4X9QA

Mnsod-3 room temperature structure
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
194
Chain Sequence
b'KHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn] 2, mitochondrial
publication title The structure of the Caenorhabditis elegans manganese superoxide dismutase MnSOD-3-azide complex.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 74
structure length 194
sequence length 194
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4x9qA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4x9qA02
3C3TA 3RN4A 3OT7A 1MMMA 2ADQB 1IXBA 1WB8A 2GDSA 1GN6A 5AG2A 1GN2A 3DC5A 1N0NA 3QVNA 1I0HA 1IDSA 1EM1A 1XDCA 3MDSA 4X9QA 1GN4A 2QKCA 1BS3A 1BT8A 1B06A 2QKAA 5A9GA 1VEWA 1PL4A 1BSMA 1WB7A 1EN4A 1Y67A 1ZLZA 1I08A 1ZSPA 2CE4A 1AR4A 4JYYA 3TJTA 1AR5A 2AW9A 4C7UA 1AVMA 4JZ2A 3AK1A 3K9SA 4BR6A 1XILA 1LUWA 1GN3A 1IX9A 4F6EA 3CEIA 2P4KA 1ZUQA 1AP5A 1MNGA 4YIOA 3AK3A 3AK2A 4FFKA 2ADPA 3KKYA 1EN6A 1JA8A 4JZGA 3BFRA 3LSUA 4YIPA 3DC6A 1N0JA 1QNMA 1XUQA 3C3SA 3IC9A 1ZTEA 1D5NA 1EN5A 2RCVA 2CDYA 1JR9A 1MA1A 3EVKA 1XREA 1MSDA 1LUVA 1P7GA 1PM9A 1AP6A 4E4EA 1VARA 1KKCA 4GUNA 1SZXA
chains in the Genus database with same CATH superfamily
2P5OA 3QO5A 1GAXA 3BHPA 1B04A 2CAZC 2A7WA 1YI2V 3AG7A 2FL4A 1K7DA 3RYFA 5KHJA 1FJGB 1JVMA 1WN7A 4LNUA 2UU9B 2ZT9B 1YCIA 1NR7A 2KG7A 1G1XB 4H0LB 5L3DA 4DR1B 4X9QA 2D2CB 3ABKC 2UUAB 3UT5B 5LA6B 2EJRA 4FFBB 5LYJB 4JTCB 5JCOA 4QJFB 4J7ZA 1XHXA 4ZHQA 3RGBA 2RJZA 1VEWA 3PN1A 1PL4A 2HJDA 3UO3A 1BHBA 1THZA 1NTKH 1K97A 2P22C 2P4VA 3AG1B 4IHJB 3ZJZA 3VBBA 2QWRB 4ASUG 2GSMB 1V55C 3FFQA 1I94O 3CPWU 5KUKA 1Q43A 3TXQA 1NTMH 3T4DA 3LDDA 3OMNB 1IURA 2YC0A 3E8BA 2Q0OC 3MHSC 4JAUA 4GX2A 4J7KA 5C8YA 3CRQA 4I7ZB 5KAIZ 1V54B 1OHHG 1QQCA 2W0FC 1EZJA 1GMGA 2ZE5A 3JARA 2CGOA 3QF7A 1L1FA 2OIEA 2ITDC 2QJ1A 1MA1A 1Z5VA 5EYPA 3HKDB 4EB6A 1AP6A 4X1YB 4FIPC 2ATKC 2M6YA 4JI6O 4OX9B 2H94A 4DV0O 1FXKB 3IJ4A 1Q6HA 2L6LA 2QSAA 2N04A 1WB8A 2WSSG 1GN6A 2WA4A 2OTJV 3D3QA 5FLXN 3ZBHA 2DE0X 2Q69A 2EBOA 4QPKA 1MZFA 3JAKA 2IJHA 4CC5A 1FXVA 1H2GA 4FVMA 2R9RB 2VQEB 2H8PC 4OGQB 3L9DA 1XHZA 4FM1A 1J5EB 3LSSA 5EZYA 1SQQH 4RUEA 3ZRWB 2DWEC 4J80A 1IJGA 1MOFA 2DYRB 5E1AC 4H44B 2LFRA 4U3JB 3P3PA 4HZ3A 3MHHC 4MVMA 1GO3F 5EBMC 4X8AA 1N34B 5L3EA 2VS0A 1NU1H 1SA0A 3RYIB 5KLVH 4C7UA 4DV3B 1AVMA 1SERA 2XTAA 4JZ2A 3OM3B 3L73H 3CC2V 4NXNO 3OGCC 2QM4A 1M90W 3O9OA 1FXHA 2IU3A 4QNHB 1AI4A 1MNGA 3OD4A 3ZMSA 2Y0IA 4U7NA 5K1PA 1FAFA 2ZR2A 2P6JA 4JYCA 4ZI7A 3E2EA 3A0HZ 1N33B 4NTYA 2OWOA 4MS2A 4MVZA 3ETEA 3F7VC 3LSUA 4LF7B 4BAYA 3AG2C 3RYFB 3SYCA 2HJFC 3RVYA 4LNUB 5LBQA 1GTOA 1EN5A 4WFEA 4K8ZA 4MVOA 2PYLA 2KG7B 3EHBB 2GV9A 3ZHRA 2M7WA 1ZAUA 2F95B 2ZDIA 4O4HA 1XNRB 3FB6C 3LNMB 5GTIZ 4YJ3A 4ZHQB 4GKKO 4PD4F 3DTUB 3RFRA 4CH4A 4MW8A 2IU0A 5IDJA 3MAQA 2F93B 4Q20A 2P90A 4PI0A 1EM1A 2R9IA 4B3MO 1AI6A 3O65A 4PJ0Z 1WJZA 1AROP 2XAHA 2PY5A 4B3TB 1H38A 2JK5C 1JPXA 5C8YB 2Q68A 4MVQA 3ZHQA 1ZL8A 4BIOA 1XMQB 1I08A 5JJNB 3JARB 3T1HB 3ICXA 3CMAV 1Y6XA 2LGQA 2JGUA 4UCRA 4GX0A 5FNVA 5JJEB 2RNBA 5EYPB 3ABUA 1BHAA 3JYCA 4EB6B 5IWAO 2VWJA 3CRAA 1KMIZ 1PPJH 3RYHB 4DW1A 3SYOA 1RP3B 1R3LC 3QO8A 1PD3A 2HP8A 1AP5A 4JPRA 2HHHB 4JYAB 3AK2A 1VQ9V 3J80N 4EFBA 2Q7EA 2QR4A 2ZM6B 4OPHA 4WCEV 1HR0O 5EIBC 2B9ZA 3E8HA 4NXMB 1NZ6A 3RVZA 2EX3A 1X4TA 4I55A 1WAZA 3JAKB 4H37A 2UXBO 3ABMC 2Q7HA 3G71V 2KQXA 2EINB 4K8XA 3EFFK 3OEEG 2PTMA 2PI4A 1U96A 3QO7A 4O4LA 4CS2A 4LF6B 5EZYB 4DR4B 2EIMC 3RWRD 2JDIG 2Q67A 1IBLB 4MTGA 5LMUO 4GCZA 2IH1C 2DW4A 5DM6V 5JH7A 2X0LA 4X65O 2A3QA 5FPOA 1XOUA 3W7SA 1VF6A 1SA0B 4DR2O 2JJ1G 1GKFA 2E74B 2YXHA 5KHGA 2VRZA 1WA8A 4JI1B 5IY5B 1M57C 3DSQA 1NKDA 2BTOA 3AG4B 5JVDA 4CS4A 1N32B 1WPXA 1HDJA 4YXWG 5LHHA 1E1QG 4ZI7B 2JRIA 4IIJA 4FMTA 1TGOA 1OCRC 2PF4E 4MTXA 2HEPA 2GBOA 4B3SO 2AW9A 4GKJB 1JMKC 1SQBH 2Q6AA 2A06H 4BW5A 1K4DC 3CWBH 5LP6A 1K92A 1FFXB 2JGDA 3CSXA 1GH6A 2WLNA 1BE3H 4F6EA 1SESA 1OZ0A 5H6RA 3OW2U 2F23A 2QTOA 4DR3O 1Z5WA 4O4HB 3JATA 4YJ3B 3E8FA 2HKOA 3P30A 1IVSA 3BFRA 5EBWC 1JJOA 5IYZA 3JAMN 2YEVA 3X2QB 1VQ5V 4LFCB 1M4UA 3JD3A 3THOA 4IGGA 3VQYA 2ZD9A 5LA6A 1K34A 4RUFA 2KKWA 5K1XA 2Q5ZA 4JV5B 2EILB 5IT9N 2BCCH 1EZVH 2HVKC 1F4NA 1XL6A 2X6BA 4WFAV 3ASNB 3OTOO 1H8HG 3I55V 1FPOA 3F5WC 4F4LA 3H1JH 3M7MX 4DV6O 1ZL8B 1GM7A 3G6BA 5L3BA 3K5LA 1VQ8V 3T1CA 1DLBA 3DC5A 4O4JA 4F6RA 4Q6GA 4LF8B 2DYSC 2E76B 2FYUH 5FNVB 2X6AA 5C93A 4J7JA 1BMFG 3G80A 2QKCA 4JAAA 3K9AA 1S77D 1JNBA 2WLMA 3N2KA 2JEXA 2VQFB 2YUAA 4DUZO 5A9GA 2LJ2A 3F7YC 4LF5O 5LGUA 1KP2A 3ETDA 4DV5B 1YSCA 3ZRXA 4JYYA 5F2VO 4ZOLA 4X64B 4I55B 1XQ8A 3TJTA 4NR1A 4N21A 4TV9A 3P3NA 2CTRA 3LDEA 1IBKO 3CCLV 2ITCC 5LMNB 1XILA 4JF3A 4PDLA 4PI2A 1US6A 4TWKA 4LF4B 4O4LB 3CEIA 4DR6O 4B3RB 1WNSA 4X20A 1IXMA 2LW1A 3OR7C 3CP1A 4PDRA 4X66O 4DV2O 3ZN1A 1YVWA 3CCSV 1Y74A 5JH7B 4KL1A 5B1OA 4W4KA 4JI8B 4I9WA 1D5NA 3HR0A 2RCVA 2IM9A 4GLXA 4EFEA 4JI7O 3BABA 1OJHA 5BXZA 1LR1A 4EEQA 3SPJA 1S76D 1WA8B 3OEHG 1GM8A 4D7TA 3CRRA 1V9PA 3ZS8C 2F1MA 3UQ8A 4UCTA 2NN4A 2CH7A 5KMGA 3D36A 2N05A 4RAIA 2XAGA 4LC1A 5DECA 5JVDB 2ODMA 3TK1A 5CA1A 2YIAA 5AG2A 1MG1A 4IIJB 3JALA 1ENVA 4DV4B 4JI0O 3AG1C 1FOUA 2YIDA 3M99B 3A8TA 5LP6B 1QU7A 4LFBB 1AB3A 1S0VA 3L70H 2JGDB 2YS8A 3SPIA 1KD1W 2HG5C 1VQMV 4MTOA 4TQDA 4AI8A 4WBNA 3CHXA 3ETQA 2JVDA 1D2DA 3ASOB 4JYBA 3JATB 5B3SC 3HKBA 1FS0G 3AG3B 4U3FH 1V54C 5IYZB 3QNEA 3CCQV 2YEVB 4AILC 1AR5A 2JEUA 2EIJB 3CCMV 3TETA 4FLUA 2Z5UA 5KHIA 2MK3A 4YIOA 1RPOA 4UUJC 4PHZA 1EN6A 4PA4A 1FXKC 3QTCA 1I94B 1KB9F 4XDJA 2Y4UA 1QNMA 3B2EE 2DMXA 5IYDO 4O2AA 3STLC 2Q9LA 1HNXO 4A5UB 3SPCA 4YHHO 2Z3YA 4O4JB 4F6RB 2WLKA 1MSDA 2FTKA 1Q82W 3ABLB 1P7GA 5B1AB 1NQTA 1P84F 2XAJA 3H1KH 2XAQA 1QLEB 1TUEB 2QM7A 3A0BZ 3CCEV 3N2KB 2IBZH 4PV1B 4RQEA 2ZINA 4PELA 2WLHA 1MMMA 2YSUB 3LSQA 1IXBA 3JSNA 2KSDA 1VIBA 2DYRC 5EBLC 4Z1VA 4ZOLB 3K0GA 4JI6B 1A32A 4FLZA 5ITZA 4DV0B 3RYHA 3H1IH 1NTZH 4TSFG 4TV9B 1VMGA 2BTQA 2HFEC 4MTFA 1R6KA 4LWSA 5BZBA 4MSWC 3BRCA 4O2BA 1BS3A 5CA0A 2DQ0A 3ZMUA 1GRJA 4DUYO 2IW5A 4X20B 2PYJA 3CB2A 4H13B 2YI8A 1KKDA 4CC6A 3G6EV 3SJQC 1Y74B 1NR1A 4CZZA 2NNUA 4KP4A 4JI3O 5L3GA 1XNQO 1KYOF 1UPGA 3W7WA 1IBMO 1HNZO 4WF9V 4UV9A 2R9AA 2UXDO 2RN9A 3OMAB 4G2KA 4RWUA 2GUZA 5GW7A 1QVFU 2B1IA 2WWWA 3SYPA 1I7FA 1IX9A 3KG2A 4FLTA 4L8JA 4CBCA 2CH7B 5KMGB 3BCCH 2CTWA 5JQGA 2WLLA 3ZMVA 5JCOC 4DR5O 4B08A 4JI4O 5CA1B 3L74H 3JALB 3WU2Z 1TUBA 2Q8VA 4DK0A 5EK0A 4NXNB 2JIZG 2F4VO 2C2AA 4ZBMA 1VP7A 2EZOA 2GTSA 3SR2C 2BOCC 4MVSA 2UUCO 2ZNIA 4WBNB 3CYOA 5IYBO 1JX9A 4GZRB 3HKBB 3JCZA 3Q4HA 4DYLA 1T5EA 1FFXA 1K8AW 4JI5O 2EIKB 3QVNA 2Y69C 4NTXA 2QTSA 4ICGA 2NR5A 4GKKB 3NXSA 4PA6A 1XL4A 5KHKA 1CEZA 1K3EA 3ML0A 2LGWA 2W6JG 4GX5A 4BIUA 1U97A 2E5LO 1Y67A 2JJ2G 5CBFA 2EZPA 1QHTA 2QWQB 2VWKA 1JQ0A 4B3MB 4WFFA 4O2AB 5B5EZ 4W4LA 2QDOA 3ZCCA 2IJJA 1H2LA 1MZEA 1D5AA 1UJWB 1Q81W 3H9VA 3GB7C 3E83A 5IJ0A 1NJIW 4CS3A 3PJSK 2WA3A 3ZHTA 2EINC 4IYIA 2WLJA 4FFKA 2ZIMA 4BW9A 2A0LA 1F4MA 3DC6A 1LNQA 1K33A 2JS3A 4XDKA 2F66C 3FAVA 5IWAB 1VQPV 3CXCU 5J9PC 2CDYA 4JTAB 1XREA 5ITZB 4X1KA 5GTHZ 2OCCB 4LH7A 2BTQB 4LWSB 4FM0A 2CTPA 4ABMA 3JD2A 3ZHUA 1NVPB 4KHPO 4FPPA 4O2BB 3IFXA 4NTWA 3RT3C 5CA0B 3K58A 4PDVA 5BMVA 2WLIA 4GUNA 4D7SA 1HR0B 4UCUA 2DWDC 5IE9A 4CH5A 4KUMA 1YJ9V 2UXBB 2CUGA 2YXLA 3AG4C 5J2UA 2XAFA 1RFYA 1YIJV 3B77A 4JAVA 1Z2GA 1OCZC 5BR8O 4LF9O 3W7XA 3T1YO 1AI7A 2ZXWB 2GUZB 2YI9A 4B7EA 1NVPD 1K5SA 5LMUB 3FKSG 2QA4V 2OYQA 2Q0AA 4X65B 3F5TA 4HYOA 1M56B 3E89A 1Q5OA 5JQGB 2WLLB 1Q86W 3H1HH 2ZDIC 4DR2B 1N4CA 2ARHA 2N74A 4X62O 4LBEC 1TUBB 2A9HA 2XASA 4BIZA 5LHIA 1SETA 3X2QC 3AK1A 5CB4A 4DV7O 5B66Z 1LUWA 5GONA 2EILC 1YEWA 1RM1B 2QGNA 2OT5A 2P7TC 3CX5F 4B3SB 3ASNC 1H2NA 3Q4HB 1CPYA 3LNNA 3B40A 2RDCA 2IH3C 5BY1A 4QE9A 2Q7GA 4DV1O 3CCJV 3R66A 1LUVA 2Y0PA 4UB8Z 1OCOB 4DR3B 1O9GA 2ZR3A 2QKSA 1HP8A 5LGTA 4I9QA 3SJCC 1AI5A 1PNKA 2EIMB 1OCCB 3TGUH 1RSOA 2DJVA 3T2MA 3H01A 4DW0A 4NB5A 2UUBO 3DXRA 5EIBD 3VQXA 2MW2B 3RYCA 5L3FA 5B1BB 3AEIA 1CP9A 4J9ZB 3OTOB 3ETGA 3N2GA 5IJ0B 1M57B 1Q90D 3K57A 4DV6B 3CS5A 1B06A 4KFMA 2CK3G 2ILMA 1KECA 2AXTZ 1K9MW 4UB6Z 1KP3A 1N36O 1W0KG 4DR7O 1B6QA 3FAVB 2HLDG 4O4IA 3R65A 2BE3A 1XMOO 4LFAO 3JAWA 2LO1A 3SPHA 3DGEA 4JI2O 3BAAA 3OTFA 4X1KB 1H2KA 3S3XA 4YJ2A 4DUZB 4D6TH 1VQNV 4LF5B 2P67A 5BMVB 2G38A 2WLIB 1HWYA 2R70A 1PNMA 3AK3A 3K79A 1TAEA 3SPGA 3SJBC 4YIPA 3EXAA 5J2UB 2YDEA 1XUQA 5CN0A 4YY3O 2AZ2A 1IBKB 1R6NA 3IC9A 1VQLV 3NR7A 1JR9A 4TV8A 4DR6B 3E86A 1VQ4V 4FLWA 3FB7C 5FPRA 3HPLC 1SQVH 3B8MA 1JFFA 4LP8A 4TQFA 4QPJA 5H6QA 3IC7A 4X66B 5LP6C 4ZIBA 4DV2B 1N8RW 5H9CA 1EFRG 4E2LA 2X6CA 1B3QA 2BOBC 2GTAA 4PA3A 1H2MA 4JI7B 4AHCA 3WFVA 3AG3C 1WPBA 1AILA 4GYCB 1I0HA 5LL6Y 4P9PA 3GWKC 4L87A 4I4TA 5CB4B 2EIJC 1CXZB 1FYJA 4HNAA 2ZQMA 1Y4MA 5GONB 4AQYO 2FMLA 1R3IC 1QR8A 2OTLV 1MABG 3MD0A 5LOVA 1WB7A 3P32A 5HFLA 1M9NA 1SQFA 3WG7B 1ZSPA 3L75H 4UVBA 3HB3B 2BSKA 2AZ0A 1KBHA 1HNWO 2Y4TA 2UXCO 1Q6IA 3K9SA 3ZX6A 1YXBA 1K73W 1M93A 2PI5A 1ZWIC 3WB0A 4XDLA 3ABLC 4DV4O 4DO2A 1P49A 5B1AC 4K0KO 4NYKA 2AHZA 2ZE8A 4MT8A 2YXYA 1WLEA 3A2FA 1YJWV 1RSOB 1QLEC 1VQ7V 2OIGA 3H1LH 1YHQV 3GVMA 3M8AA 1DK1A 3DXRB 3C90A 4CH6A 3RYCB 3JD0A 5KA5A 3UKMA 4WFHA 4X88A 1YTFB 4ZKIA 1FJGO 3JD1A 3SJAC 2UU9O 3L71H 4EKWA 3N2GB 3CJHA 1Y66A 1PNLA 4E4EA 5CMUA 2IJKA 4DR1O 2D3OW 2UUAO 3RN4A 3J81N 3S3WA 1HNXB 4YHHB 1ORQC 4J41A 5A2QN 3FB5C 3K5MA 4NKGB 4O4IB 5KAFZ 1SRYA 1O9HA 3JAWB 1YITV 1YTFD 3FYIB 4YJ2B 3WB2A 4H33A 4DRXA 1W59A 3OAAG 4UFZA 1H5WA 3CCRV 5B3SB 4WFBV 2ZE6A 5CA3A 3D36C 1ZX3A 1SF9A 1SKVA 3ABKB 2V7QG 4TV8B 3BEHA 4FJCC 4DUYB 2QWPB 5KA6A 3K3WA 1VQ6V 1JFFB 1JOYA 3K03A 1YZBA 2P4KA 4JTDB 3D3IA 5FL7G 2HR3A 4JI3B 1XNQB 4OX9O 2QM8A 1JA8A 1IBMB 1HNZB 4FLXA 1Q6UA 1V55B 2UXDB 2XOKG 2XT9A 4RQFA 3E22A 3UCSC 3KZIZ 1ZTEA 2O57A 4P9OA 2IJIA 3CC4V 3ZIAG 2HVJC 3HKEA 2DN9A 1PM9A 1AJPA 3OFNG 5KHHA 1ROPA 2OCHA 1J95A 2EIKC 4I4TB 2Q4PA 2UXXA 3BA8A 4B7KA 2LP7A 4HNAB 1KKCA 4DR5B 2WPDG 4JI4B 4DK1A 2VQEO 1JCHA 3E8GA 1J5EO 3KDRA 5LOVB 3D8CA 1KUQA 2XNDG 3K06A 4JGSA 5H2FZ 2F4VB 5DEDA 2BSKB 4TT3G 1EBOA 4QGPA 1IDSA 3BVOA 2UUCB 1BQ0A 1UFIA 1FKAO 2ZIOA 2ZE7A 1N34O 3LDCA 3RW0A 4DV3O 1NS1A 1XEQA 1AJQA 1PL0A 1M1KW 4JI5B 1GK9A 1PV0A 5LHGA 3B8NA 2CE4A 1AR4A 2V4DA 4MVUA 1DF4A 4I50A 1N33O 2QE7G 4LF7O 3FX7A 4G28B 4X89A 1OV9A 4I0XA 2B5UA 1QR9A 3FYEB 1SQXH 3CJHB 1R3KC 2FKXA 2W0XA 4K3AA 2E5LB 2OCCC 4WFGA 1KQSU 1X59A 4P2ZA 4JZGA 3CXHF 4XBFA 3KCYA 4U7OA 1N0JA 1XNRO 3CRMA 3J7AU 1DF5A 3JCUZ 3FD9A 2R72A 3T4ZA 3ZN0A 4HBNA 4DXWA 3UO2A 2DOSA 1RPRA 1H8EG 2LW7A 2V1DA 1E79G 3ZRVA 3IAYA 1DTOA 2ZXWC 2WAMA 1S72V 4DRXB 1W0JG 2UXNA 4JASA 1Q7YW 3AG2B 2NLJC 3JSLA 4B3TO 3G4SV 3VOUA 2GDSA 2YIBA 1XBLA 5KX5A 1F51A 1M56C 1GN2A 2XUMA 5B1NA 3CRCA 3ZHSA 1IZ3A 5HFMA 4KHPB 4FM2A 3CMEV 4J10A 3ZMTA 1XMQO 4BWAA 4OXSA 2Y69B 3K5NA 2RMKB 1BL8A 1NI8A 3T1HO 1GN4A 3JASA 4UV8A 5IY5C 5IYCO 2ETNA 3BY6A 5H5NA 3ZHVA 3LUTB 4J11A 1WP7A 1NT2B 1GM9A 1G6UA 2Q73A 2QKAA 4LH6A 2EULA 3OR6C 1BSMA 4TUYA 1NH2B 2QWOB 1VQKV 1EN4A 5BR8B 1RM1C 4LF9B 2HHHO 5IJ9A 4JYAO 3T1YB 3UM7A 3ZEDA 3W7UA 4IYHA 3E22B 3N27A 2ZM6O 4R50A 1QLNA 1BCCH 4FK5C 4PA7A 4G27B 5D5QA 4UXNA 1YJNV 2P06A 2B1GA 3HKEB 4NXMO 4PDMA 1M5IA 1QBZA 3RBZA 4BR6A 1MSWD 1P4RA 1R6TA 4UVAA 1WP8A 2LFSA 3HKCA 4FLYA 3L72H 1OCOC 2CTQA 3CCUV 5EC1C 4I5SA 4R8CA 4LR3A 1NH2D 1K4CC 4GT1A 4LF6O 4X62B 1XI1A 1OCCC 3ZRSA 4DR4O 1TVKA 1S3JA 5EC2C 2ZCEA 1IBLO 5LXTA 3I56V 4DV7B 4UCOA 3EVKA 4OPAA 2AHYA 1VF7A 1SQPH 5B1BC 4X1IA 1TA8A 4QIWF 1Y76A 2PGGA 4JI1O 3CE2A 3OT7A 1SC5B 5J2TA 4P30A 2A79B 4DV1B 1VQOV 3ABMB 1N32O 4MVRA 1OCZB 2K9PA 1N0NA 2ZNJA 3E35A 1L0NH 4I50B 1NBMG 4R6ZA 1QCEA 4I0XB 4LCUC 2LQTA 1SQGA 4GKJO 1I5YA 4N23A 3OE7G 3APOA 2UUBB 1P7BA 1COWG 3U10A 1KC8W 3KCXA 4TOIA 1DGSA 4UCSA 3VQVA 4CH3A 3GWOA 3CC7V 4PA9A 5E79Z 5LGNA 2E3CA 3STZC 3CD6V 3OUSA 3K04A 4GX1A 1L0LH 3BPZA 3TCUA 4FZ0A 2Y48A 1BQZA 3UT5A 4FFBA 4LFCO 5LYJA 3FB8C 1GN3A 4UVCA 4FLVA 1H2SB 1ZUQA 4JV5O 5CBHA 3SGIA 1OCRB 1N36B 4RO2A 2ADPA 3KKYA 4DR7B 1XMOB 4IHJA 4LFAB 1JJ2U 3OUFA 4NVPA 4IT5A 3VQWA 4JI2B 5KX5B 3C3SA 3ABTA 3SYQA 4UCVA 2QEXV 5JJJB 5TISZ 1W2BU 1L8DA 2W6IG 1F23A 1VF6C 2F43G 2L35A 1S5JA 2PUSA 3G67A 5L3CA 1K5QA 2YICA 5DN6G 1QVGU 3JASB 4LF8O 1VARA 2XHBA 3BA9A 1Q3EA 1FFTB 3B4SA 3C3TA 4YY3B 2PZSA 1R3JC 3K08A 2ADQB 4J42A 2CGNA 3OGIB 4TUYB 1PP9H 2YIBD 2VQFO 3B09A 5IJ9B 1E1RG 3WG7C 2EJ7A 3HKDA 1R1BA 2AGAA 4DV5O 1XDCA 4HAMA 4FZ1A 3MDSA 4X1YA 1VF5B 4X64O 3SYAA 3OMIB 4QE7A 1BT8A 3IGAC 5D5PA 1FXKA 5KUMA 2X7RB 3CCVV 3HKCB 5LMNO 3ASOC 2E75B 4Z2WA 4B3RO 4LF4O 1ZLZA 1Q8IA 1YDXA 1AR1B 1SS3A 1HW7A 2DYSB 1TVKB 5CBGA 3U11A 5LXTB 2ZKOA 3JD4A 4K35A 3K0DA 4AQYB 5JWPA 4JI8O 3APQA 4MW3A 2GHYA 1KU9A 4X1IB 1F7YA 1R73A 1S5LZ 4JI0B 3ZRWA 1G4YB 1Y76B 2KB1A 4IL6Z 3ZMZA 4U3JA 2K1EA 3A0RA 5J2TB 3QG5A 3WB1A 3U0ZA 1HNWB 1AJNA 2QWNB 2UXCB 1FD9A 1URFA 3K59A 2FB5A 1BZKA 3K5OA 1I5XA 2DQ3A 1G8MA 4Z1MG 3RYIA 1S5HC 3SDLA 1BGYH 4J9YB 4K0KB 3I5DA 4KXRA 2H3OA 2RQ6A 1PKXA 2Z0AA 3TXSA 1YF2A 3W7TA 2JS5A 1SZTA 4R7CA 4LFBO 1SZXA
chains in the Genus database with same CATH topology
3C3TA 3RN4A 3OT7A 1MMMA 2ADQB 3KDRA 1IXBA 1WB8A 2GDSA 1GN6A 5AG2A 1GN2A 3DC5A 1N0NA 3QVNA 1I0HA 1IDSA 1EM1A 1XDCA 3MDSA 4X9QA 1GN4A 2QKCA 1BS3A 1BT8A 1B06A 2QKAA 5A9GA 1VEWA 1PL4A 1BSMA 1WB7A 1EN4A 1Y67A 1ZLZA 1I08A 1ZSPA 2CE4A 1AR4A 4JYYA 3TJTA 1AR5A 2AW9A 4C7UA 1AVMA 4JZ2A 3AK1A 3K9SA 4BR6A 1XILA 1LUWA 1GN3A 1IX9A 4F6EA 3CEIA 2P4KA 1ZUQA 1AP5A 1MNGA 4YIOA 3AK3A 3AK2A 4FFKA 2ADPA 3KKYA 1EN6A 1JA8A 4JZGA 3BFRA 3LSUA 4YIPA 3DC6A 1N0JA 1QNMA 1XUQA 3C3SA 3IC9A 1ZTEA 1D5NA 1EN5A 2RCVA 2CDYA 1JR9A 1MA1A 3EVKA 1XREA 1MSDA 1LUVA 1P7GA 1PM9A 1AP6A 4E4EA 1VARA 1KKCA 4GUNA 1SZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C3T A;  3RN4 A;  3OT7 A;  1MMM A;  2ADQ B;  1IXB A;  1WB8 A;  2GDS A;  1GN6 A;  5AG2 A;  1GN2 A;  3DC5 A;  1N0N A;  3QVN A;  1I0H A;  1IDS A;  1EM1 A;  1XDC A;  3MDS A;  4X9Q A;  1GN4 A;  2QKC A;  1BS3 A;  1BT8 A;  1B06 A;  2QKA A;  5A9G A;  1VEW A;  1PL4 A;  1BSM A;  1WB7 A;  1EN4 A;  1Y67 A;  1ZLZ A;  1I08 A;  1ZSP A;  2CE4 A;  1AR4 A;  4JYY A;  3TJT A;  1AR5 A;  2AW9 A;  4C7U A;  1AVM A;  4JZ2 A;  3AK1 A;  3K9S A;  4BR6 A;  1XIL A;  1LUW A;  1GN3 A;  1IX9 A;  4F6E A;  3CEI A;  2P4K A;  1ZUQ A;  1AP5 A;  1MNG A;  4YIO A;  3AK3 A;  3AK2 A;  4FFK A;  2ADP A;  3KKY A;  1EN6 A;  1JA8 A;  4JZG A;  3BFR A;  3LSU A;  4YIP A;  3DC6 A;  1N0J A;  1QNM A;  1XUQ A;  3C3S A;  3IC9 A;  1ZTE A;  1D5N A;  1EN5 A;  2RCV A;  2CDY A;  1JR9 A;  1MA1 A;  3EVK A;  1XRE A;  1MSD A;  1LUV A;  1P7G A;  1PM9 A;  1AP6 A;  4E4E A;  1VAR A;  1KKC A;  4GUN A;  1SZX A; 
#chains in the Genus database with same CATH topology
 2P5O A;  3QO5 A;  1GAX A;  3BHP A;  1B04 A;  2CAZ C;  2A7W A;  1YI2 V;  3AG7 A;  2FL4 A;  1K7D A;  3RYF A;  5KHJ A;  1FJG B;  1JVM A;  1WN7 A;  4LNU A;  2UU9 B;  2ZT9 B;  1YCI A;  1NR7 A;  2KG7 A;  1G1X B;  4H0L B;  5L3D A;  4DR1 B;  4X9Q A;  2D2C B;  3ABK C;  2UUA B;  3UT5 B;  5LA6 B;  2EJR A;  4FFB B;  5LYJ B;  4JTC B;  5JCO A;  4QJF B;  4J7Z A;  1XHX A;  4ZHQ A;  3RGB A;  2RJZ A;  1VEW A;  3PN1 A;  1PL4 A;  2HJD A;  3UO3 A;  1BHB A;  1THZ A;  1NTK H;  1K97 A;  2P22 C;  2P4V A;  3AG1 B;  4IHJ B;  3ZJZ A;  3VBB A;  2QWR B;  4ASU G;  2GSM B;  1V55 C;  3FFQ A;  1I94 O;  3CPW U;  5KUK A;  1Q43 A;  3TXQ A;  1NTM H;  3T4D A;  3LDD A;  3OMN B;  1IUR A;  2YC0 A;  3E8B A;  2Q0O C;  3MHS C;  4JAU A;  4GX2 A;  4J7K A;  5C8Y A;  3CRQ A;  4I7Z B;  5KAI Z;  1V54 B;  1OHH G;  1QQC A;  2W0F C;  1EZJ A;  1GMG A;  2ZE5 A;  3JAR A;  2CGO A;  3QF7 A;  1L1F A;  2OIE A;  2ITD C;  2QJ1 A;  1MA1 A;  1Z5V A;  5EYP A;  3HKD B;  4EB6 A;  1AP6 A;  4X1Y B;  4FIP C;  2ATK C;  2M6Y A;  4JI6 O;  4OX9 B;  2H94 A;  4DV0 O;  1FXK B;  3IJ4 A;  1Q6H A;  2L6L A;  2QSA A;  2N04 A;  1WB8 A;  2WSS G;  1GN6 A;  2WA4 A;  2OTJ V;  3D3Q A;  5FLX N;  3ZBH A;  2DE0 X;  2Q69 A;  2EBO A;  4QPK A;  1MZF A;  3JAK A;  2IJH A;  4CC5 A;  1FXV A;  1H2G A;  4FVM A;  2R9R B;  2VQE B;  2H8P C;  4OGQ B;  3L9D A;  1XHZ A;  4FM1 A;  1J5E B;  3LSS A;  5EZY A;  1SQQ H;  4RUE A;  3ZRW B;  2DWE C;  4J80 A;  1IJG A;  1MOF A;  2DYR B;  5E1A C;  4H44 B;  2LFR A;  4U3J B;  3P3P A;  4HZ3 A;  3MHH C;  4MVM A;  1GO3 F;  5EBM C;  4X8A A;  1N34 B;  5L3E A;  2VS0 A;  1NU1 H;  1SA0 A;  3RYI B;  5KLV H;  4C7U A;  4DV3 B;  1AVM A;  1SER A;  2XTA A;  4JZ2 A;  3OM3 B;  3L73 H;  3CC2 V;  4NXN O;  3OGC C;  2QM4 A;  1M90 W;  3O9O A;  1FXH A;  2IU3 A;  4QNH B;  1AI4 A;  1MNG A;  3OD4 A;  3ZMS A;  2Y0I A;  4U7N A;  5K1P A;  1FAF A;  2ZR2 A;  2P6J A;  4JYC A;  4ZI7 A;  3E2E A;  3A0H Z;  1N33 B;  4NTY A;  2OWO A;  4MS2 A;  4MVZ A;  3ETE A;  3F7V C;  3LSU A;  4LF7 B;  4BAY A;  3AG2 C;  3RYF B;  3SYC A;  2HJF C;  3RVY A;  4LNU B;  5LBQ A;  1GTO A;  1EN5 A;  4WFE A;  4K8Z A;  4MVO A;  2PYL A;  2KG7 B;  3EHB B;  2GV9 A;  3ZHR A;  2M7W A;  1ZAU A;  2F95 B;  2ZDI A;  4O4H A;  1XNR B;  3FB6 C;  3LNM B;  5GTI Z;  4YJ3 A;  4ZHQ B;  4GKK O;  4PD4 F;  3DTU B;  3RFR A;  4CH4 A;  4MW8 A;  2IU0 A;  5IDJ A;  3MAQ A;  2F93 B;  4Q20 A;  2P90 A;  4PI0 A;  1EM1 A;  2R9I A;  4B3M O;  1AI6 A;  3O65 A;  4PJ0 Z;  1WJZ A;  1ARO P;  2XAH A;  2PY5 A;  4B3T B;  1H38 A;  2JK5 C;  1JPX A;  5C8Y B;  2Q68 A;  4MVQ A;  3ZHQ A;  1ZL8 A;  4BIO A;  1XMQ B;  1I08 A;  5JJN B;  3JAR B;  3T1H B;  3ICX A;  3CMA V;  1Y6X A;  2LGQ A;  2JGU A;  4UCR A;  4GX0 A;  5FNV A;  5JJE B;  2RNB A;  5EYP B;  3ABU A;  1BHA A;  3JYC A;  4EB6 B;  5IWA O;  2VWJ A;  3CRA A;  1KMI Z;  1PPJ H;  3RYH B;  4DW1 A;  3SYO A;  1RP3 B;  1R3L C;  3QO8 A;  1PD3 A;  2HP8 A;  1AP5 A;  4JPR A;  2HHH B;  4JYA B;  3AK2 A;  1VQ9 V;  3J80 N;  4EFB A;  2Q7E A;  2QR4 A;  2ZM6 B;  4OPH A;  4WCE V;  1HR0 O;  5EIB C;  2B9Z A;  3E8H A;  4NXM B;  1NZ6 A;  3RVZ A;  2EX3 A;  1X4T A;  4I55 A;  1WAZ A;  3JAK B;  4H37 A;  2UXB O;  3ABM C;  2Q7H A;  3G71 V;  2KQX A;  2EIN B;  4K8X A;  3EFF K;  3OEE G;  2PTM A;  2PI4 A;  1U96 A;  3QO7 A;  4O4L A;  4CS2 A;  4LF6 B;  5EZY B;  4DR4 B;  2EIM C;  3RWR D;  2JDI G;  2Q67 A;  1IBL B;  4MTG A;  5LMU O;  4GCZ A;  2IH1 C;  2DW4 A;  5DM6 V;  5JH7 A;  2X0L A;  4X65 O;  2A3Q A;  5FPO A;  1XOU A;  3W7S A;  1VF6 A;  1SA0 B;  4DR2 O;  2JJ1 G;  1GKF A;  2E74 B;  2YXH A;  5KHG A;  2VRZ A;  1WA8 A;  4JI1 B;  5IY5 B;  1M57 C;  3DSQ A;  1NKD A;  2BTO A;  3AG4 B;  5JVD A;  4CS4 A;  1N32 B;  1WPX A;  1HDJ A;  4YXW G;  5LHH A;  1E1Q G;  4ZI7 B;  2JRI A;  4IIJ A;  4FMT A;  1TGO A;  1OCR C;  2PF4 E;  4MTX A;  2HEP A;  2GBO A;  4B3S O;  2AW9 A;  4GKJ B;  1JMK C;  1SQB H;  2Q6A A;  2A06 H;  4BW5 A;  1K4D C;  3CWB H;  5LP6 A;  1K92 A;  1FFX B;  2JGD A;  3CSX A;  1GH6 A;  2WLN A;  1BE3 H;  4F6E A;  1SES A;  1OZ0 A;  5H6R A;  3OW2 U;  2F23 A;  2QTO A;  4DR3 O;  1Z5W A;  4O4H B;  3JAT A;  4YJ3 B;  3E8F A;  2HKO A;  3P30 A;  1IVS A;  3BFR A;  5EBW C;  1JJO A;  5IYZ A;  3JAM N;  2YEV A;  3X2Q B;  1VQ5 V;  4LFC B;  1M4U A;  3JD3 A;  3THO A;  4IGG A;  3VQY A;  2ZD9 A;  5LA6 A;  1K34 A;  4RUF A;  2KKW A;  5K1X A;  2Q5Z A;  4JV5 B;  2EIL B;  5IT9 N;  2BCC H;  1EZV H;  2HVK C;  1F4N A;  1XL6 A;  2X6B A;  4WFA V;  3ASN B;  3OTO O;  1H8H G;  3I55 V;  1FPO A;  3F5W C;  4F4L A;  3H1J H;  3M7M X;  4DV6 O;  1ZL8 B;  1GM7 A;  3G6B A;  5L3B A;  3K5L A;  1VQ8 V;  3T1C A;  1DLB A;  3DC5 A;  4O4J A;  4F6R A;  4Q6G A;  4LF8 B;  2DYS C;  2E76 B;  2FYU H;  5FNV B;  2X6A A;  5C93 A;  4J7J A;  1BMF G;  3G80 A;  2QKC A;  4JAA A;  3K9A A;  1S77 D;  1JNB A;  2WLM A;  3N2K A;  2JEX A;  2VQF B;  2YUA A;  4DUZ O;  5A9G A;  2LJ2 A;  3F7Y C;  4LF5 O;  5LGU A;  1KP2 A;  3ETD A;  4DV5 B;  1YSC A;  3ZRX A;  4JYY A;  5F2V O;  4ZOL A;  4X64 B;  4I55 B;  1XQ8 A;  3TJT A;  4NR1 A;  4N21 A;  4TV9 A;  3P3N A;  2CTR A;  3LDE A;  1IBK O;  3CCL V;  2ITC C;  5LMN B;  1XIL A;  4JF3 A;  4PDL A;  4PI2 A;  1US6 A;  4TWK A;  4LF4 B;  4O4L B;  3CEI A;  4DR6 O;  4B3R B;  1WNS A;  4X20 A;  1IXM A;  2LW1 A;  3OR7 C;  3CP1 A;  4PDR A;  4X66 O;  4DV2 O;  3ZN1 A;  1YVW A;  3CCS V;  1Y74 A;  5JH7 B;  4KL1 A;  5B1O A;  4W4K A;  4JI8 B;  4I9W A;  1D5N A;  3HR0 A;  2RCV A;  2IM9 A;  4GLX A;  4EFE A;  4JI7 O;  3BAB A;  1OJH A;  5BXZ A;  1LR1 A;  4EEQ A;  3SPJ A;  1S76 D;  1WA8 B;  3OEH G;  1GM8 A;  4D7T A;  3CRR A;  1V9P A;  3ZS8 C;  2F1M A;  3UQ8 A;  4UCT A;  2NN4 A;  2CH7 A;  5KMG A;  3D36 A;  2N05 A;  4RAI A;  2XAG A;  4LC1 A;  5DEC A;  5JVD B;  2ODM A;  3TK1 A;  5CA1 A;  2YIA A;  5AG2 A;  1MG1 A;  4IIJ B;  3JAL A;  1ENV A;  4DV4 B;  4JI0 O;  3AG1 C;  1FOU A;  2YID A;  3M99 B;  3A8T A;  5LP6 B;  1QU7 A;  4LFB B;  1AB3 A;  1S0V A;  3L70 H;  2JGD B;  2YS8 A;  3SPI A;  1KD1 W;  2HG5 C;  1VQM V;  4MTO A;  4TQD A;  4AI8 A;  4WBN A;  3CHX A;  3ETQ A;  2JVD A;  1D2D A;  3ASO B;  4JYB A;  3JAT B;  5B3S C;  3HKB A;  1FS0 G;  3AG3 B;  4U3F H;  1V54 C;  5IYZ B;  3QNE A;  3CCQ V;  2YEV B;  4AIL C;  1AR5 A;  2JEU A;  2EIJ B;  3CCM V;  3TET A;  4FLU A;  2Z5U A;  5KHI A;  2MK3 A;  4YIO A;  1RPO A;  4UUJ C;  4PHZ A;  1EN6 A;  4PA4 A;  1FXK C;  3QTC A;  1I94 B;  1KB9 F;  4XDJ A;  2Y4U A;  1QNM A;  3B2E E;  2DMX A;  5IYD O;  4O2A A;  3STL C;  2Q9L A;  1HNX O;  4A5U B;  3SPC A;  4YHH O;  2Z3Y A;  4O4J B;  4F6R B;  2WLK A;  1MSD A;  2FTK A;  1Q82 W;  3ABL B;  1P7G A;  5B1A B;  1NQT A;  1P84 F;  2XAJ A;  3H1K H;  2XAQ A;  1QLE B;  1TUE B;  2QM7 A;  3A0B Z;  3CCE V;  3N2K B;  2IBZ H;  4PV1 B;  4RQE A;  2ZIN A;  4PEL A;  2WLH A;  1MMM A;  2YSU B;  3LSQ A;  1IXB A;  3JSN A;  2KSD A;  1VIB A;  2DYR C;  5EBL C;  4Z1V A;  4ZOL B;  3K0G A;  4JI6 B;  1A32 A;  4FLZ A;  5ITZ A;  4DV0 B;  3RYH A;  3H1I H;  1NTZ H;  4TSF G;  4TV9 B;  1VMG A;  2BTQ A;  2HFE C;  4MTF A;  1R6K A;  4LWS A;  5BZB A;  4MSW C;  3BRC A;  4O2B A;  1BS3 A;  5CA0 A;  2DQ0 A;  3ZMU A;  1GRJ A;  4DUY O;  2IW5 A;  4X20 B;  2PYJ A;  3CB2 A;  4H13 B;  2YI8 A;  1KKD A;  4CC6 A;  3G6E V;  3SJQ C;  1Y74 B;  1NR1 A;  4CZZ A;  2NNU A;  4KP4 A;  4JI3 O;  5L3G A;  1XNQ O;  1KYO F;  1UPG A;  3W7W A;  1IBM O;  1HNZ O;  4WF9 V;  4UV9 A;  2R9A A;  2UXD O;  2RN9 A;  3OMA B;  4G2K A;  4RWU A;  2GUZ A;  5GW7 A;  1QVF U;  2B1I A;  2WWW A;  3SYP A;  1I7F A;  1IX9 A;  3KG2 A;  4FLT A;  4L8J A;  4CBC A;  2CH7 B;  5KMG B;  3BCC H;  2CTW A;  5JQG A;  2WLL A;  3ZMV A;  5JCO C;  4DR5 O;  4B08 A;  4JI4 O;  5CA1 B;  3L74 H;  3JAL B;  3WU2 Z;  1TUB A;  2Q8V A;  4DK0 A;  5EK0 A;  4NXN B;  2JIZ G;  2F4V O;  2C2A A;  4ZBM A;  1VP7 A;  2EZO A;  2GTS A;  3SR2 C;  2BOC C;  4MVS A;  2UUC O;  2ZNI A;  4WBN B;  3CYO A;  5IYB O;  1JX9 A;  4GZR B;  3HKB B;  3JCZ A;  3Q4H A;  4DYL A;  1T5E A;  1FFX A;  1K8A W;  4JI5 O;  2EIK B;  3QVN A;  2Y69 C;  4NTX A;  2QTS A;  4ICG A;  2NR5 A;  4GKK B;  3NXS A;  4PA6 A;  1XL4 A;  5KHK A;  1CEZ A;  1K3E A;  3ML0 A;  2LGW A;  2W6J G;  4GX5 A;  4BIU A;  1U97 A;  2E5L O;  1Y67 A;  2JJ2 G;  5CBF A;  2EZP A;  1QHT A;  2QWQ B;  2VWK A;  1JQ0 A;  4B3M B;  4WFF A;  4O2A B;  5B5E Z;  4W4L A;  2QDO A;  3ZCC A;  2IJJ A;  1H2L A;  1MZE A;  1D5A A;  1UJW B;  1Q81 W;  3H9V A;  3GB7 C;  3E83 A;  5IJ0 A;  1NJI W;  4CS3 A;  3PJS K;  2WA3 A;  3ZHT A;  2EIN C;  4IYI A;  2WLJ A;  4FFK A;  2ZIM A;  4BW9 A;  2A0L A;  1F4M A;  3DC6 A;  1LNQ A;  1K33 A;  2JS3 A;  4XDK A;  2F66 C;  3FAV A;  5IWA B;  1VQP V;  3CXC U;  5J9P C;  2CDY A;  4JTA B;  1XRE A;  5ITZ B;  4X1K A;  5GTH Z;  2OCC B;  4LH7 A;  2BTQ B;  4LWS B;  4FM0 A;  2CTP A;  4ABM A;  3JD2 A;  3ZHU A;  1NVP B;  4KHP O;  4FPP A;  4O2B B;  3IFX A;  4NTW A;  3RT3 C;  5CA0 B;  3K58 A;  4PDV A;  5BMV A;  2WLI A;  4GUN A;  4D7S A;  1HR0 B;  4UCU A;  2DWD C;  5IE9 A;  4CH5 A;  4KUM A;  1YJ9 V;  2UXB B;  2CUG A;  2YXL A;  3AG4 C;  5J2U A;  2XAF A;  1RFY A;  1YIJ V;  3B77 A;  4JAV A;  1Z2G A;  1OCZ C;  5BR8 O;  4LF9 O;  3W7X A;  3T1Y O;  1AI7 A;  2ZXW B;  2GUZ B;  2YI9 A;  4B7E A;  1NVP D;  1K5S A;  5LMU B;  3FKS G;  2QA4 V;  2OYQ A;  2Q0A A;  4X65 B;  3F5T A;  4HYO A;  1M56 B;  3E89 A;  1Q5O A;  5JQG B;  2WLL B;  1Q86 W;  3H1H H;  2ZDI C;  4DR2 B;  1N4C A;  2ARH A;  2N74 A;  4X62 O;  4LBE C;  1TUB B;  2A9H A;  2XAS A;  4BIZ A;  5LHI A;  1SET A;  3X2Q C;  3AK1 A;  5CB4 A;  4DV7 O;  5B66 Z;  1LUW A;  5GON A;  2EIL C;  1YEW A;  1RM1 B;  2QGN A;  2OT5 A;  2P7T C;  3CX5 F;  4B3S B;  3ASN C;  1H2N A;  3Q4H B;  1CPY A;  3LNN A;  3B40 A;  2RDC A;  2IH3 C;  5BY1 A;  4QE9 A;  2Q7G A;  4DV1 O;  3CCJ V;  3R66 A;  1LUV A;  2Y0P A;  4UB8 Z;  1OCO B;  4DR3 B;  1O9G A;  2ZR3 A;  2QKS A;  1HP8 A;  5LGT A;  4I9Q A;  3SJC C;  1AI5 A;  1PNK A;  2EIM B;  1OCC B;  3TGU H;  1RSO A;  2DJV A;  3T2M A;  3H01 A;  4DW0 A;  4NB5 A;  2UUB O;  3DXR A;  5EIB D;  3VQX A;  2MW2 B;  3RYC A;  5L3F A;  5B1B B;  3AEI A;  1CP9 A;  4J9Z B;  3OTO B;  3ETG A;  3N2G A;  5IJ0 B;  1M57 B;  1Q90 D;  3K57 A;  4DV6 B;  3CS5 A;  1B06 A;  4KFM A;  2CK3 G;  2ILM A;  1KEC A;  2AXT Z;  1K9M W;  4UB6 Z;  1KP3 A;  1N36 O;  1W0K G;  4DR7 O;  1B6Q A;  3FAV B;  2HLD G;  4O4I A;  3R65 A;  2BE3 A;  1XMO O;  4LFA O;  3JAW A;  2LO1 A;  3SPH A;  3DGE A;  4JI2 O;  3BAA A;  3OTF A;  4X1K B;  1H2K A;  3S3X A;  4YJ2 A;  4DUZ B;  4D6T H;  1VQN V;  4LF5 B;  2P67 A;  5BMV B;  2G38 A;  2WLI B;  1HWY A;  2R70 A;  1PNM A;  3AK3 A;  3K79 A;  1TAE A;  3SPG A;  3SJB C;  4YIP A;  3EXA A;  5J2U B;  2YDE A;  1XUQ A;  5CN0 A;  4YY3 O;  2AZ2 A;  1IBK B;  1R6N A;  3IC9 A;  1VQL V;  3NR7 A;  1JR9 A;  4TV8 A;  4DR6 B;  3E86 A;  1VQ4 V;  4FLW A;  3FB7 C;  5FPR A;  3HPL C;  1SQV H;  3B8M A;  1JFF A;  4LP8 A;  4TQF A;  4QPJ A;  5H6Q A;  3IC7 A;  4X66 B;  5LP6 C;  4ZIB A;  4DV2 B;  1N8R W;  5H9C A;  1EFR G;  4E2L A;  2X6C A;  1B3Q A;  2BOB C;  2GTA A;  4PA3 A;  1H2M A;  4JI7 B;  4AHC A;  3WFV A;  3AG3 C;  1WPB A;  1AIL A;  4GYC B;  1I0H A;  5LL6 Y;  4P9P A;  3GWK C;  4L87 A;  4I4T A;  5CB4 B;  2EIJ C;  1CXZ B;  1FYJ A;  4HNA A;  2ZQM A;  1Y4M A;  5GON B;  4AQY O;  2FML A;  1R3I C;  1QR8 A;  2OTL V;  1MAB G;  3MD0 A;  5LOV A;  1WB7 A;  3P32 A;  5HFL A;  1M9N A;  1SQF A;  3WG7 B;  1ZSP A;  3L75 H;  4UVB A;  3HB3 B;  2BSK A;  2AZ0 A;  1KBH A;  1HNW O;  2Y4T A;  2UXC O;  1Q6I A;  3K9S A;  3ZX6 A;  1YXB A;  1K73 W;  1M93 A;  2PI5 A;  1ZWI C;  3WB0 A;  4XDL A;  3ABL C;  4DV4 O;  4DO2 A;  1P49 A;  5B1A C;  4K0K O;  4NYK A;  2AHZ A;  2ZE8 A;  4MT8 A;  2YXY A;  1WLE A;  3A2F A;  1YJW V;  1RSO B;  1QLE C;  1VQ7 V;  2OIG A;  3H1L H;  1YHQ V;  3GVM A;  3M8A A;  1DK1 A;  3DXR B;  3C90 A;  4CH6 A;  3RYC B;  3JD0 A;  5KA5 A;  3UKM A;  4WFH A;  4X88 A;  1YTF B;  4ZKI A;  1FJG O;  3JD1 A;  3SJA C;  2UU9 O;  3L71 H;  4EKW A;  3N2G B;  3CJH A;  1Y66 A;  1PNL A;  4E4E A;  5CMU A;  2IJK A;  4DR1 O;  2D3O W;  2UUA O;  3RN4 A;  3J81 N;  3S3W A;  1HNX B;  4YHH B;  1ORQ C;  4J41 A;  5A2Q N;  3FB5 C;  3K5M A;  4NKG B;  4O4I B;  5KAF Z;  1SRY A;  1O9H A;  3JAW B;  1YIT V;  1YTF D;  3FYI B;  4YJ2 B;  3WB2 A;  4H33 A;  4DRX A;  1W59 A;  3OAA G;  4UFZ A;  1H5W A;  3CCR V;  5B3S B;  4WFB V;  2ZE6 A;  5CA3 A;  3D36 C;  1ZX3 A;  1SF9 A;  1SKV A;  3ABK B;  2V7Q G;  4TV8 B;  3BEH A;  4FJC C;  4DUY B;  2QWP B;  5KA6 A;  3K3W A;  1VQ6 V;  1JFF B;  1JOY A;  3K03 A;  1YZB A;  2P4K A;  4JTD B;  3D3I A;  5FL7 G;  2HR3 A;  4JI3 B;  1XNQ B;  4OX9 O;  2QM8 A;  1JA8 A;  1IBM B;  1HNZ B;  4FLX A;  1Q6U A;  1V55 B;  2UXD B;  2XOK G;  2XT9 A;  4RQF A;  3E22 A;  3UCS C;  3KZI Z;  1ZTE A;  2O57 A;  4P9O A;  2IJI A;  3CC4 V;  3ZIA G;  2HVJ C;  3HKE A;  2DN9 A;  1PM9 A;  1AJP A;  3OFN G;  5KHH A;  1ROP A;  2OCH A;  1J95 A;  2EIK C;  4I4T B;  2Q4P A;  2UXX A;  3BA8 A;  4B7K A;  2LP7 A;  4HNA B;  1KKC A;  4DR5 B;  2WPD G;  4JI4 B;  4DK1 A;  2VQE O;  1JCH A;  3E8G A;  1J5E O;  3KDR A;  5LOV B;  3D8C A;  1KUQ A;  2XND G;  3K06 A;  4JGS A;  5H2F Z;  2F4V B;  5DED A;  2BSK B;  4TT3 G;  1EBO A;  4QGP A;  1IDS A;  3BVO A;  2UUC B;  1BQ0 A;  1UFI A;  1FKA O;  2ZIO A;  2ZE7 A;  1N34 O;  3LDC A;  3RW0 A;  4DV3 O;  1NS1 A;  1XEQ A;  1AJQ A;  1PL0 A;  1M1K W;  4JI5 B;  1GK9 A;  1PV0 A;  5LHG A;  3B8N A;  2CE4 A;  1AR4 A;  2V4D A;  4MVU A;  1DF4 A;  4I50 A;  1N33 O;  2QE7 G;  4LF7 O;  3FX7 A;  4G28 B;  4X89 A;  1OV9 A;  4I0X A;  2B5U A;  1QR9 A;  3FYE B;  1SQX H;  3CJH B;  1R3K C;  2FKX A;  2W0X A;  4K3A A;  2E5L B;  2OCC C;  4WFG A;  1KQS U;  1X59 A;  4P2Z A;  4JZG A;  3CXH F;  4XBF A;  3KCY A;  4U7O A;  1N0J A;  1XNR O;  3CRM A;  3J7A U;  1DF5 A;  3JCU Z;  3FD9 A;  2R72 A;  3T4Z A;  3ZN0 A;  4HBN A;  4DXW A;  3UO2 A;  2DOS A;  1RPR A;  1H8E G;  2LW7 A;  2V1D A;  1E79 G;  3ZRV A;  3IAY A;  1DTO A;  2ZXW C;  2WAM A;  1S72 V;  4DRX B;  1W0J G;  2UXN A;  4JAS A;  1Q7Y W;  3AG2 B;  2NLJ C;  3JSL A;  4B3T O;  3G4S V;  3VOU A;  2GDS A;  2YIB A;  1XBL A;  5KX5 A;  1F51 A;  1M56 C;  1GN2 A;  2XUM A;  5B1N A;  3CRC A;  3ZHS A;  1IZ3 A;  5HFM A;  4KHP B;  4FM2 A;  3CME V;  4J10 A;  3ZMT A;  1XMQ O;  4BWA A;  4OXS A;  2Y69 B;  3K5N A;  2RMK B;  1BL8 A;  1NI8 A;  3T1H O;  1GN4 A;  3JAS A;  4UV8 A;  5IY5 C;  5IYC O;  2ETN A;  3BY6 A;  5H5N A;  3ZHV A;  3LUT B;  4J11 A;  1WP7 A;  1NT2 B;  1GM9 A;  1G6U A;  2Q73 A;  2QKA A;  4LH6 A;  2EUL A;  3OR6 C;  1BSM A;  4TUY A;  1NH2 B;  2QWO B;  1VQK V;  1EN4 A;  5BR8 B;  1RM1 C;  4LF9 B;  2HHH O;  5IJ9 A;  4JYA O;  3T1Y B;  3UM7 A;  3ZED A;  3W7U A;  4IYH A;  3E22 B;  3N27 A;  2ZM6 O;  4R50 A;  1QLN A;  1BCC H;  4FK5 C;  4PA7 A;  4G27 B;  5D5Q A;  4UXN A;  1YJN V;  2P06 A;  2B1G A;  3HKE B;  4NXM O;  4PDM A;  1M5I A;  1QBZ A;  3RBZ A;  4BR6 A;  1MSW D;  1P4R A;  1R6T A;  4UVA A;  1WP8 A;  2LFS A;  3HKC A;  4FLY A;  3L72 H;  1OCO C;  2CTQ A;  3CCU V;  5EC1 C;  4I5S A;  4R8C A;  4LR3 A;  1NH2 D;  1K4C C;  4GT1 A;  4LF6 O;  4X62 B;  1XI1 A;  1OCC C;  3ZRS A;  4DR4 O;  1TVK A;  1S3J A;  5EC2 C;  2ZCE A;  1IBL O;  5LXT A;  3I56 V;  4DV7 B;  4UCO A;  3EVK A;  4OPA A;  2AHY A;  1VF7 A;  1SQP H;  5B1B C;  4X1I A;  1TA8 A;  4QIW F;  1Y76 A;  2PGG A;  4JI1 O;  3CE2 A;  3OT7 A;  1SC5 B;  5J2T A;  4P30 A;  2A79 B;  4DV1 B;  1VQO V;  3ABM B;  1N32 O;  4MVR A;  1OCZ B;  2K9P A;  1N0N A;  2ZNJ A;  3E35 A;  1L0N H;  4I50 B;  1NBM G;  4R6Z A;  1QCE A;  4I0X B;  4LCU C;  2LQT A;  1SQG A;  4GKJ O;  1I5Y A;  4N23 A;  3OE7 G;  3APO A;  2UUB B;  1P7B A;  1COW G;  3U10 A;  1KC8 W;  3KCX A;  4TOI A;  1DGS A;  4UCS A;  3VQV A;  4CH3 A;  3GWO A;  3CC7 V;  4PA9 A;  5E79 Z;  5LGN A;  2E3C A;  3STZ C;  3CD6 V;  3OUS A;  3K04 A;  4GX1 A;  1L0L H;  3BPZ A;  3TCU A;  4FZ0 A;  2Y48 A;  1BQZ A;  3UT5 A;  4FFB A;  4LFC O;  5LYJ A;  3FB8 C;  1GN3 A;  4UVC A;  4FLV A;  1H2S B;  1ZUQ A;  4JV5 O;  5CBH A;  3SGI A;  1OCR B;  1N36 B;  4RO2 A;  2ADP A;  3KKY A;  4DR7 B;  1XMO B;  4IHJ A;  4LFA B;  1JJ2 U;  3OUF A;  4NVP A;  4IT5 A;  3VQW A;  4JI2 B;  5KX5 B;  3C3S A;  3ABT A;  3SYQ A;  4UCV A;  2QEX V;  5JJJ B;  5TIS Z;  1W2B U;  1L8D A;  2W6I G;  1F23 A;  1VF6 C;  2F43 G;  2L35 A;  1S5J A;  2PUS A;  3G67 A;  5L3C A;  1K5Q A;  2YIC A;  5DN6 G;  1QVG U;  3JAS B;  4LF8 O;  1VAR A;  2XHB A;  3BA9 A;  1Q3E A;  1FFT B;  3B4S A;  3C3T A;  4YY3 B;  2PZS A;  1R3J C;  3K08 A;  2ADQ B;  4J42 A;  2CGN A;  3OGI B;  4TUY B;  1PP9 H;  2YIB D;  2VQF O;  3B09 A;  5IJ9 B;  1E1R G;  3WG7 C;  2EJ7 A;  3HKD A;  1R1B A;  2AGA A;  4DV5 O;  1XDC A;  4HAM A;  4FZ1 A;  3MDS A;  4X1Y A;  1VF5 B;  4X64 O;  3SYA A;  3OMI B;  4QE7 A;  1BT8 A;  3IGA C;  5D5P A;  1FXK A;  5KUM A;  2X7R B;  3CCV V;  3HKC B;  5LMN O;  3ASO C;  2E75 B;  4Z2W A;  4B3R O;  4LF4 O;  1ZLZ A;  1Q8I A;  1YDX A;  1AR1 B;  1SS3 A;  1HW7 A;  2DYS B;  1TVK B;  5CBG A;  3U11 A;  5LXT B;  2ZKO A;  3JD4 A;  4K35 A;  3K0D A;  4AQY B;  5JWP A;  4JI8 O;  3APQ A;  4MW3 A;  2GHY A;  1KU9 A;  4X1I B;  1F7Y A;  1R73 A;  1S5L Z;  4JI0 B;  3ZRW A;  1G4Y B;  1Y76 B;  2KB1 A;  4IL6 Z;  3ZMZ A;  4U3J A;  2K1E A;  3A0R A;  5J2T B;  3QG5 A;  3WB1 A;  3U0Z A;  1HNW B;  1AJN A;  2QWN B;  2UXC B;  1FD9 A;  1URF A;  3K59 A;  2FB5 A;  1BZK A;  3K5O A;  1I5X A;  2DQ3 A;  1G8M A;  4Z1M G;  3RYI A;  1S5H C;  3SDL A;  1BGY H;  4J9Y B;  4K0K B;  3I5D A;  4KXR A;  2H3O A;  2RQ6 A;  1PKX A;  2Z0A A;  3TXS A;  1YF2 A;  3W7T A;  2JS5 A;  1SZT A;  4R7C A;  4LFB O;  1SZX A; 
#chains in the Genus database with same CATH homology
 3C3T A;  3RN4 A;  3OT7 A;  1MMM A;  2ADQ B;  3KDR A;  1IXB A;  1WB8 A;  2GDS A;  1GN6 A;  5AG2 A;  1GN2 A;  3DC5 A;  1N0N A;  3QVN A;  1I0H A;  1IDS A;  1EM1 A;  1XDC A;  3MDS A;  4X9Q A;  1GN4 A;  2QKC A;  1BS3 A;  1BT8 A;  1B06 A;  2QKA A;  5A9G A;  1VEW A;  1PL4 A;  1BSM A;  1WB7 A;  1EN4 A;  1Y67 A;  1ZLZ A;  1I08 A;  1ZSP A;  2CE4 A;  1AR4 A;  4JYY A;  3TJT A;  1AR5 A;  2AW9 A;  4C7U A;  1AVM A;  4JZ2 A;  3AK1 A;  3K9S A;  4BR6 A;  1XIL A;  1LUW A;  1GN3 A;  1IX9 A;  4F6E A;  3CEI A;  2P4K A;  1ZUQ A;  1AP5 A;  1MNG A;  4YIO A;  3AK3 A;  3AK2 A;  4FFK A;  2ADP A;  3KKY A;  1EN6 A;  1JA8 A;  4JZG A;  3BFR A;  3LSU A;  4YIP A;  3DC6 A;  1N0J A;  1QNM A;  1XUQ A;  3C3S A;  3IC9 A;  1ZTE A;  1D5N A;  1EN5 A;  2RCV A;  2CDY A;  1JR9 A;  1MA1 A;  3EVK A;  1XRE A;  1MSD A;  1LUV A;  1P7G A;  1PM9 A;  1AP6 A;  4E4E A;  1VAR A;  1KKC A;  4GUN A;  1SZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...