JI7 O;  3RYH B;  1JOY A;  3VQX A;  4MVS A;  3CCS V;  2AXT Z;  5JVD B;  4NXN O;  5EIB C;  3JAW A;  2WLI A;  4UCV A;  3W7X A;  4HBN A;  3VBB A;  3ZJZ A;  4LF9 O;  2VWJ A;  1OCO B;  4O4I A;  1TUE B;  4FFB A;  3CC7 V;  2UXC O;  2XHB A;  4DV5 B;  1GRJ A;  2ITD C;  5H9C A;  5EZY A;  3IFX A;  4I0X B;  1G8M A;  2L35 A;  1P49 A;  3ABL C;  2B9Z A;  3UT5 B;  1NTK H;  2FB5 A;  4UXN A;  1THZ A;  4R8C A;  1BHA A;  2UUA B;  1EN4 A;  4X62 B;  1BZK A;  3RVZ A;  5LL6 Y;  4CH5 A;  1US6 A;  1TUB A;  5B1B C;  1NKD A;  4XDK A;  3H1K H;  4JI1 B;  3NR7 A;  2PI4 A;  1TAE A;  3CP1 A;  2Y4T A;  3E22 B;  4YXW G;  1HNW O;  2IBZ H;  3OT7 A;  1TVK B;  4D7T A;  1K92 A;  3IC7 A;  3HKC A;  5ITZ B;  1HR0 B;  4XDL A;  3A0R A;  2QKS A;  1FKA O;  2YXH A;  5EYP B;  1OV9 A;  4WFH A;  1XQ8 A;  4X66 O;  5H6R A;  1X4T A;  4NR1 A;  1YVW A;  1AR1 B;  3ABM B;  1DGS A;  1U97 A;  2YC0 A;  3QVN A;  3FX7 A;  2YI9 A;  1FD9 A;  5JQG A;  3FYE B;  4NYK A;  1M57 B;  1Y6X A;  4UCR A;  1QVG U;  2EIN B;  4X1K A;  3JAL B;  3KDR A;  2QWP B;  2IJI A;  4B3M B;  1O9G A;  2PGG A;  4MTX A;  5K1P A;  5AG2 A;  5LHH A;  1PD3 A;  3FD9 A;  4UB8 Z;  2EIM C;  1COW G;  1RPO A;  4PDV A;  4JYC A;  3T1Y O;  1HP8 A;  4MW3 A;  3RWR D;  5IE9 A;  3CD6 V;  4X8A A;  4OXS A;  4G28 B;  4YIO A;  1QR8 A;  1WB8 A;  1BQZ A;  1JA8 A;  2WLN A;  5JJE B;  2XND G;  4FVM A;  3O65 A;  1G4Y B;  4ABM A;  4DV5 O;  2O57 A;  1GTO A;  5LOV A;  3FFQ A;  1IDS A;  4OX9 B;  4J9Y B;  4NXM B;  5H6Q A;  2UUA O;  4X62 O;  1E79 G;  2CH7 A;  3JAT B;  4N21 A;  2P4V A;  3ETQ A;  4FM1 A;  3BA8 A;  3U0Z A;  2CK3 G;  5CBG A;  5JWP A;  4DO2 A;  2PY5 A;  5L3B A;  3OW2 U;  3JAR A;  4JI1 O;  3KCX A;  3AG4 B;  1RM1 B;  4WCE V;  1NVP D;  2BE3 A;  2QM4 A;  1KP2 A;  3JSL A;  4UCU A;  3NXS A;  1TGO A;  4TV9 A;  3ZHQ A;  4KHP B;  4MVQ A;  4FPP A;  3UO3 A;  4DV7 B;  4J11 A;  3LDE A;  5KMG B;  1HR0 O;  4I55 B;  4GYC B;  4LCU C;  3OE7 G;  3H01 A;  3RYI B;  1WJZ A;  2YDE A;  4CBC A;  4LF6 B;  1HW7 A;  2BOC C;  1Q6U A;  3K58 A;  5KHK A;  3ZRW A;  2W6J G;  3Q4H A;  3RVY A;  2WPD G;  2XTA A;  3A2F A;  1JCH A;  4WF9 V;  3HKB A;  4MT8 A;  3T2M A;  2P5O A;  5LGT A;  1VMG A;  3CWB H;  1QVF U;  5A9G A;  4IHJ B;  3ZN0 A;  3M7M X;  4ZOL B;  1SKV A;  1ZUQ A;  1AJN A;  1SQQ H;  2AHZ A;  4MTG A;  3SYQ A;  4F6E A;  5B3S C;  4B3M O;  1YI2 V;  3G71 V;  4ZIB A;  4X89 A;  2RMK B;  1ZX3 A;  2CTW A;  2ETN A;  1BQ0 A;  2OTL V;  2MW2 B;  4LWS B;  4FLZ A;  2P6J A;  1PNK A;  3LUT B;  3ETD A;  1J95 A;  5B66 Z;  1SQP H;  2WLH A;  2Q67 A;  1BE3 H;  2BTQ A;  1R73 A;  1SRY A;  2YIB A;  4HYO A;  3F7V C;  5KA5 A;  2UXD B;  2EIK C;  3B8M A;  1K34 A;  3E8B A;  1VF6 C;  5EC1 C;  5J2T B;  4YJ2 B;  5KHI A;  2DYR B;  4PI2 A;  1Q6H A;  4LFA B;  1IUR A;  2ZE6 A;  2E3C A;  2E74 B;  1YIT V;  1M93 A;  5LMN B;  4JI2 B;  2JS5 A;  2EZO A;  4JTD B;  3ZX6 A;  3KKY A;  4L8J A;  1AB3 A;  4HAM A;  4O4H B;  3JAW B;  5LP6 A;  2FTK A;  1D5A A;  1NZ6 A;  1EBO A;  2WLI B;  2B5U A;  4OX9 O;  2W0X A;  2JEX A;  3ZRS A;  5FPO A;  4NXM O;  4O4I B;  5C93 A;  2EBO A;  4FFB B;  2UUC B;  3ZHS A;  5KAI Z;  3L74 H;  2AZ2 A;  3JAM N;  4H37 A;  4K8X A;  1LUW A;  2Q6A A;  5EZY B;  4I0X A;  1VP7 A;  3K57 A;  3G80 A;  3K5M A;  2QEX V;  1B3Q A;  2IJK A;  2JJ1 G;  1YIJ V;  3CYO A;  3E89 A;  4TUY A;  4XBF A;  3OMI B;  4B08 A;  3ABK C;  2FYU H;  1WPB A;  4KHP O;  1FPO A;  4CS3 A;  2JIZ G;  3LSQ A;  4DV7 O;  1KB9 F;  1TUB B;  4YIP A;  1NR7 A;  4LF4 B;  4TV8 A;  3C3S A;  1Q8I A;  2GV9 A;  4RQE A;  3L73 H;  1KMI Z;  4LF6 O;  3ZMU A;  3CME V;  2YID A;  4DK1 A;  5A2Q N;  2QM8 A;  3JSN A;  2BTO A;  3HKC B;  2F66 C;  5ITZ A;  3BCC H;  2IH3 C;  3ZMS A;  1JFF B;  2AZ0 A;  1NTM H;  1K4C C;  1IVS A;  3AG3 C;  4UCO A;  2C2A A;  1AP6 A;  3P3N A;  3J7A U;  3SPI A;  4WFA V;  5CA0 A;  1M56 C;  5JQG B;  3K79 A;  2LO1 A;  1G1X B;  5CMU A;  3SR2 C;  2XAS A;  2Q7H A;  3ZHT A;  3WB2 A;  4JAS A;  4IYH A;  4X1K B;  2Q4P A;  2LQT A;  4Z1M G;  2LJ2 A;  5IJ0 A;  4JTA B;  2UXD O;  4ZHQ A;  3ASN C;  3BA9 A;  4UCS A;  3RN4 A;  5IY5 B;  4WFG A;  1L0N H;  2DN9 A;  2OYQ A;  4LFA O;  4J41 A;  4P9O A;  1ZTE A;  4PD4 F;  1Z2G A;  2QA4 V;  5LMN O;  4JI2 O;  3CS5 A;  1Q82 W;  2Q7E A;  4JAV A;  1W2B U;  4PA7 A;  4J80 A;  4PA9 A;  1S72 V;  4B7K A;  2A06 H;  2WLK A;  4NTX A;  2UUC O;  2CUG A;  1H2K A;  1NH2 D;  3CCQ V;  4U3F H;  1K3E A;  5LOV B;  4O2A A;  3QTC A;  2Y48 A;  1PL0 A;  4J7K A;  1AI6 A;  5CA1 A;  4OGQ B;  4X64 B;  1YTF D;  4F6R A;  1I0H A;  3IC9 A;  1L8D A;  2M6Y A;  1NI8 A;  1YF2 A;  2ZDI C;  1BT8 A;  4J7Z A;  2EIL B;  2XAQ A;  5CBF A;  3CHX A;  3ZHV A;  5J2U A;  2CTR A;  3ZN1 A;  3JAR B;  2R70 A;  1VQ7 V;  1S5J A;  2V7Q G;  2K1E A;  4QIW F;  1VQ9 V;  3WG7 C;  4GKK B;  1XL4 A;  2W6I G;  3A8T A;  2Q5Z A;  2WAM A;  3SJC C;  1V9P A;  3E8H A;  3K03 A;  4TV9 B;  1Y74 A;  4I4T A;  1XRE A;  1MZF A;  4MSW C;  3ZMV A;  1D2D A;  4DR3 B;  1BMF G;  1ZAU A;  2ZM6 B;  2HKO A;  3OUS A;  5IJ9 A;  3EHB B;  1QBZ A;  3A0H Z;  1KU9 A;  3JCZ A;  3CXH F;  1P4R A;  1IBL B;  4F4L A;  4NKG B;  3K59 A;  1OZ0 A;  3OM3 B;  3ZRW B;  3Q4H B;  5GTI Z;  4K35 A;  4ZBM A;  3HKB B;  5L3G A;  1S3J A;  2LW7 A;  3DC5 A;  2DJV A;  2VWK A;  1CEZ A;  5CBH A;  4B7E A;  4JI4 B;  1VQL V;  4MS2 A;  2A7W A;  5IT9 N;  2PF4 E;  3T1C A;  5JH7 A;  3AG1 B;  3LSS A;  1WN7 A;  4D6T H;  3D3I A;  5KA6 A;  3STL C;  1VQ5 V;  3ABU A;  5IYD O;  4LWS A;  4Q6G A;  2P06 A;  2DOS A;  2QWN B;  3FB5 C;  3EVK A;  1XNR O;  3CPW U;  2XAJ A;  5LBQ A;  1NVP B;  1PL4 A;  1J5E B;  1KEC A;  2QSA A;  5CN0 A;  2RQ6 A;  1SQG A;  2F4V B;  2ZNI A;  4KUM A;  4DUZ B;  4NTY A;  4KP4 A;  1OJH A;  2EIJ C;  2QWR B;  5BMV A;  1MSW D;  1SQV H;  1LR1 A;  4J7J A;  4NTW A;  5DED A;  4OPH A;  3T1Y B;  1YJ9 V;  5KX5 A;  2ILM A;  2OCC C;  2F95 B;  4MTF A;  4O4H A;  1E1R G;  5LP6 B;  5FPR A;  3G6B A;  5D5Q A;  1AI7 A;  4X64 O;  4JI0 B;  1XIL A;  3RYC A;  2GUZ A;  4QPK A;  5CB4 A;  1XL6 A;  5EBM C;  1WNS A;  4IL6 Z;  1MNG A;  2PI5 A;  2QWO B;  4PA4 A;  4K8Z A;  4TUY B;  3MHS C;  3P32 A;  4E4E A;  4GKK O;  2CTQ A;  3OGI B;  1FXK A;  4MW8 A;  3G67 A;  2EX3 A;  3N2K A;  4LF7 B;  4BIZ A;  3X2Q B;  4ASU G;  4G2K A;  4IGG A;  2QM7 A;  3ZCC A;  1O9H A;  4DR3 O;  2ZM6 O;  4TV8 B;  2JS3 A;  1FOU A;  2RJZ A;  5LHI A;  3C3T A;  2G38 A;  1IBL O;  1S76 D;  4DR4 B;  1G6U A;  4LC1 A;  2WLM A;  1R6T A;  5C8Y A;  3SPJ A;  1JFF A;  4LNU A;  3H1L H;  4CH6 A;  4GX0 A;  2HP8 A;  4JI4 O;  4U7O A;  2VS0 A;  3ASO B;  3L71 H;  4WBN A;  3VOU A;  3T4D A;  4FZ1 A;  1P7B A;  1RSO A;  2F43 G;  1OCC C;  2QTS A;  3F5W C;  3CRM A;  3N2G A;  5CA0 B;  2CE4 A;  2WLL A;  3CCE V;  1NBM G;  2ZKO A;  1OCR C;  1JMK C;  3OR7 C;  3OUF A;  1XHX A;  3SYO A;  2ZD9 A;  1J5E O;  1BCC H;  3E35 A;  5BZB A;  3TXS A;  1VQN V;  2F4V O;  5IJ0 B;  5KHJ A;  1FYJ A;  3LSU A;  4ZHQ B;  3JD4 A;  5H5N A;  4DUZ O;  3W7U A;  3CX5 F;  2LGQ A;  2CTP A;  4FLW A;  2ZQM A;  3FAV A;  2WWW A;  1SQX H;  2HLD G;  3WB0 A;  2HJF C;  4GUN A;  2PYL A;  1AI5 A;  2DE0 X;  4PDL A;  3SPG A;  2PYJ A;  1B06 A;  4JAA A;  2ZE7 A;  3SYP A;  1H2N A;  3AG2 B;  4JI0 O;  4LF5 B;  1FAF A;  2KKW A;  3F5T A;  2UU9 B;  4GCZ A;  2A9H A;  5E1A C;  3BY6 A;  2XOK G;  4O2A B;  3DSQ A;  3JD2 A;  3CB2 A;  2X0L A;  3CRQ A;  4I9Q A;  1SQB H;  5CA1 B;  1S5L Z;  4IT5 A;  4JZ2 A;  2KSD A;  2N74 A;  3LNM B;  3GVM A;  4F6R B;  1X59 A;  4B3S B;  4LF7 O;  3BAA A;  4DRX B;  2W0F C;  2FKX A;  3ZED A;  4X88 A;  2A0L A;  4WFB V;  1Q43 A;  3VQV A;  1EM1 A;  5J2U B;  1SES A;  2JEU A;  1RPR A;  3ABM C;  4B3T B;  4DR4 O;  3OD4 A;  2HHH B;  2YIB D;  3QNE A;  1Y74 B;  4I4T B;  3RFR A;  4JI8 B;  2Z0A A;  3ZHR A;  2EIN C;  1V54 B;  2IM9 A;  2JK5 C;  3H1J H;  4DXW A;  4JPR A;  3I5D A;  4UVC A;  1ENV A;  3LDD A;  5IJ9 B;  3APQ A;  1AJP A;  1N33 B;  3FB7 C;  1JX9 A;  3D36 C;  1NH2 B;  3U10 A;  2YIA A;  2YSU B;  3T4Z A;  4NVP A;  3APO A;  3BEH A;  5K1X A;  3OFN G;  1EN6 A;  3ML0 A;  4O2B A;  1XHZ A;  3N27 A;  1V55 C;  2QWQ B;  1QLE B;  1YTF B;  3P30 A;  2Y0I A;  5JH7 B;  1WA8 A;  2WA4 A;  4R7C A;  2GSM B;  1XMQ B;  4OPA A;  5F2V O;  2P67 A;  3STZ C;  2DMX A;  3CE2 A;  1KYO F;  2X7R B;  2ZIN A;  4PHZ A;  5KAF Z;  2QR4 A;  2ZNJ A;  3JD1 A;  2X6B A;  4CC6 A;  1TA8 A;  1YDX A;  1SC5 B;  2YI8 A;  1YJW V;  3BAB A;  3P3P A;  4GX5 A;  2N05 A;  4FLX A;  4DR5 B;  1NT2 B;  3GWK C;  2CDY A;  2Y69 B;  4HNA A;  3FKS G;  3K04 A;  4FZ0 A;  4YHH B;  4YJ3 A;  3JD0 A;  5BMV B;  1HNX B;  4O4J A;  4LF5 O;  2HJD A;  4UV8 A;  2XAH A;  5LXT A;  2UU9 O;  1VEW A;  5KX5 B;  5B5E Z;  2FL4 A;  3MHH C;  4PA3 A;  5KUM A;  1RM1 C;  1FXH A;  5LYJ A;  2B1I A;  1R6N A;  2YXL A;  2N04 A;  2Q9L A;  5IYZ A;  4B3S O;  3RYC B;  2GUZ B;  2D3O W;  3QO5 A;  5CB4 B;  3PJS K;  1E1Q G;  1JQ0 A;  5JCO C;  5LA6 B;  3FYI B;  3J81 N;  4K0K B;  2YIC A;  3SPH A;  4CH3 A;  1SZX A;  5IWA B;  4B3T O;  2IU3 A;  1FXK B;  3OR6 C;  1JPX A;  3N2K B;  2HHH O;  3PN1 A;  3DXR A;  1Q81 W;  1JVM A;  5GW7 A;  4JI8 O;  1HNZ B;  3TXQ A;  1IJG A;  5FL7 G;  1N33 O;  1JNB A;  4H44 B;  2QTO A;  1URF A;  4XDJ A;  1UFI A;  5C8Y B;  1IX9 A;  4LNU B;  2AHY A;  3AK3 A;  2F23 A;  2WA3 A;  1UPG A;  5DM6 V;  4LR3 A;  4WBN B;  4EB6 A;  1RSO B;  2LW1 A;  5KHG A;  1M1K W;  1XMQ O;  2XUM A;  1YSC A;  3N2G B;  5GTH Z;  1N34 B;  1MSD A;  2CGN A;  3QG5 A;  4I9W A;  3OTO B;  2WLL B;  4LFB B;  3OTF A;  1T5E A;  3JD3 A;  4MVU A;  4JYA O;  2NLJ C;  4J10 A;  2UXN A;  1GN3 A;  4DR5 O;  4N23 A;  4G27 B;  4DK0 A;  2QKC A;  3K5L A;  1P7G A;  5TIS Z;  4YHH O;  5L3D A;  1BSM A;  3BPZ A;  1PM9 A;  4QE7 A;  1HNX O;  1XNR B;  4GZR B;  1I5Y A;  1IXM A;  1BGY H;  2BCC H;  3GB7 C;  5J9P C;  1PV0 A;  3FAV B;  2WSS G;  1OCZ B;  4P30 A;  2XT9 A;  4DW1 A;  4TQD A;  3L75 H;  3BRC A;  1K97 A;  3B8N A;  1VQM V;  3H1H H;  4FJC C;  1M9N A;  3L72 H;  1GM7 A;  1NS1 A;  1Q86 W;  1KKD A;  1M90 W;  2Q0O C;  4K0K O;  2OWO A;  3QO7 A;  1RFY A;  2IJH A;  1ZLZ A;  5IWA O;  3G4S V;  4RQF A;  3H1I H;  1SS3 A;  1QCE A;  4GLX A;  1ZSP A;  3G6E V;  4FIP C;  4EKW A;  5D5P A;  4K3A A;  4DRX A;  1EZJ A;  2DQ0 A;  2PTM A;  1KKC A;  4P9P A;  2GDS A;  1HNZ O;  1JR9 A;  3ZMZ A;  1R3J C;  1VF6 A;  1VIB A;  3CSX A;  5DEC A;  4DUY B;  4QE9 A;  2DQ3 A;  5FLX N;  1GN2 A;  1N36 B;  1K7D A;  1Y76 A;  2DYS C;  4X1I A;  4DW0 A;  1NTZ H;  2HFE C;  2R72 A;  2ODM A; 
#chains in the Genus database with same CATH homology
 1LUW A;  1AP5 A;  1VEW A;  4JZG A;  1GN3 A;  1LUV A;  1MA1 A;  2QKA A;  2QKC A;  3EVK A;  1EM1 A;  3KDR A;  1P7G A;  1GN4 A;  3TJT A;  1BSM A;  1PL4 A;  1XDC A;  1PM9 A;  1BS3 A;  1VAR A;  2RCV A;  4YIP A;  1GN6 A;  2AW9 A;  5AG2 A;  4JYY A;  3C3S A;  2CE4 A;  5A9G A;  4BR6 A;  2P4K A;  1ZUQ A;  4F6E A;  1SZX A;  1I0H A;  4X9Q A;  2ADQ B;  3IC9 A;  4YIO A;  3AK1 A;  1WB8 A;  3LSU A;  1JA8 A;  1BT8 A;  1EN5 A;  1I08 A;  1EN4 A;  1EN6 A;  2ADP A;  1N0J A;  1QNM A;  1XUQ A;  4C7U A;  1ZLZ A;  1XIL A;  1AP6 A;  1IDS A;  1AVM A;  1XRE A;  1ZSP A;  1MNG A;  4FFK A;  1KKC A;  4GUN A;  3K9S A;  3CEI A;  1N0N A;  2GDS A;  3OT7 A;  1IX9 A;  1JR9 A;  1B06 A;  1Y67 A;  4E4E A;  3AK3 A;  3KKY A;  3MDS A;  3BFR A;  3AK2 A;  3DC6 A;  1AR4 A;  1MMM A;  1WB7 A;  3RN4 A;  1IXB A;  2CDY A;  3DC5 A;  1GN2 A;  1D5N A;  1ZTE A;  1MSD A;  1AR5 A;  3C3T A;  3QVN A;  4JZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...