4X9QA

Mnsod-3 room temperature structure
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
194
Chain Sequence
KHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn] 2, mitochondrial
publication title The structure of the Caenorhabditis elegans manganese superoxide dismutase MnSOD-3-azide complex.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 74
structure length 194
sequence length 194
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4x9qA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4x9qA02
1GN4A 1GN6A 3QVNA 2ADQB 1IXBA 1ZLZA 4X9QA 3AK3A 5AG2A 1AR5A 4FFKA 1JR9A 1GN3A 1QNMA 1KKCA 2ADPA 3OT7A 1Y67A 4C7UA 4JZGA 1B06A 1BT8A 3AK2A 1ZTEA 1N0JA 3EVKA 1WB8A 1XILA 2GDSA 3C3TA 1VARA 1MSDA 3TJTA 5A9GA 1IDSA 1XDCA 1WB7A 1LUVA 1XREA 2QKCA 3RN4A 1D5NA 1IX9A 3BFRA 4E4EA 2RCVA 1AP5A 3MDSA 1EN6A 3DC5A 2AW9A 2CDYA 3LSUA 1XUQA 1PL4A 1BSMA 1MA1A 4BR6A 3DC6A 1AR4A 1EM1A 1P7GA 1JA8A 2P4KA 3AK1A 1I08A 3KKYA 1PM9A 1EN4A 4JYYA 1MMMA 4YIPA 1AP6A 1N0NA 1VEWA 4GUNA 4JZ2A 3K9SA 1SZXA 1ZUQA 1I0HA 4YIOA 1ZSPA 1LUWA 1MNGA 1BS3A 3IC9A 1EN5A 4F6EA 2CE4A 2QKAA 1GN2A 3C3SA 1AVMA 3CEIA
chains in the Genus database with same CATH superfamily
2BTQB 4LFBB 1EBOA 1K73W 4PA4A 1F51A 4G28B 2P7TC 3HR0A 3THOA 1AJNA 2WLJA 2Q9LA 5BXZA 1M93A 1H2NA 1Y66A 4DUZO 2A06H 1JVMA 1FJGB 5IYBO 4TQFA 4WFBV 4FZ1A 4FM2A 2VRZA 2V7QG 3JATA 3ZMUA 4BIOA 4X66B 3LSSA 2GHYA 4K8ZA 1VQ6V 2Q8VA 3OGIB 4B3TB 3ZS8C 5A9GA 1QBZA 1Q81W 2QM7A 4DR7O 4ZI7A 1IDSA 4D7TA 1GKFA 3M8AA 1NS1A 1TGOA 2B5UA 4HBNA 3E8BA 1FYJA 1MZEA 1R6KA 1B6QA 4CS3A 1PD3A 3UO3A 3T1HB 4NR1A 3CXHF 3AEIA 3H1LH 4QE7A 4IGGA 4X65O 5LOVB 2YSUB 1ORQC 3ASNB 1O9HA 2M6YA 4K0KB 4UB8Z 2UXDO 4LF7B 4I5SA 4P9PA 3CSXA 2JJ2G 4IHJB 1I08A 4PI0A 2GTAA 4UV8A 2QTSA 1XBLA 1QHTA 1HNZB 4LWSA 4MTGA 1SA0A 4JAUA 4MVUA 1E1QG 2LW7A 1JFFA 3LSQA 1MNGA 2IU3A 2VWKA 3ZHRA 4MVQA 4J11A 1Q86W 4DRXB 3SJAC 3E2EA 1AJPA 2VQFO 4E2LA 2JK5C 3CCRV 4DV4B 4PHZA 1AVMA 3CEIA 3CCJV 4UVCA 3OGCC 2DYSB 4FIPC 3B2EE 3ASOC 2ZE5A 3OUSA 1ZLZA 1S5JA 2HFEC 1FJGO 1Y4MA 5AG2A 5KHGA 4FFKA 1BZKA 1NH2B 2OTJV 4ZIBA 1K5SA 4JI8B 3P30A 4X66O 1VQPV 2AGAA 4B3TO 2F93B 4X1KA 5GTHZ 2GDSA 2M7WA 1XNQO 1BHAA 3CS5A 4R8CA 1MSDA 4EFEA 4RUEA 3TJTA 4U7NA 2ZM6O 4ZBMA 4I9WA 3SYQA 5L3CA 1FAFA 1H2MA 3RYHA 2QKSA 3VQYA 3ZN1A 1L8DA 5JH7A 1VQNV 3B8NA 3JD3A 1SQQH 1HNWB 1R3JC 5B5EZ 2Q7HA 3CRRA 4O4JB 3A0RA 1AROP 2K1EA 4ZHQB 1VQMV 4DK0A 4HNAB 5JJJB 3JD1A 3Q4HA 2R70A 2R9RB 1EZJA 3K04A 4TQDA 3UKMA 4JYAB 3KKYA 3K57A 1SQPH 1HNZO 3CCSV 4X20A 3VBBA 2AZ0A 4B3SO 4CH3A 2WLKA 1WAZA 2FMLA 3ZMSA 3OTOO 1WPXA 1XMOB 1WJZA 5CA1A 4G27B 4LCUC 4BAYA 3WB1A 1AI7A 5LHHA 1OHHG 3X2QB 4LR3A 4DV4O 4EB6A 1W59A 4B3MB 4J42A 4D6TH 3AG1C 3L9DA 1GN2A 1ZL8A 1GTOA 4O4IA 4MS2A 1EZVH 4IT5A 3RBZA 2ITCC 3O65A 2R72A 1XMQB 3OAAG 4J41A 4DR4B 3QVNA 2OWOA 3G80A 1CPYA 3SYPA 4X9QA 4DW1A 1IBLB 4R6ZA 5KAIZ 4JI8O 2DW4A 4W4KA 3E86A 2WLIA 3OR7C 3P3PA 5TISZ 5BMVA 1PV0A 1GM9A 3K0DA 3FB8C 5LGUA 3W7SA 1HDJA 1JOYA 3DXRA 3FD9A 4B7KA 4O4HA 4JV5B 2EULA 4NTXA 3S3XA 1RSOA 3JAKA 3RVZA 5JJEB 4FFBA 4JI3B 5DEDA 5B1NA 5GW7A 1VQKV 1HNWO 3GB7C 1U97A 1KYOF 2OCHA 3CCMV 1W0KG 1KB9F 2AW9A 3G67A 4OPHA 2JGDB 1N8RW 3KG2A 4P30A 3JAWA 4X62B 2H3OA 2JEUA 1V54B 5ITZA 2YDEA 3B8MA 4WF9V 2IH1C 1Q5OA 1RFYA 5J2TB 3HKDB 5F2VO 2QWQB 3CHXA 1SERA 4DUYO 4I50A 3ZBHA 1P49A 3X2QC 1OJHA 4I7ZB 1NZ6A 1XMOO 3K79A 3GVMA 4CBCA 3N2GA 4KFMA 4RUFA 3CRMA 3FAVB 1LUWA 4B3MO 3AG3C 4MSWC 2QDOA 4UCVA 1TA8A 3SPJA 5L3DA 4B3RO 4XDLA 3U0ZA 4CZZA 4OX9B 3KCYA 1IBLO 4P2ZA 3O9OA 4GX5A 2YICA 2NR5A 1HNXO 4MTFA 1OCOC 3ZRWA 2P90A 1I94O 4X1YB 2ARHA 5KHJA 4H33A 4JI5B 2P5OA 4I4TB 1Y67A 1YI2V 1COWG 4UXNA 1FXKB 1R3IC 4LH7A 3NXSA 1OCRB 1WB8A 3CC2V 2BSKA 2QM8A 2PZSA 3MD0A 1P84F 3F5TA 2NN4A 4RO2A 4ZKIA 1THZA 4JI3O 2DE0X 3IFXA 3CX5F 2CGNA 1R73A 2UXBB 5BZBA 3K03A 2DJVA 3A0HZ 4LF9B 1WNSA 4JI6B 1N32B 2ZD9A 3H1IH 4Z1VA 1AI4A 4BR6A 3CJHA 2AZ2A 3DC6A 1JQ0A 3LUTB 1E79G 3RYFB 3K08A 3M7MX 2PTMA 1SC5B 3UQ8A 2ZDIC 1GMGA 1FFXA 4FLVA 4KHPO 2E76B 3ABMB 1YITV 4FVMA 3CCEV 4LF5O 1VF6C 1ZSPA 1FOUA 1K34A 1CXZB 4MVSA 4QIWF 2EIKB 4R50A 5L3GA 4RQEA 5EYPA 4OX9O 2PYJA 5LA6A 2KSDA 3B77A 1YJNV 3CE2A 5CB4A 5KMGB 4CS2A 3ZRVA 4JPRA 5GONB 3OMNB 3KZIZ 3IGAC 2CAZC 4WFAV 5EIBD 4CH6A 4PELA 3I55V 1FXKC 1NKDA 1OCRC 2Q73A 1DF4A 1Y76A 4NKGB 1KKCA 3CRCA 1B3QA 3AG7A 2E5LB 2RJZA 5KHIA 1N0JA 2AHYA 2UU9B 5K1XA 1F23A 2RMKB 2FKXA 2H94A 2YEVA 2DYRC 3M99B 3H1JH 4YHHO 2UXBO 4PDRA 2QKCA 3G4SV 5EC1C 1TVKB 3JSLA 5JQGA 5KHHA 4E4EA 4CC6A 4UFZA 5IY5B 2CTPA 2JVDA 2XAHA 3T4ZA 2UXCB 5CMUA 3RWRD 5C8YB 1H2LA 5LXTA 1I5YA 3ICXA 5IT9N 2OCCC 2N74A 3ABMC 5DECA 1NTZH 1YVWA 3HKBB 3R66A 4WFFA 2OTLV 1XEQA 3EFFK 3K3WA 3JASA 3JSNA 1ZWIC 3K5LA 3T1YO 3OTFA 1FFTB 1AP6A 1PNLA 1VEWA 1JNBA 4JI1O 2FYUH 1K4CC 4IYHA 1SZXA 1RP3B 5JCOC 5EZYA 4Z2WA 2XAQA 1Y6XA 3OEHG 5J2UA 4LFCB 1S77D 4TT3G 2KQXA 1S5LZ 3AG4C 2K9PA 1IBMO 1NR1A 4O2AA 4QPJA 1BE3H 3STZC 1PP9H 4I0XA 4TWKA 4O2BA 2X0LA 2DWEC 1M56B 3RYIB 1QU7A 4NTWA 4CC5A 4LF8B 2XAFA 2IJIA 3E83A 3N27A 3N2KA 3RYCB 2QSAA 3K0GA 4HYOA 5E1AC 5B1AC 3BPZA 4LNUA 4K3AA 3QO8A 1BQ0A 4O4LB 4NTYA 5IYZA 5LP6B 4I55B 5LHIA 4GLXA 5IY5C 3K5MA 1QLEB 3HKEA 5FNVB 5JVDA 5IYCO 2EINB 3WU2Z 2VWJA 2DOSA 5CA0A 1XDCA 2ODMA 3WFVA 1IZ3A 4FM1A 5FPRA 1HR0B 5J9PC 4UCOA 2UXXA 1Q8IA 2GSMB 5JJNB 2UXCO 1YJ9V 2YIAA 1Q7YW 5DN6G 1S0VA 2JGUA 3LNNA 4AILC 4PDMA 2JDIG 4DR1B 3G6BA 2XASA 1K4DC 3ZN0A 3FKSG 2LGWA 4JAAA 2IU0A 2EIJB 3D8CA 2L6LA 4H44B 2UUBO 3ETEA 3E8HA 1YSCA 4WFGA 4DV3O 4TV9A 3CC7V 3ZCCA 4DR6B 3K9SA 2ZNIA 3VQXA 3IC7A 5L3EA 5LHGA 4FLYA 4PA3A 3ZRSA 4LF6B 5CBGA 1M1KW 4PDVA 4DK1A 1M90W 1SQXH 4LF8O 3OFNG 2QKAA 4N21A 3IAYA 5KX5B 4IHJA 2X7RB 3A8TA 3ZMVA 5FLXN 1URFA 1K9MW 4U3JA 2Y69B 1XHZA 3U10A 1VIBA 4JI0B 2E75B 3PN1A 5IWAB 4DV0O 2XNDG 3APOA 2F23A 2EINC 3FX7A 1SS3A 2ZNJA 4LWSB 4NYKA 1SA0B 1YJWV 4LFBO 2P4VA 1UPGA 2IH3C 1SRYA 1JFFB 4FJCC 1WA8B 2CTWA 1YXBA 1OV9A 3CD6V 2ZINA 1DTOA 2UUAB 1OCZB 4KP4A 2DQ3A 2QM4A 2DMXA 4DR1O 3JARB 3K5NA 3UT5B 3RT3C 4L87A 4DV1B 1JCHA 2RDCA 5IJ9A 3OR6C 2OYQA 4DV2B 3G6EV 2QEXV 2HG5C 4ICGA 1RM1B 1XOUA 3T1HO 3ASNC 4X1KB 2ZR3A 3SPGA 3TXQA 1M4UA 3FYEB 2A3QA 4YIPA 3ABKB 1KUQA 2H8PC 2ZE6A 3QO7A 4K0KO 2RN9A 2OIGA 5B66Z 3QO5A 3MAQA 4LF7O 1HWYA 1ZUQA 3RYHB 2XUMA 1BCCH 2QWOB 4ZHQA 4JTDB 3D3QA 2EX3A 4RQFA 1S76D 3FB7C 5D5PA 2ILMA 2QE7G 4ZOLB 4UVAA 5IWAO 4J9YB 4GX0A 2VQEB 1JPXA 3E22B 3W7XA 2ITDC 4X20B 3L73H 4YY3B 4OXSA 3JCZA 1QNMA 1LNQA 4BWAA 2P06A 2DYSC 1TUEB 3RGBA 3OM3B 4GKJB 1BT8A 1JJ2U 3AK2A 3FYIB 1GH6A 4FLUA 4X1IB 2YXLA 2BOBC 2CK3G 3UM7A 3CCVV 4DR5B 3F5WC 1SETA 3K06A 4UCUA 3ZX6A 4TSFG 1NJIW 2HHHB 4QPKA 3PJSK 3EHBB 3OMAB 1KBHA 4O4IB 1KD1W 2Z5UA 1K33A 4MT8A 2DWDC 2QWPB 5EC2C 4NVPA 3J7AU 3CRAA 3DTUB 4MTOA 2P67A 1RM1C 1ZAUA 3DC5A 3W7WA 1DGSA 2GTSA 2WLIB 1Q6IA 3AG2B 1JMKC 1R1BA 1P7GA 1US6A 2QWRB 2IJJA 3DXRB 1R6TA 1KQSU 1N4CA 1VQOV 4DR3B 2C2AA 3I5DA 2WLNA 3R65A 2PGGA 3JYCA 3K5OA 2QGNA 3T4DA 3JAKB 5B1BB 3SPHA 2BCCH 2LJ2A 5LMNB 3KCXA 4YIOA 2MW2B 2IJHA 2HP8A 4TUYB 2JGDA 3T1CA 5EBWC 4JYAO 3A2FA 3CPWU 2UXNA 4B7EA 1YEWA 1J5EB 3BA9A 1NQTA 4H0LB 1GK9A 3L70H 2ZE7A 3JAWB 3KDRA 2GBOA 2VQEO 4G2KA 3WG7B 2Y4UA 4YY3O 4QE9A 2W6IG 4DR2B 2XHBA 3ABLB 2JRIA 4UUJC 1TUBA 1FPOA 3FAVA 2PI4A 4MW3A 4WBNA 1VQ7V 1Z2GA 2ZDIA 2ZR2A 2OIEA 1XMQO 4BIZA 2WA4A 4H37A 1N36B 4DR4O 2Q7EA 1F4MA 1VARA 4DW0A 1VF6A 2NLJC 2ZIMA 3BVOA 1D5NA 1U96A 4F6RA 1Q6HA 4H13B 4CH4A 4JV5O 4WFHA 4WFEA 4YJ2A 2QWNB 1FXKA 3STLC 1EFRG 5FL7G 1EM1A 4DR3O 5B1BC 1PNMA 3CRQA 2HJFC 1V54C 2JEXA 1WN7A 2ZT9B 2F95B 1V9PA 3APQA 1AR1B 4JZ2A 4X62O 4MVRA 4YJ3B 5CN0A 4BW9A 5L3FA 5DM6V 4LBEC 4DXWA 1J5EO 3BABA 3W7UA 1VQLV 1QVGU 2WPDG 1QQCA 1BMFG 1MOFA 3OUFA 2ZXWB 4NXMB 4K35A 1CP9A 3RYFA 3CCUV 3ABLC 5KUMA 3JD0A 2JJ1G 2QTOA 4PDLA 5KHKA 4JTAB 3F7VC 4DYLA 2Y0IA 3DGEA 4MTXA 2WLLA 1Q6UA 1B04A 1XQ8A 2HEPA 4LF4B 1MZFA 4EFBA 1N36O 1B06A 4UCSA 2HLDG 3TCUA 5CBHA 2W0FC 4JF3A 1FKAO 1E1RG 3BRCA 2R9IA 5JCOA 3D36C 1L1FA 5KA5A 4OPAA 5EYPB 3QF7A 3BCCH 4JI5O 3JD2A 3SJCC 2N05A 1NTMH 5H9CA 3TGUH 4TV8B 4TOIA 4UCRA 1AB3A 2DQ0A 2WLMA 4GKKB 1SQBH 2CDYA 1XUQA 2V4DA 3ZIAG 1BSMA 1Y76B 1MA1A 1P7BA 4JI4B 2OT5A 1AR4A 1BQZA 1BHBA 3AK1A 3ZHUA 2PF4E 1H2KA 4LF9O 5EBMC 5LMUB 4JI6O 2YEVB 4J7ZA 4X8AA 1N32O 1DK1A 2CTQA 4OGQB 1DLBA 1H2GA 2W0XA 2RQ6A 4DV7B 4HZ3A 2KB1A 1I0HA 5JQGB 2EIMB 1J95A 1D2DA 4MVMA 3H01A 3L72H 3WB0A 5C8YA 1BS3A 5LL6Y 1SZTA 2O57A 2YUAA 1GO3F 1MG1A 2ATKC 3HKBA 4MVZA 2EIKC 4JI7B 5LXTB 1S72V 2KG7A 1YZBA 1PPJH 4FLXA 3JAMN 2LQTA 1AJQA 2F43G 4IIJA 4XDJA 3AK3A 4LH6A 3CXCU 4QNHB 1AR5A 3H1HH 1Y74A 1BGYH 1S5HC 2CTRA 5IJ0B 3MHHC 5EZYB 2EBOA 3JD4A 4FMTA 3OE7G 1XILA 3HKCB 3RYIA 3C3TA 2W6JG 4O2AB 1KKDA 3FB5C 3QTCA 3LNMB 4X65B 3VQVA 4O2BB 2EZPA 4FK5C 1QLNA 2WWWA 1IX9A 2E5LO 4GKKO 3SR2C 2CH7B 2UU9O 2GUZB 1DF5A 3GWKC 1IVSA 4MVOA 3QG5A 4JI4O 2Q69A 4LNUB 4KUMA 5LYJB 1G8MA 4I55A 1WP8A 5H6QA 3JALA 4FLTA 1Z5VA 2BTQA 4P9OA 1Q3EA 1KMIZ 4PJ0Z 5B1OA 3ZMTA 3HKEB 4JYYA 4XBFA 2VQFB 5CA0B 3LDEA 5C93A 2NNUA 3SGIA 2XAJA 3H9VA 5LGTA 1LR1A 2MK3A 4X64B 4JYBA 4XDKA 3RFRA 1AI6A 2WSSG 1HP8A 4Q6GA 5K1PA 3JATB 2RNBA 4JI7O 3ASOB 3F7YC 1RPOA 1WLEA 1YHQV 1VQ9V 2A9HA 4UV9A 4GCZA 4J10A 1QR9A 3FB6C 4ZI7B 4LFCO 1GN4A 1GN6A 3FFQA 1VF7A 1IXBA 1M56C 3BA8A 1XNQB 4JTCB 5LOVA 1K97A 1L0LH 1GN3A 3MHSC 2ZM6B 2LP7A 4U3FH 3OT7A 4TV9B 4JZGA 4W4LA 3SDLA 4ABMA 2Y4TA 2CGOA 3EVKA 2HR3A 4JASA 2BOCC 5KX5A 1QCEA 3NR7A 4JGSA 1R3KC 5LP6C 2YIDA 1FD9A 2JS3A 1UJWB 1GRJA 3CC4V 1CEZA 1LUVA 3RN4A 1SF9A 2JS5A 1QLEC 3B4SA 5H6RA 1X59A 4QGPA 2XAGA 2YI9A 2UUCB 2CUGA 3J80N 4R7CA 3MDSA 4N23A 4DRXA 3CMEV 1EN6A 4U3JB 5IYDO 4QJFB 1G1XB 3K9AA 3P3NA 5KAFZ 1XNRB 4B3SB 1XI1A 2B9ZA 4GT1A 1S3JA 1HR0O 1WA8A 2LFRA 2YI8A 3OTOB 2X6CA 3E8FA 4NB5A 3OW2U 2A0LA 1AILA 1YDXA 1VQ8V 1MMMA 3B09A 2PI5A 3SYOA 2ZCEA 2EIJC 1WP7A 4YXWG 2QR4A 2QA4V 2QJ1A 4X64O 3ML0A 1M9NA 3AG1B 3JARA 1MABG 1GAXA 3UT5A 1K92A 2Y48A 1I7FA 3UCSC 1NTKH 4DO2A 2DN9A 2CE4A 1NBMG 1KC8W 1M57B 4L8JA 3RVYA 1NVPD 4DR6O 1IXMA 2ETNA 2YC0A 2GV9A 5KUKA 5IJ9B 1K3EA 4AQYB 1G4YB 4LF6O 2ADQB 2YXYA 3I56V 1PNKA 2IJKA 1YF2A 2WLHA 4DV6B 3SYCA 1JR9A 4O4JA 4A5UB 2PY5A 1ZX3A 4HNAA 5JH7B 2Y69C 2F1MA 2Q68A 4PV1B 5EIBC 3U11A 4EEQA 3SYAA 1GM7A 2Q4PA 3VQWA 3CB2A 4UCTA 4IL6Z 2B1GA 4JI0O 5IDJA 1AI5A 2AXTZ 4ZOLA 3Q4HB 5GTIZ 4DV5B 1TAEA 3K59A 3BAAA 2YS8A 4IYIA 1WB7A 2UUCO 2Q6AA 1F4NA 3BFRA 1FXHA 3E22A 3J81N 3UO2A 3P32A 3ZHTA 1XNRO 5H2FZ 2Y0PA 3LSUA 4DUYB 3CCQV 5FPOA 5CA1B 3CWBH 2B1IA 1VQ5V 4PD4F 1OCZC 4X1IA 4EB6B 2Z0AA 2IM9A 1JA8A 2UUAO 1I5XA 1ZL8B 1ENVA 5L3BA 2ZKOA 2YIBA 2ZIOA 1R6NA 1N34B 2KKWA 4B3RB 3ZRXA 1YTFD 3BEHA 3AG3B 4GX1A 5KLVH 4DV1O 4PA6A 1M57C 2HVJC 4DV2O 5BMVB 3ABKC 5BR8B 5B3SB 4HAMA 1HNXB 1Q82W 3SJBC 3L71H 1I94B 3ZJZA 3ZHVA 1H8HG 4AQYO 4O4HB 1XL4A 3ABTA 4Z1MG 5KA6A 1OCOB 3QNEA 3CCLV 2X6AA 1VF5B 1RSOB 3DSQA 3LDCA 4DV6O 4RWUA 3OMIB 4LC1A 3G71V 2WA3A 4FFBB 2BE3A 2E74B 1N33B 4TUYA 4KXRA 3EXAA 2F4VB 4NXNB 4JI2B 2F66C 4MW8A 3A0BZ 5J2TA 4DV5O 1X4TA 1WPBA 3HKDA 2D2CB 4PA9A 2Q0OC 4GYCB 2FB5A 2ZE8A 5ITZB 1R3LC 1FXVA 1K8AW 1XREA 4GKJO 1G6UA 1F7YA 4I50B 2RCVA 5CBFA 1SESA 4PA7A 4RAIA 3D3IA 3JCUZ 3L74H 3SPCA 3ETQA 3S3WA 3N2GB 4PI2A 4J80A 1KU9A 4DR5O 1IJGA 2Z3YA 4KHPB 2HJDA 2LW1A 2HHHO 1H8EG 3E89A 1TUBB 2R9AA 3E35A 5EK0A 1NU1H 5EBLC 4WBNB 1VQ4V 2IW5A 1Z5WA 1D5AA 4LF5B 4EKWA 1Q43A 2P4KA 4U7OA 3H1KH 1N34O 2L35A 4FPPA 1W2BU 1NT2B 1PM9A 2E3CA 4X1YA 1EN4A 3AG2C 4I4TA 5B3SC 3VOUA 3ZMZA 1N0NA 3D36A 4FZ0A 1PKXA 3ZRWB 5BR8O 4F4LA 1KECA 3HB3B 3ZHSA 3OEEG 4F6RB 3T2MA 2BTOA 1SQVH 2LFSA 4FM0A 3HPLC 2FTKA 3SPIA 3IC9A 3WB2A 2EILB 4YJ2B 3ZHQA 2BSKB 2LGQA 5LMNO 3C3SA 1NI8A 1OCCB 1YCIA 2IBZH 5HFMA 1NVPB 2VS0A 1N33O 1O9GA 4JYCA 4YJ3A 4YHHB 2F4VO 4NXNO 4JI2O 3WG7C 3LDDA 5IE9A 2ADPA 1SQGA 2X6BA 4WCEV 4LP8A 2DYRB 3CMAV 4FLWA 1IBKB 2Q67A 1VMGA 2Q7GA 4I9QA 1ZTEA 2HVKC 1HW7A 4LFAB 5E79Z 3CJHB 4B08A 4AHCA 3GWOA 4J9ZB 4DR2O 3OD4A 4JAVA 1GM8A 5JWPA 2JIZG 4FLZA 1V55B 1KP2A 1H5WA 1BL8A 1FFXB 4D7SA 3RW0A 1JJOA 1NR7A 1H2SB 2OCCB 3SJQC 2WLLB 5KMGA 1P4RA 4UVBA 5GONA 1PL4A 3T1YB 1T5EA 3ETDA 4JI1B 1YIJV 5LA6B 2XTAA 5CB4B 3C90A 1MSWD 1W0JG 1IBMB 1K7DA 2WAMA 5H5NA 4TV8A 3CP1A 1KP3A 2YXHA 1XHXA 3AG4B 4GUNA 3CYOA 2EILC 2ZQMA 2P22C 1L0NH 3E8GA 1YTFB 2FL4A 2G38A 2EJ7A 1OCCC 4GZRB 1IURA 1SKVA 1ROPA 3TXSA 4F6EA 5B1AB 1VP7A 1TVKA 1XL6A 4J7JA 3ABUA 5HFLA 1UFIA 1A32A 4BW5A 2ZXWC 2PYLA 2Q0AA 1NH2D 2HKOA 1RPRA 3BHPA 4ASUG 1IBKO 1Q90D 4NXMO 1QVFU 2D3OW 4C7UA 1QR8A 4LFAO 3BY6A 4X88A 4DUZB 4K8XA 1V55C 5BY1A 5LBQA 2V1DA 4X89A 4LF4O 3JASB 4Q20A 4DR7B 1AP5A 2A7WA 2N04A 3TK1A 2KG7B 1FS0G 3IJ4A 3ZEDA 2UUBB 4BIUA 4GX2A 4IIJB 5J2UB 5IJ0A 4DV3B 5D5QA 5CA3A 4UB6Z 1Y74B 1OZ0A 3HKCA 3RYCA 1JX9A 4I0XB 2P6JA 5LGNA 2AHZA 1H38A 3K58A 3ETGA 2UXDB 2A79B 3W7TA 3N2KB 4J7KA 4O4LA 2CH7A 4CS4A 2LO1A 2GUZA 2EJRA 5LP6A 4AI8A 2EZOA 5A2QN 1SQFA 5IYZB 5LYJA 5FNVA 4KL1A 2XOKG 3B40A 5LMUO 1M5IA 1EN5A 3L75H 2XT9A 2EIMC 4DV0B 1K5QA 1PL0A 2Q5ZA 4CH5A 4DV7O 3TETA 5JVDB 3JALB 2PUSA 2YIBD
chains in the Genus database with same CATH topology
1GN4A 1GN6A 3QVNA 2ADQB 1IXBA 1ZLZA 4X9QA 3AK3A 5AG2A 1AR5A 4FFKA 1JR9A 1GN3A 1QNMA 1KKCA 2ADPA 3OT7A 1Y67A 4C7UA 4JZGA 1B06A 1BT8A 3AK2A 1ZTEA 1N0JA 3EVKA 1WB8A 1XILA 2GDSA 3C3TA 1VARA 1MSDA 3TJTA 5A9GA 1IDSA 1XDCA 1WB7A 1LUVA 1XREA 2QKCA 3RN4A 1D5NA 1IX9A 3BFRA 4E4EA 2RCVA 1AP5A 3MDSA 1EN6A 3DC5A 2AW9A 2CDYA 3LSUA 1XUQA 1PL4A 1BSMA 1MA1A 4BR6A 3DC6A 1AR4A 1EM1A 1P7GA 1JA8A 2P4KA 3AK1A 1I08A 3KKYA 1PM9A 1EN4A 4JYYA 1MMMA 4YIPA 1AP6A 1N0NA 1VEWA 4GUNA 4JZ2A 3K9SA 1SZXA 1ZUQA 1I0HA 4YIOA 1ZSPA 1LUWA 1MNGA 1BS3A 3IC9A 1EN5A 4F6EA 2CE4A 2QKAA 1GN2A 3KDRA 3C3SA 1AVMA 3CEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GN4 A;  1GN6 A;  3QVN A;  2ADQ B;  1IXB A;  1ZLZ A;  4X9Q A;  3AK3 A;  5AG2 A;  1AR5 A;  4FFK A;  1JR9 A;  1GN3 A;  1QNM A;  1KKC A;  2ADP A;  3OT7 A;  1Y67 A;  4C7U A;  4JZG A;  1B06 A;  1BT8 A;  3AK2 A;  1ZTE A;  1N0J A;  3EVK A;  1WB8 A;  1XIL A;  2GDS A;  3C3T A;  1VAR A;  1MSD A;  3TJT A;  5A9G A;  1IDS A;  1XDC A;  1WB7 A;  1LUV A;  1XRE A;  2QKC A;  3RN4 A;  1D5N A;  1IX9 A;  3BFR A;  4E4E A;  2RCV A;  1AP5 A;  3MDS A;  1EN6 A;  3DC5 A;  2AW9 A;  2CDY A;  3LSU A;  1XUQ A;  1PL4 A;  1BSM A;  1MA1 A;  4BR6 A;  3DC6 A;  1AR4 A;  1EM1 A;  1P7G A;  1JA8 A;  2P4K A;  3AK1 A;  1I08 A;  3KKY A;  1PM9 A;  1EN4 A;  4JYY A;  1MMM A;  4YIP A;  1AP6 A;  1N0N A;  1VEW A;  4GUN A;  4JZ2 A;  3K9S A;  1SZX A;  1ZUQ A;  1I0H A;  4YIO A;  1ZSP A;  1LUW A;  1MNG A;  1BS3 A;  3IC9 A;  1EN5 A;  4F6E A;  2CE4 A;  2QKA A;  1GN2 A;  3C3S A;  1AVM A;  3CEI A; 
#chains in the Genus database with same CATH topology
 2BTQ B;  4LFB B;  1EBO A;  1K73 W;  4PA4 A;  1F51 A;  4G28 B;  2P7T C;  3HR0 A;  3THO A;  1AJN A;  2WLJ A;  2Q9L A;  5BXZ A;  1M93 A;  1H2N A;  1Y66 A;  4DUZ O;  2A06 H;  1JVM A;  1FJG B;  5IYB O;  4TQF A;  4WFB V;  4FZ1 A;  4FM2 A;  2VRZ A;  2V7Q G;  3JAT A;  3ZMU A;  4BIO A;  4X66 B;  3LSS A;  2GHY A;  4K8Z A;  1VQ6 V;  2Q8V A;  3OGI B;  4B3T B;  3ZS8 C;  5A9G A;  1QBZ A;  1Q81 W;  2QM7 A;  4DR7 O;  4ZI7 A;  1IDS A;  4D7T A;  1GKF A;  3M8A A;  1NS1 A;  1TGO A;  2B5U A;  4HBN A;  3E8B A;  1FYJ A;  1MZE A;  1R6K A;  1B6Q A;  4CS3 A;  1PD3 A;  3UO3 A;  3T1H B;  4NR1 A;  3CXH F;  3AEI A;  3H1L H;  4QE7 A;  4IGG A;  4X65 O;  5LOV B;  2YSU B;  1ORQ C;  3ASN B;  1O9H A;  2M6Y A;  4K0K B;  4UB8 Z;  2UXD O;  4LF7 B;  4I5S A;  4P9P A;  3CSX A;  2JJ2 G;  4IHJ B;  1I08 A;  4PI0 A;  2GTA A;  4UV8 A;  2QTS A;  1XBL A;  1QHT A;  1HNZ B;  4LWS A;  4MTG A;  1SA0 A;  4JAU A;  4MVU A;  1E1Q G;  2LW7 A;  1JFF A;  3LSQ A;  1MNG A;  2IU3 A;  2VWK A;  3ZHR A;  4MVQ A;  4J11 A;  1Q86 W;  4DRX B;  3SJA C;  3E2E A;  1AJP A;  2VQF O;  4E2L A;  2JK5 C;  3CCR V;  4DV4 B;  4PHZ A;  1AVM A;  3CEI A;  3CCJ V;  4UVC A;  3OGC C;  2DYS B;  4FIP C;  3B2E E;  3ASO C;  2ZE5 A;  3OUS A;  1ZLZ A;  1S5J A;  2HFE C;  1FJG O;  1Y4M A;  5AG2 A;  5KHG A;  4FFK A;  1BZK A;  1NH2 B;  2OTJ V;  4ZIB A;  1K5S A;  4JI8 B;  3P30 A;  4X66 O;  1VQP V;  2AGA A;  4B3T O;  2F93 B;  4X1K A;  5GTH Z;  2GDS A;  2M7W A;  1XNQ O;  1BHA A;  3CS5 A;  4R8C A;  1MSD A;  4EFE A;  4RUE A;  3TJT A;  4U7N A;  2ZM6 O;  4ZBM A;  4I9W A;  3SYQ A;  5L3C A;  1FAF A;  1H2M A;  3RYH A;  2QKS A;  3VQY A;  3ZN1 A;  1L8D A;  5JH7 A;  1VQN V;  3B8N A;  3JD3 A;  1SQQ H;  1HNW B;  1R3J C;  5B5E Z;  2Q7H A;  3CRR A;  4O4J B;  3A0R A;  1ARO P;  2K1E A;  4ZHQ B;  1VQM V;  4DK0 A;  4HNA B;  5JJJ B;  3JD1 A;  3Q4H A;  2R70 A;  2R9R B;  1EZJ A;  3K04 A;  4TQD A;  3UKM A;  4JYA B;  3KKY A;  3K57 A;  1SQP H;  1HNZ O;  3CCS V;  4X20 A;  3VBB A;  2AZ0 A;  4B3S O;  4CH3 A;  2WLK A;  1WAZ A;  2FML A;  3ZMS A;  3OTO O;  1WPX A;  1XMO B;  1WJZ A;  5CA1 A;  4G27 B;  4LCU C;  4BAY A;  3WB1 A;  1AI7 A;  5LHH A;  1OHH G;  3X2Q B;  4LR3 A;  4DV4 O;  4EB6 A;  1W59 A;  4B3M B;  4J42 A;  4D6T H;  3AG1 C;  3L9D A;  1GN2 A;  1ZL8 A;  1GTO A;  4O4I A;  4MS2 A;  1EZV H;  4IT5 A;  3RBZ A;  2ITC C;  3O65 A;  2R72 A;  1XMQ B;  3OAA G;  4J41 A;  4DR4 B;  3QVN A;  2OWO A;  3G80 A;  1CPY A;  3SYP A;  4X9Q A;  4DW1 A;  1IBL B;  4R6Z A;  5KAI Z;  4JI8 O;  2DW4 A;  4W4K A;  3E86 A;  2WLI A;  3OR7 C;  3P3P A;  5TIS Z;  5BMV A;  1PV0 A;  1GM9 A;  3K0D A;  3FB8 C;  5LGU A;  3W7S A;  1HDJ A;  1JOY A;  3DXR A;  3FD9 A;  4B7K A;  4O4H A;  4JV5 B;  2EUL A;  4NTX A;  3S3X A;  1RSO A;  3JAK A;  3RVZ A;  5JJE B;  4FFB A;  4JI3 B;  5DED A;  5B1N A;  5GW7 A;  1VQK V;  1HNW O;  3GB7 C;  1U97 A;  1KYO F;  2OCH A;  3CCM V;  1W0K G;  1KB9 F;  2AW9 A;  3G67 A;  4OPH A;  2JGD B;  1N8R W;  3KG2 A;  4P30 A;  3JAW A;  4X62 B;  2H3O A;  2JEU A;  1V54 B;  5ITZ A;  2YDE A;  3B8M A;  4WF9 V;  2IH1 C;  1Q5O A;  1RFY A;  5J2T B;  3HKD B;  5F2V O;  2QWQ B;  3CHX A;  1SER A;  4DUY O;  4I50 A;  3ZBH A;  1P49 A;  3X2Q C;  1OJH A;  4I7Z B;  1NZ6 A;  1XMO O;  3K79 A;  3GVM A;  4CBC A;  3N2G A;  4KFM A;  4RUF A;  3CRM A;  3FAV B;  1LUW A;  4B3M O;  3AG3 C;  4MSW C;  2QDO A;  4UCV A;  1TA8 A;  3SPJ A;  5L3D A;  4B3R O;  4XDL A;  3U0Z A;  4CZZ A;  4OX9 B;  3KCY A;  1IBL O;  4P2Z A;  3O9O A;  4GX5 A;  2YIC A;  2NR5 A;  1HNX O;  4MTF A;  1OCO C;  3ZRW A;  2P90 A;  1I94 O;  4X1Y B;  2ARH A;  5KHJ A;  4H33 A;  4JI5 B;  2P5O A;  4I4T B;  1Y67 A;  1YI2 V;  1COW G;  4UXN A;  1FXK B;  1R3I C;  4LH7 A;  3NXS A;  1OCR B;  1WB8 A;  3CC2 V;  2BSK A;  2QM8 A;  2PZS A;  3MD0 A;  1P84 F;  3F5T A;  2NN4 A;  4RO2 A;  4ZKI A;  1THZ A;  4JI3 O;  2DE0 X;  3IFX A;  3CX5 F;  2CGN A;  1R73 A;  2UXB B;  5BZB A;  3K03 A;  2DJV A;  3A0H Z;  4LF9 B;  1WNS A;  4JI6 B;  1N32 B;  2ZD9 A;  3H1I H;  4Z1V A;  1AI4 A;  4BR6 A;  3CJH A;  2AZ2 A;  3DC6 A;  1JQ0 A;  3LUT B;  1E79 G;  3RYF B;  3K08 A;  3M7M X;  2PTM A;  1SC5 B;  3UQ8 A;  2ZDI C;  1GMG A;  1FFX A;  4FLV A;  4KHP O;  2E76 B;  3ABM B;  1YIT V;  4FVM A;  3CCE V;  4LF5 O;  1VF6 C;  1ZSP A;  1FOU A;  1K34 A;  1CXZ B;  4MVS A;  4QIW F;  2EIK B;  4R50 A;  5L3G A;  4RQE A;  5EYP A;  4OX9 O;  2PYJ A;  5LA6 A;  2KSD A;  3B77 A;  1YJN V;  3CE2 A;  5CB4 A;  5KMG B;  4CS2 A;  3ZRV A;  4JPR A;  5GON B;  3OMN B;  3KZI Z;  3IGA C;  2CAZ C;  4WFA V;  5EIB D;  4CH6 A;  4PEL A;  3I55 V;  1FXK C;  1NKD A;  1OCR C;  2Q73 A;  1DF4 A;  1Y76 A;  4NKG B;  1KKC A;  3CRC A;  1B3Q A;  3AG7 A;  2E5L B;  2RJZ A;  5KHI A;  1N0J A;  2AHY A;  2UU9 B;  5K1X A;  1F23 A;  2RMK B;  2FKX A;  2H94 A;  2YEV A;  2DYR C;  3M99 B;  3H1J H;  4YHH O;  2UXB O;  4PDR A;  2QKC A;  3G4S V;  5EC1 C;  1TVK B;  3JSL A;  5JQG A;  5KHH A;  4E4E A;  4CC6 A;  4UFZ A;  5IY5 B;  2CTP A;  2JVD A;  2XAH A;  3T4Z A;  2UXC B;  5CMU A;  3RWR D;  5C8Y B;  1H2L A;  5LXT A;  1I5Y A;  3ICX A;  5IT9 N;  2OCC C;  2N74 A;  3ABM C;  5DEC A;  1NTZ H;  1YVW A;  3HKB B;  3R66 A;  4WFF A;  2OTL V;  1XEQ A;  3EFF K;  3K3W A;  3JAS A;  3JSN A;  1ZWI C;  3K5L A;  3T1Y O;  3OTF A;  1FFT B;  1AP6 A;  1PNL A;  1VEW A;  1JNB A;  4JI1 O;  2FYU H;  1K4C C;  4IYH A;  1SZX A;  1RP3 B;  5JCO C;  5EZY A;  4Z2W A;  2XAQ A;  1Y6X A;  3OEH G;  5J2U A;  4LFC B;  1S77 D;  4TT3 G;  2KQX A;  1S5L Z;  3AG4 C;  2K9P A;  1IBM O;  1NR1 A;  4O2A A;  4QPJ A;  1BE3 H;  3STZ C;  1PP9 H;  4I0X A;  4TWK A;  4O2B A;  2X0L A;  2DWE C;  1M56 B;  3RYI B;  1QU7 A;  4NTW A;  4CC5 A;  4LF8 B;  2XAF A;  2IJI A;  3E83 A;  3N27 A;  3N2K A;  3RYC B;  2QSA A;  3K0G A;  4HYO A;  5E1A C;  5B1A C;  3BPZ A;  4LNU A;  4K3A A;  3QO8 A;  1BQ0 A;  4O4L B;  4NTY A;  5IYZ A;  5LP6 B;  4I55 B;  5LHI A;  4GLX A;  5IY5 C;  3K5M A;  1QLE B;  3HKE A;  5FNV B;  5JVD A;  5IYC O;  2EIN B;  3WU2 Z;  2VWJ A;  2DOS A;  5CA0 A;  1XDC A;  2ODM A;  3WFV A;  1IZ3 A;  4FM1 A;  5FPR A;  1HR0 B;  5J9P C;  4UCO A;  2UXX A;  1Q8I A;  2GSM B;  5JJN B;  2UXC O;  1YJ9 V;  2YIA A;  1Q7Y W;  5DN6 G;  1S0V A;  2JGU A;  3LNN A;  4AIL C;  4PDM A;  2JDI G;  4DR1 B;  3G6B A;  2XAS A;  1K4D C;  3ZN0 A;  3FKS G;  2LGW A;  4JAA A;  2IU0 A;  2EIJ B;  3D8C A;  2L6L A;  4H44 B;  2UUB O;  3ETE A;  3E8H A;  1YSC A;  4WFG A;  4DV3 O;  4TV9 A;  3CC7 V;  3ZCC A;  4DR6 B;  3K9S A;  2ZNI A;  3VQX A;  3IC7 A;  5L3E A;  5LHG A;  4FLY A;  4PA3 A;  3ZRS A;  4LF6 B;  5CBG A;  1M1K W;  4PDV A;  4DK1 A;  1M90 W;  1SQX H;  4LF8 O;  3OFN G;  2QKA A;  4N21 A;  3IAY A;  5KX5 B;  4IHJ A;  2X7R B;  3A8T A;  3ZMV A;  5FLX N;  1URF A;  1K9M W;  4U3J A;  2Y69 B;  1XHZ A;  3U10 A;  1VIB A;  4JI0 B;  2E75 B;  3PN1 A;  5IWA B;  4DV0 O;  2XND G;  3APO A;  2F23 A;  2EIN C;  3FX7 A;  1SS3 A;  2ZNJ A;  4LWS B;  4NYK A;  1SA0 B;  1YJW V;  4LFB O;  2P4V A;  1UPG A;  2IH3 C;  1SRY A;  1JFF B;  4FJC C;  1WA8 B;  2CTW A;  1YXB A;  1OV9 A;  3CD6 V;  2ZIN A;  1DTO A;  2UUA B;  1OCZ B;  4KP4 A;  2DQ3 A;  2QM4 A;  2DMX A;  4DR1 O;  3JAR B;  3K5N A;  3UT5 B;  3RT3 C;  4L87 A;  4DV1 B;  1JCH A;  2RDC A;  5IJ9 A;  3OR6 C;  2OYQ A;  4DV2 B;  3G6E V;  2QEX V;  2HG5 C;  4ICG A;  1RM1 B;  1XOU A;  3T1H O;  3ASN C;  4X1K B;  2ZR3 A;  3SPG A;  3TXQ A;  1M4U A;  3FYE B;  2A3Q A;  4YIP A;  3ABK B;  1KUQ A;  2H8P C;  2ZE6 A;  3QO7 A;  4K0K O;  2RN9 A;  2OIG A;  5B66 Z;  3QO5 A;  3MAQ A;  4LF7 O;  1HWY A;  1ZUQ A;  3RYH B;  2XUM A;  1BCC H;  2QWO B;  4ZHQ A;  4JTD B;  3D3Q A;  2EX3 A;  4RQF A;  1S76 D;  3FB7 C;  5D5P A;  2ILM A;  2QE7 G;  4ZOL B;  4UVA A;  5IWA O;  4J9Y B;  4GX0 A;  2VQE B;  1JPX A;  3E22 B;  3W7X A;  2ITD C;  4X20 B;  3L73 H;  4YY3 B;  4OXS A;  3JCZ A;  1QNM A;  1LNQ A;  4BWA A;  2P06 A;  2DYS C;  1TUE B;  3RGB A;  3OM3 B;  4GKJ B;  1BT8 A;  1JJ2 U;  3AK2 A;  3FYI B;  1GH6 A;  4FLU A;  4X1I B;  2YXL A;  2BOB C;  2CK3 G;  3UM7 A;  3CCV V;  4DR5 B;  3F5W C;  1SET A;  3K06 A;  4UCU A;  3ZX6 A;  4TSF G;  1NJI W;  2HHH B;  4QPK A;  3PJS K;  3EHB B;  3OMA B;  1KBH A;  4O4I B;  1KD1 W;  2Z5U A;  1K33 A;  4MT8 A;  2DWD C;  2QWP B;  5EC2 C;  4NVP A;  3J7A U;  3CRA A;  3DTU B;  4MTO A;  2P67 A;  1RM1 C;  1ZAU A;  3DC5 A;  3W7W A;  1DGS A;  2GTS A;  2WLI B;  1Q6I A;  3AG2 B;  1JMK C;  1R1B A;  1P7G A;  1US6 A;  2QWR B;  2IJJ A;  3DXR B;  1R6T A;  1KQS U;  1N4C A;  1VQO V;  4DR3 B;  2C2A A;  3I5D A;  2WLN A;  3R65 A;  2PGG A;  3JYC A;  3K5O A;  2QGN A;  3T4D A;  3JAK B;  5B1B B;  3SPH A;  2BCC H;  2LJ2 A;  5LMN B;  3KCX A;  4YIO A;  2MW2 B;  2IJH A;  2HP8 A;  4TUY B;  2JGD A;  3T1C A;  5EBW C;  4JYA O;  3A2F A;  3CPW U;  2UXN A;  4B7E A;  1YEW A;  1J5E B;  3BA9 A;  1NQT A;  4H0L B;  1GK9 A;  3L70 H;  2ZE7 A;  3JAW B;  3KDR A;  2GBO A;  2VQE O;  4G2K A;  3WG7 B;  2Y4U A;  4YY3 O;  4QE9 A;  2W6I G;  4DR2 B;  2XHB A;  3ABL B;  2JRI A;  4UUJ C;  1TUB A;  1FPO A;  3FAV A;  2PI4 A;  4MW3 A;  4WBN A;  1VQ7 V;  1Z2G A;  2ZDI A;  2ZR2 A;  2OIE A;  1XMQ O;  4BIZ A;  2WA4 A;  4H37 A;  1N36 B;  4DR4 O;  2Q7E A;  1F4M A;  1VAR A;  4DW0 A;  1VF6 A;  2NLJ C;  2ZIM A;  3BVO A;  1D5N A;  1U96 A;  4F6R A;  1Q6H A;  4H13 B;  4CH4 A;  4JV5 O;  4WFH A;  4WFE A;  4YJ2 A;  2QWN B;  1FXK A;  3STL C;  1EFR G;  5FL7 G;  1EM1 A;  4DR3 O;  5B1B C;  1PNM A;  3CRQ A;  2HJF C;  1V54 C;  2JEX A;  1WN7 A;  2ZT9 B;  2F95 B;  1V9P A;  3APQ A;  1AR1 B;  4JZ2 A;  4X62 O;  4MVR A;  4YJ3 B;  5CN0 A;  4BW9 A;  5L3F A;  5DM6 V;  4LBE C;  4DXW A;  1J5E O;  3BAB A;  3W7U A;  1VQL V;  1QVG U;  2WPD G;  1QQC A;  1BMF G;  1MOF A;  3OUF A;  2ZXW B;  4NXM B;  4K35 A;  1CP9 A;  3RYF A;  3CCU V;  3ABL C;  5KUM A;  3JD0 A;  2JJ1 G;  2QTO A;  4PDL A;  5KHK A;  4JTA B;  3F7V C;  4DYL A;  2Y0I A;  3DGE A;  4MTX A;  2WLL A;  1Q6U A;  1B04 A;  1XQ8 A;  2HEP A;  4LF4 B;  1MZF A;  4EFB A;  1N36 O;  1B06 A;  4UCS A;  2HLD G;  3TCU A;  5CBH A;  2W0F C;  4JF3 A;  1FKA O;  1E1R G;  3BRC A;  2R9I A;  5JCO A;  3D36 C;  1L1F A;  5KA5 A;  4OPA A;  5EYP B;  3QF7 A;  3BCC H;  4JI5 O;  3JD2 A;  3SJC C;  2N05 A;  1NTM H;  5H9C A;  3TGU H;  4TV8 B;  4TOI A;  4UCR A;  1AB3 A;  2DQ0 A;  2WLM A;  4GKK B;  1SQB H;  2CDY A;  1XUQ A;  2V4D A;  3ZIA G;  1BSM A;  1Y76 B;  1MA1 A;  1P7B A;  4JI4 B;  2OT5 A;  1AR4 A;  1BQZ A;  1BHB A;  3AK1 A;  3ZHU A;  2PF4 E;  1H2K A;  4LF9 O;  5EBM C;  5LMU B;  4JI6 O;  2YEV B;  4J7Z A;  4X8A A;  1N32 O;  1DK1 A;  2CTQ A;  4OGQ B;  1DLB A;  1H2G A;  2W0X A;  2RQ6 A;  4DV7 B;  4HZ3 A;  2KB1 A;  1I0H A;  5JQG B;  2EIM B;  1J95 A;  1D2D A;  4MVM A;  3H01 A;  3L72 H;  3WB0 A;  5C8Y A;  1BS3 A;  5LL6 Y;  1SZT A;  2O57 A;  2YUA A;  1GO3 F;  1MG1 A;  2ATK C;  3HKB A;  4MVZ A;  2EIK C;  4JI7 B;  5LXT B;  1S72 V;  2KG7 A;  1YZB A;  1PPJ H;  4FLX A;  3JAM N;  2LQT A;  1AJQ A;  2F43 G;  4IIJ A;  4XDJ A;  3AK3 A;  4LH6 A;  3CXC U;  4QNH B;  1AR5 A;  3H1H H;  1Y74 A;  1BGY H;  1S5H C;  2CTR A;  5IJ0 B;  3MHH C;  5EZY B;  2EBO A;  3JD4 A;  4FMT A;  3OE7 G;  1XIL A;  3HKC B;  3RYI A;  3C3T A;  2W6J G;  4O2A B;  1KKD A;  3FB5 C;  3QTC A;  3LNM B;  4X65 B;  3VQV A;  4O2B B;  2EZP A;  4FK5 C;  1QLN A;  2WWW A;  1IX9 A;  2E5L O;  4GKK O;  3SR2 C;  2CH7 B;  2UU9 O;  2GUZ B;  1DF5 A;  3GWK C;  1IVS A;  4MVO A;  3QG5 A;  4JI4 O;  2Q69 A;  4LNU B;  4KUM A;  5LYJ B;  1G8M A;  4I55 A;  1WP8 A;  5H6Q A;  3JAL A;  4FLT A;  1Z5V A;  2BTQ A;  4P9O A;  1Q3E A;  1KMI Z;  4PJ0 Z;  5B1O A;  3ZMT A;  3HKE B;  4JYY A;  4XBF A;  2VQF B;  5CA0 B;  3LDE A;  5C93 A;  2NNU A;  3SGI A;  2XAJ A;  3H9V A;  5LGT A;  1LR1 A;  2MK3 A;  4X64 B;  4JYB A;  4XDK A;  3RFR A;  1AI6 A;  2WSS G;  1HP8 A;  4Q6G A;  5K1P A;  3JAT B;  2RNB A;  4JI7 O;  3ASO B;  3F7Y C;  1RPO A;  1WLE A;  1YHQ V;  1VQ9 V;  2A9H A;  4UV9 A;  4GCZ A;  4J10 A;  1QR9 A;  3FB6 C;  4ZI7 B;  4LFC O;  1GN4 A;  1GN6 A;  3FFQ A;  1VF7 A;  1IXB A;  1M56 C;  3BA8 A;  1XNQ B;  4JTC B;  5LOV A;  1K97 A;  1L0L H;  1GN3 A;  3MHS C;  2ZM6 B;  2LP7 A;  4U3F H;  3OT7 A;  4TV9 B;  4JZG A;  4W4L A;  3SDL A;  4ABM A;  2Y4T A;  2CGO A;  3EVK A;  2HR3 A;  4JAS A;  2BOC C;  5KX5 A;  1QCE A;  3NR7 A;  4JGS A;  1R3K C;  5LP6 C;  2YID A;  1FD9 A;  2JS3 A;  1UJW B;  1GRJ A;  3CC4 V;  1CEZ A;  1LUV A;  3RN4 A;  1SF9 A;  2JS5 A;  1QLE C;  3B4S A;  5H6R A;  1X59 A;  4QGP A;  2XAG A;  2YI9 A;  2UUC B;  2CUG A;  3J80 N;  4R7C A;  3MDS A;  4N23 A;  4DRX A;  3CME V;  1EN6 A;  4U3J B;  5IYD O;  4QJF B;  1G1X B;  3K9A A;  3P3N A;  5KAF Z;  1XNR B;  4B3S B;  1XI1 A;  2B9Z A;  4GT1 A;  1S3J A;  1HR0 O;  1WA8 A;  2LFR A;  2YI8 A;  3OTO B;  2X6C A;  3E8F A;  4NB5 A;  3OW2 U;  2A0L A;  1AIL A;  1YDX A;  1VQ8 V;  1MMM A;  3B09 A;  2PI5 A;  3SYO A;  2ZCE A;  2EIJ C;  1WP7 A;  4YXW G;  2QR4 A;  2QA4 V;  2QJ1 A;  4X64 O;  3ML0 A;  1M9N A;  3AG1 B;  3JAR A;  1MAB G;  1GAX A;  3UT5 A;  1K92 A;  2Y48 A;  1I7F A;  3UCS C;  1NTK H;  4DO2 A;  2DN9 A;  2CE4 A;  1NBM G;  1KC8 W;  1M57 B;  4L8J A;  3RVY A;  1NVP D;  4DR6 O;  1IXM A;  2ETN A;  2YC0 A;  2GV9 A;  5KUK A;  5IJ9 B;  1K3E A;  4AQY B;  1G4Y B;  4LF6 O;  2ADQ B;  2YXY A;  3I56 V;  1PNK A;  2IJK A;  1YF2 A;  2WLH A;  4DV6 B;  3SYC A;  1JR9 A;  4O4J A;  4A5U B;  2PY5 A;  1ZX3 A;  4HNA A;  5JH7 B;  2Y69 C;  2F1M A;  2Q68 A;  4PV1 B;  5EIB C;  3U11 A;  4EEQ A;  3SYA A;  1GM7 A;  2Q4P A;  3VQW A;  3CB2 A;  4UCT A;  4IL6 Z;  2B1G A;  4JI0 O;  5IDJ A;  1AI5 A;  2AXT Z;  4ZOL A;  3Q4H B;  5GTI Z;  4DV5 B;  1TAE A;  3K59 A;  3BAA A;  2YS8 A;  4IYI A;  1WB7 A;  2UUC O;  2Q6A A;  1F4N A;  3BFR A;  1FXH A;  3E22 A;  3J81 N;  3UO2 A;  3P32 A;  3ZHT A;  1XNR O;  5H2F Z;  2Y0P A;  3LSU A;  4DUY B;  3CCQ V;  5FPO A;  5CA1 B;  3CWB H;  2B1I A;  1VQ5 V;  4PD4 F;  1OCZ C;  4X1I A;  4EB6 B;  2Z0A A;  2IM9 A;  1JA8 A;  2UUA O;  1I5X A;  1ZL8 B;  1ENV A;  5L3B A;  2ZKO A;  2YIB A;  2ZIO A;  1R6N A;  1N34 B;  2KKW A;  4B3R B;  3ZRX A;  1YTF D;  3BEH A;  3AG3 B;  4GX1 A;  5KLV H;  4DV1 O;  4PA6 A;  1M57 C;  2HVJ C;  4DV2 O;  5BMV B;  3ABK C;  5BR8 B;  5B3S B;  4HAM A;  1HNX B;  1Q82 W;  3SJB C;  3L71 H;  1I94 B;  3ZJZ A;  3ZHV A;  1H8H G;  4AQY O;  4O4H B;  1XL4 A;  3ABT A;  4Z1M G;  5KA6 A;  1OCO B;  3QNE A;  3CCL V;  2X6A A;  1VF5 B;  1RSO B;  3DSQ A;  3LDC A;  4DV6 O;  4RWU A;  3OMI B;  4LC1 A;  3G71 V;  2WA3 A;  4FFB B;  2BE3 A;  2E74 B;  1N33 B;  4TUY A;  4KXR A;  3EXA A;  2F4V B;  4NXN B;  4JI2 B;  2F66 C;  4MW8 A;  3A0B Z;  5J2T A;  4DV5 O;  1X4T A;  1WPB A;  3HKD A;  2D2C B;  4PA9 A;  2Q0O C;  4GYC B;  2FB5 A;  2ZE8 A;  5ITZ B;  1R3L C;  1FXV A;  1K8A W;  1XRE A;  4GKJ O;  1G6U A;  1F7Y A;  4I50 B;  2RCV A;  5CBF A;  1SES A;  4PA7 A;  4RAI A;  3D3I A;  3JCU Z;  3L74 H;  3SPC A;  3ETQ A;  3S3W A;  3N2G B;  4PI2 A;  4J80 A;  1KU9 A;  4DR5 O;  1IJG A;  2Z3Y A;  4KHP B;  2HJD A;  2LW1 A;  2HHH O;  1H8E G;  3E89 A;  1TUB B;  2R9A A;  3E35 A;  5EK0 A;  1NU1 H;  5EBL C;  4WBN B;  1VQ4 V;  2IW5 A;  1Z5W A;  1D5A A;  4LF5 B;  4EKW A;  1Q43 A;  2P4K A;  4U7O A;  3H1K H;  1N34 O;  2L35 A;  4FPP A;  1W2B U;  1NT2 B;  1PM9 A;  2E3C A;  4X1Y A;  1EN4 A;  3AG2 C;  4I4T A;  5B3S C;  3VOU A;  3ZMZ A;  1N0N A;  3D36 A;  4FZ0 A;  1PKX A;  3ZRW B;  5BR8 O;  4F4L A;  1KEC A;  3HB3 B;  3ZHS A;  3OEE G;  4F6R B;  3T2M A;  2BTO A;  1SQV H;  2LFS A;  4FM0 A;  3HPL C;  2FTK A;  3SPI A;  3IC9 A;  3WB2 A;  2EIL B;  4YJ2 B;  3ZHQ A;  2BSK B;  2LGQ A;  5LMN O;  3C3S A;  1NI8 A;  1OCC B;  1YCI A;  2IBZ H;  5HFM A;  1NVP B;  2VS0 A;  1N33 O;  1O9G A;  4JYC A;  4YJ3 A;  4YHH B;  2F4V O;  4NXN O;  4JI2 O;  3WG7 C;  3LDD A;  5IE9 A;  2ADP A;  1SQG A;  2X6B A;  4WCE V;  4LP8 A;  2DYR B;  3CMA V;  4FLW A;  1IBK B;  2Q67 A;  1VMG A;  2Q7G A;  4I9Q A;  1ZTE A;  2HVK C;  1HW7 A;  4LFA B;  5E79 Z;  3CJH B;  4B08 A;  4AHC A;  3GWO A;  4J9Z B;  4DR2 O;  3OD4 A;  4JAV A;  1GM8 A;  5JWP A;  2JIZ G;  4FLZ A;  1V55 B;  1KP2 A;  1H5W A;  1BL8 A;  1FFX B;  4D7S A;  3RW0 A;  1JJO A;  1NR7 A;  1H2S B;  2OCC B;  3SJQ C;  2WLL B;  5KMG A;  1P4R A;  4UVB A;  5GON A;  1PL4 A;  3T1Y B;  1T5E A;  3ETD A;  4JI1 B;  1YIJ V;  5LA6 B;  2XTA A;  5CB4 B;  3C90 A;  1MSW D;  1W0J G;  1IBM B;  1K7D A;  2WAM A;  5H5N A;  4TV8 A;  3CP1 A;  1KP3 A;  2YXH A;  1XHX A;  3AG4 B;  4GUN A;  3CYO A;  2EIL C;  2ZQM A;  2P22 C;  1L0N H;  3E8G A;  1YTF B;  2FL4 A;  2G38 A;  2EJ7 A;  1OCC C;  4GZR B;  1IUR A;  1SKV A;  1ROP A;  3TXS A;  4F6E A;  5B1A B;  1VP7 A;  1TVK A;  1XL6 A;  4J7J A;  3ABU A;  5HFL A;  1UFI A;  1A32 A;  4BW5 A;  2ZXW C;  2PYL A;  2Q0A A;  1NH2 D;  2HKO A;  1RPR A;  3BHP A;  4ASU G;  1IBK O;  1Q90 D;  4NXM O;  1QVF U;  2D3O W;  4C7U A;  1QR8 A;  4LFA O;  3BY6 A;  4X88 A;  4DUZ B;  4K8X A;  1V55 C;  5BY1 A;  5LBQ A;  2V1D A;  4X89 A;  4LF4 O;  3JAS B;  4Q20 A;  4DR7 B;  1AP5 A;  2A7W A;  2N04 A;  3TK1 A;  2KG7 B;  1FS0 G;  3IJ4 A;  3ZED A;  2UUB B;  4BIU A;  4GX2 A;  4IIJ B;  5J2U B;  5IJ0 A;  4DV3 B;  5D5Q A;  5CA3 A;  4UB6 Z;  1Y74 B;  1OZ0 A;  3HKC A;  3RYC A;  1JX9 A;  4I0X B;  2P6J A;  5LGN A;  2AHZ A;  1H38 A;  3K58 A;  3ETG A;  2UXD B;  2A79 B;  3W7T A;  3N2K B;  4J7K A;  4O4L A;  2CH7 A;  4CS4 A;  2LO1 A;  2GUZ A;  2EJR A;  5LP6 A;  4AI8 A;  2EZO A;  5A2Q N;  1SQF A;  5IYZ B;  5LYJ A;  5FNV A;  4KL1 A;  2XOK G;  3B40 A;  5LMU O;  1M5I A;  1EN5 A;  3L75 H;  2XT9 A;  2EIM C;  4DV0 B;  1K5Q A;  1PL0 A;  2Q5Z A;  4CH5 A;  4DV7 O;  3TET A;  5JVD B;  3JAL B;  2PUS A;  2YIB D; 
#chains in the Genus database with same CATH homology
 1GN4 A;  1GN6 A;  3QVN A;  2ADQ B;  1IXB A;  1ZLZ A;  4X9Q A;  3AK3 A;  5AG2 A;  1AR5 A;  4FFK A;  1JR9 A;  1GN3 A;  1QNM A;  1KKC A;  2ADP A;  3OT7 A;  1Y67 A;  4C7U A;  4JZG A;  1B06 A;  1BT8 A;  3AK2 A;  1ZTE A;  1N0J A;  3EVK A;  1WB8 A;  1XIL A;  2GDS A;  3C3T A;  1VAR A;  1MSD A;  3TJT A;  5A9G A;  1IDS A;  1XDC A;  1WB7 A;  1LUV A;  1XRE A;  2QKC A;  3RN4 A;  1D5N A;  1IX9 A;  3BFR A;  4E4E A;  2RCV A;  1AP5 A;  3MDS A;  1EN6 A;  3DC5 A;  2AW9 A;  2CDY A;  3LSU A;  1XUQ A;  1PL4 A;  1BSM A;  1MA1 A;  4BR6 A;  3DC6 A;  1AR4 A;  1EM1 A;  1P7G A;  1JA8 A;  2P4K A;  3AK1 A;  1I08 A;  3KKY A;  1PM9 A;  1EN4 A;  4JYY A;  1MMM A;  4YIP A;  1AP6 A;  1N0N A;  1VEW A;  4GUN A;  4JZ2 A;  3K9S A;  1SZX A;  1ZUQ A;  1I0H A;  4YIO A;  1ZSP A;  1LUW A;  1MNG A;  1BS3 A;  3IC9 A;  1EN5 A;  4F6E A;  2CE4 A;  2QKA A;  1GN2 A;  3KDR A;  3C3S A;  1AVM A;  3CEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...