2P4KA

Contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAANVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2p4kA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2p4kA02
4JYYA 1Y67A 2GDSA 1WB8A 3IC9A 2AW9A 1JR9A 2ADPA 2ADQB 1XUQA 4BR6A 3QVNA 3C3SA 1KKCA 1GN3A 1BT8A 3RN4A 1ZTEA 4JZGA 1MSDA 4F6EA 1I0HA 1ZSPA 3AK1A 1LUVA 1GN2A 1VARA 1ZLZA 2QKAA 1IX9A 4X9QA 3EVKA 1MNGA 3TJTA 1IDSA 3CEIA 1AVMA 1QNMA 3DC5A 3BFRA 1N0NA 3AK2A 4E4EA 3AK3A 1EM1A 1SZXA 1AP6A 4JZ2A 1BS3A 1EN6A 1B06A 1XDCA 1IXBA 2P4KA 4GUNA 1BSMA 1MA1A 2RCVA 1PM9A 1JA8A 1AR5A 1EN5A 2QKCA 1I08A 1XILA 1N0JA 3LSUA 1ZUQA 3C3TA 3KKYA 1AR4A 1P7GA 3MDSA 1AP5A 1MMMA 1EN4A 1LUWA 1XREA 3K9SA 5A9GA 1PL4A 2CDYA 1WB7A 4YIPA 5AG2A 4C7UA 1VEWA 1D5NA 2CE4A 3DC6A 1GN4A 1GN6A 3OT7A 4YIOA 4FFKA
chains in the Genus database with same CATH superfamily
4X64O 2CTPA 1NJIW 1QU7A 4U3FH 3TXSA 4HZ3A 1KU9A 3HR0A 3JD4A 3JD0A 2EX3A 1OHHG 3S3WA 1IVSA 3QO8A 3SDLA 1ZTEA 4B3MB 1PKXA 1TAEA 2ZDIA 4JV5O 4O4JA 5JJEB 4MTOA 3CCQV 3W7TA 1D2DA 3UCSC 4N21A 1GK9A 1WA8B 4FLYA 3ML0A 4N23A 4FM0A 2ETNA 1XNRB 1AJNA 4QNHB 4GZRB 1NR7A 1S76D 4B3RB 1IX9A 3EVKA 1SC5B 2AGAA 1DF4A 3TJTA 3M99B 4MVZA 5JH7A 3LSSA 3ASNB 2PI5A 1IBMB 1AVMA 1K73W 3LDDA 3AK2A 3ABTA 3OTOB 3AG1B 3VQYA 2UUAB 3J81N 3CCJV 4CH3A 3IAYA 1KP2A 4DV1B 1FFXB 1EN5A 1JNBA 1H8EG 1V54B 1WLEA 4LFBO 3AG3B 4LF7B 1R73A 4JPRA 4DR1B 4YJ2A 5D5PA 2DYSB 4QIWF 1ZUQA 5LGNA 1RPOA 2Q67A 3HKCB 3OEEG 4X1YB 4LH7A 5JWPA 1PNMA 3P3PA 2XASA 4W4KA 5IYCO 4LF6O 2D2CB 2F4VO 4ZHQA 3K0GA 2CE4A 4JI3B 3ABKC 2PGGA 1GN6A 1H2NA 4LWSB 1S5LZ 1ORQC 4X89A 3OMAB 2ITDC 2V7QG 3VQWA 3ZIAG 2HG5C 4DV0B 2PI4A 1G4YB 1X59A 3FX7A 1NT2B 1WB8A 1OCCB 3K5LA 2BOCC 3FB7C 4MTXA 5LXTA 1XBLA 1S5JA 4JI8B 5LP6B 3I56V 2X0LA 5CA1A 4X66B 3SYCA 5L3EA 4YY3B 3OTFA 4MVUA 1K4CC 1Y76B 3JATB 2XT9A 1XI1A 1N8RW 5JQGB 1VQLV 3OGCC 4X62O 5CA1B 3HPLC 3T4DA 2CK3G 3KG2A 2BOBC 2QE7G 4GCZA 1ZWIC 4JTDB 1P84F 5L3FA 4YJ3A 3A2FA 2JJ2G 2WWWA 2GUZA 4X1IB 2EJ7A 2VQEO 4MTFA 2ODMA 1VP7A 1B04A 4XBFA 4QGPA 1IBLB 1O9HA 1BQZA 4DUYO 1N36B 2GUZB 2M7WA 1XMQB 3KCXA 1DK1A 2P6JA 1QLEB 4GX5A 4TQDA 4WBNA 3E2EA 3SYQA 4O4LA 4BIOA 4FLZA 5J2UB 4H37A 4ZBMA 5E79Z 1M57C 2Q69A 2P5OA 3JYCA 5JVDA 5ITZA 3EFFK 1NR1A 1F4NA 3SYPA 3OMNB 3T1CA 1SQFA 2EZOA 3FD9A 1Q7YW 3VBBA 3GVMA 2ADPA 1XQ8A 4MVRA 4TT3G 1HNWO 3HKEB 1GM7A 5LGUA 4BR6A 2C2AA 5B3SC 1MABG 1JX9A 3JCZA 3LNMB 3ABUA 2QJ1A 4JZGA 5DEDA 1MSDA 3FAVB 1BHBA 2B1IA 3CPWU 2ZXWC 1K34A 2HEPA 1B3QA 3JARA 4FFBB 4X9QA 1MNGA 2DYRB 2MW2B 4LF4B 2OCCC 2PF4E 4IGGA 2W0XA 5CA0B 1UFIA 4DYLA 3BFRA 5J2TA 1DF5A 2YIAA 2WLHA 1QVGU 5B1NA 2EINC 3ZBHA 3FB6C 2XAFA 4OX9O 2CH7A 4B3SB 4HYOA 2UXBB 1KYOF 4NXMB 4CC6A 1E1QG 2F23A 2QWNB 4FZ0A 4UCTA 3CYOA 2H94A 4TUYA 3JAKB 3RFRA 2N74A 4HBNA 5CA3A 2ZIOA 2P90A 2KB1A 4CH6A 1MMMA 3D3QA 1SQGA 2BSKA 3N2GA 2YICA 5EZYA 5GW7A 3HKBA 4TV9B 3IGAC 3P3NA 4DR3O 1YTFB 3DC6A 3G6BA 2Q9LA 2FMLA 3CRQA 2LW1A 3TETA 4NXNB 1N32B 5B1BB 3JASA 2IU0A 2F66C 2V1DA 3SPHA 5IJ0A 3SJQC 2CTWA 5LOVB 4GKKB 2YEVB 3JAMN 1QCEA 3B77A 3BEHA 3D36C 4LNUB 4ZI7B 4LF9O 5CBFA 3ZN0A 2Z0AA 4J7KA 3B09A 3SJBC 2JGUA 1OV9A 2BTQB 2V4DA 1IZ3A 1BQ0A 3L73H 4TV8A 2KKWA 2O57A 4PV1B 5KA5A 4JI1B 4OGQB 3BAAA 4FJCC 1YJWV 4MW3A 1M57B 2QKAA 1N33O 3W7XA 4P9OA 3ZHUA 1VQ8V 1PD3A 2Q0OC 5KHHA 3RYFA 2UXCO 1R3KC 1VQMV 2QSAA 1NVPB 1EM1A 4DK1A 1COWG 5KMGA 2JS3A 4EB6A 4NVPA 1JA8A 3SJCC 3CJHB 2UUCB 3UT5B 2ZKOA 5JCOA 1R6KA 3CCRV 3LDEA 4WFFA 1XMOB 1OCRC 4MTGA 1WPXA 2Q6AA 4DW0A 3L9DA 1H2MA 4I50B 3CXCU 3K9SA 3CC2V 5BR8O 1TVKA 2CDYA 4Z1VA 1H2SB 2UXXA 4LFAB 5IE9A 2EINB 4W4LA 2JGDB 1TVKB 2YC0A 5JJNB 2JRIA 4DV2O 1TGOA 4DR7O 5C8YB 1XUQA 1M1KW 4IHJA 4YXWG 1M93A 3T1HB 1KKCA 1FXKB 1YEWA 3ABMB 4UCUA 4DR6O 1SA0A 4DO2A 3ETEA 2ZM6B 3ETGA 1Y6XA 5KUKA 3MD0A 4O2BA 3BCCH 3DSQA 5H6RA 2BCCH 1VQOV 1I5XA 1RPRA 4GX2A 4DV3O 1VARA 4XDLA 1U96A 4UCSA 4JYAO 1IJGA 2DE0X 1U97A 1VF6A 2A79B 3F5TA 3BVOA 1K33A 2ZCEA 2YIBD 5IYBO 5LHGA 3VQVA 5EBLC 1XNQO 1P4RA 4JI2O 5CN0A 2NNUA 1AP6A 1NS1A 4BIUA 1WNSA 1WP7A 2A7WA 1BSMA 2FKXA 5LYJA 4DV7O 2IJKA 2B1GA 2RDCA 1S72V 2DOSA 1YTFD 1PNLA 2QM7A 3MHSC 3SPCA 1N0JA 2VQFB 1BCCH 1FS0G 4PJ0Z 2ZE8A 4UV9A 1EN4A 3T4ZA 5KA6A 3ZHRA 3TGUH 3T1YB 4R8CA 4U7NA 1KECA 4DR2O 4IL6Z 4O2AB 2XTAA 4UCVA 4GT1A 2B5UA 3KZIZ 4X1KA 4CS3A 2AHYA 3JD2A 5L3CA 4FVMA 4NTYA 1H2LA 5LL6Y 1UPGA 2UU9O 4B3TO 4JI0B 1HR0O 4F6RA 2FL4A 1CPYA 1R3LC 1RSOA 4FMTA 3CCEV 1I94O 5LA6B 1NKDA 3RGBA 4J7JA 3OFNG 1HP8A 4RUFA 1NTKH 3LDCA 2VRZA 4LF5B 1OJHA 2LW7A 2Q0AA 1K7DA 1NVPD 4AQYO 3A0HZ 4IT5A 3CCVV 2UUBO 1EZJA 1SQPH 2H8PC 4DUZB 2IJHA 2HHHB 4A5UB 1WA8A 2YI9A 3ZRSA 2YI8A 2D3OW 1WP8A 5IYDO 1WN7A 2HFEC 4JYBA 3ZHTA 4JAAA 1HNXB 2YXHA 3F7YC 1EN6A 2UXNA 4TOIA 2RN9A 1V9PA 3I55V 4JF3A 5H9CA 4PA3A 4LFCB 1AI7A 1W0KG 4TQFA 4D7SA 2HKOA 2EIKC 3K58A 1FAFA 3H1HH 4FM1A 3DTUB 3RVZA 2X7RB 3LSUA 3CB2A 1J5EB 2Y69C 1WPBA 4DV6B 1FFXA 4JI7O 3N27A 3RYHB 1VQPV 2EILB 1NTZH 1IBKO 3L71H 5B5EZ 3BHPA 1WB7A 3HKCA 4X1YA 1XHZA 2Q4PA 1JVMA 1P7BA 2DQ0A 3L74H 2EIMC 3ZHQA 4UFZA 5FNVB 4JI6B 1QR8A 4FFKA 2GTSA 5FPRA 1FOUA 1S5HC 2FB5A 2E5LO 1YVWA 3RYIB 3OAAG 2HP8A 1JJ2U 1DTOA 1TUEB 2QWPB 3OEHG 4LWSA 2OIGA 2OYQA 3W7UA 2EIJC 1M9NA 4DR4O 1Q3EA 1PP9H 4UB8Z 5IYZB 3BPZA 4WCEV 2QM8A 4P9PA 2PYJA 1VF7A 1FJGO 4J42A 3QF7A 3HB3B 2Q7GA 3P32A 3ASOC 4LF8B 2XAJA 5LP6A 4U3JB 3MHHC 2Q68A 4I7ZB 1FPOA 4JTAB 1GN2A 4EKWA 4MSWC 4CS2A 3K5NA 1XOUA 2OCHA 1R6NA 1Y76A 3JATA 2ZE6A 5JQGA 1ROPA 3U10A 1JQ0A 4IYHA 2JS5A 2R72A 1Q5OA 1FKAO 1RFYA 2K1EA 1PV0A 4NKGB 2IH1C 3E86A 1HNZO 3HKDB 4JASA 1M5IA 2QWRB 1YXBA 2OTJV 4X1IA 4QE9A 5B1OA 4DV4O 3M7MX 4RUEA 3B2EE 3OR7C 4DR5O 1AR4A 5LHIA 4O4HB 1OCZC 4JI5B 5D5QA 1T5EA 3RYCB 3FB8C 1S3JA 4J7ZA 1WAZA 4UV8A 4BAYA 5IWAO 4FLWA 4L87A 1Z5WA 4Q20A 5GTHZ 2WLIB 2AZ2A 4DV5O 3JCUZ 1YSCA 5J2UA 1PPJH 4K35A 1Q6IA 1SQVH 1N34B 1AI6A 1ENVA 4LR3A 3CHXA 1SQXH 2Y0PA 4YHHB 1SERA 3BY6A 4GYCB 1NI8A 1MZFA 3K03A 1G8MA 2HLDG 1JPXA 5DM6V 4I9WA 1YIJV 4QPJA 3F5WC 3LUTB 5B66Z 4GKJB 2OTLV 2RJZA 3RT3C 1I5YA 1BT8A 5LMNB 1SESA 1JFFB 3HKEA 3JSNA 2WLLB 5EBMC 2ITCC 2QM4A 3CMEV 3JAWB 5L3GA 3SPJA 3K06A 1US6A 5CB4B 1JCHA 3G80A 3G67A 2EIMB 1YHQV 2R9IA 3FAVA 4I0XB 3ZRWB 4X65B 2JEUA 2IJIA 1GM9A 4H0LB 3SJAC 4AHCA 2DJVA 1PNKA 4FFBA 1R6TA 3K5OA 3ZHSA 2IH3C 4BIZA 1SZXA 2A9HA 3AG4C 2EIJB 2DW4A 4B3MO 5CA0A 4LBEC 2WLJA 4FM2A 4KHPB 3BRCA 2LFRA 3ABKB 1ZL8B 1S0VA 1NTMH 2PY5A 1XNRO 2Y0IA 3E22B 3U11A 1KMIZ 4B3RO 3ZMSA 5EYPB 1Y66A 5LMUB 4CH4A 1O9GA 4UXNA 4KL1A 1K4DC 3D3IA 1IBMO 3T2MA 1NU1H 1VIBA 3B40A 5K1XA 1WJZA 3JAKA 2YIBA 5A9GA 1SZTA 3IJ4A 3OTOO 2W0FC 1F51A 2KG7B 2LJ2A 3N2KB 4DRXB 4PD4F 5JCOC 3ZHVA 3AG2C 2UUAO 4P2ZA 4WFBV 3C90A 2E74B 1TUBB 1DGSA 2XAGA 1GAXA 3Q4HB 3SYOA 5IJ9B 4DV1O 3JALB 4TV9A 5GTIZ 4LF7O 4H13B 4DR1O 3K9AA 1K92A 5LBQA 5LHHA 2Z5UA 4JGSA 3TXQA 2ADQB 1RM1C 2Q7EA 2F95B 1Z5VA 5LOVA 3SPGA 4B08A 2YEVA 2Y4TA 4IIJB 1F4MA 2X6AA 2XNDG 2LO1A 4JI3O 4JAVA 4LNUA 2PZSA 1SF9A 4DK0A 4NR1A 4LH6A 4ZI7A 4X20B 2M6YA 5B1AC 4K0KB 1N4CA 4UUJC 1K3EA 4LF8O 3WB1A 4DV0O 3L75H 3OUSA 2BTQA 1Q90D 2KQXA 3QG5A 2ZR2A 4HNAB 3SYAA 3RBZA 3CWBH 4QE7A 5GONB 4JI4B 4Q6GA 2NR5A 3DC5A 4CZZA 1N0NA 2QR4A 4JI8O 2XOKG 1SRYA 2RMKB 3M8AA 4FLVA 2YXYA 4X66O 1H5WA 3LSQA 3K5MA 3E83A 3ZMTA 4YY3O 2QA4V 2QKSA 1MA1A 2Y4UA 5BY1A 3ZRXA 3PJSK 2ZIMA 4H44B 1Q6HA 2UXDB 4K3AA 1LR1A 3GWOA 4X64B 4LP8A 1L8DA 1XILA 1BMFG 4WFAV 2W6JG 3CJHA 2DN9A 3UT5A 1P7GA 1V55C 5DN6G 1SETA 1LUWA 1W0JG 3UO3A 1A32A 1VQNV 4G28B 2IJJA 1VQ5V 2L35A 1GTOA 4HAMA 4PDRA 3AG7A 1KQSU 3K3WA 4I50A 5B3SB 1Y74B 2LQTA 4UVAA 2YUAA 1UJWB 4EEQA 4ZOLB 1IBLO 5KAIZ 4JV5B 1J95A 4G27B 1E1RG 2CGNA 3AG4B 1E79G 3APQA 3P30A 3G6EV 1N36O 2ZXWB 1SS3A 1M90W 4CS4A 2VS0A 2N04A 1XMQO 1IXMA 2AW9A 3K04A 2JGDA 3WG7C 1JR9A 2ATKC 5KX5B 1QLNA 3VOUA 2OCCB 3H1KH 5FPOA 3BA8A 5C8YA 5KHKA 1G6UA 1KBHA 1QHTA 3STLC 2WAMA 2HJDA 4JAUA 1FXKA 3MAQA 4PDVA 3DXRB 2HR3A 4LFBB 3S3XA 4PA9A 3QO7A 2WPDG 3NR7A 2P4VA 3ETQA 1FYJA 3ETDA 3CCSV 2ZR3A 4MS2A 4FLXA 4JTCB 3CEIA 1YF2A 3ZRVA 3OM3B 1H2GA 3WFVA 3J80N 2G38A 3CCUV 1XDCA 2P4KA 4LF6B 2VWKA 5F2VO 2F4VB 2RCVA 5KUMA 5J9PC 1AR5A 5BMVB 1W59A 1AILA 3FYIB 3L70H 1W2BU 3RVYA 3D36A 4OPAA 2ZDIC 3E35A 4NYKA 2MK3A 4LF4O 2KSDA 2WA4A 3ASNC 5B1AB 4I4TB 1BHAA 1YCIA 4CH5A 1CEZA 2LP7A 2DQ3A 5HFLA 2JJ1G 5BZBA 4I9QA 1THZA 1Q86W 3R66A 3ZJZA 4NB5A 1XHXA 3CRAA 4B3SO 3H1IH 4PA7A 2UXBO 4NXMO 4KFMA 4NTXA 4O2AA 1MSWD 4Z2WA 2XUMA 2DYSC 3OMIB 4B7EA 5EK0A 4R7CA 4X62B 4D6TH 3UM7A 3IC9A 4UVBA 3FFQA 4I55B 4E2LA 3ZCCA 2LGQA 5K1PA 4CC5A 3H1LH 3RN4A 2HVKC 4NXNO 5LA6A 1N32O 1AJPA 1Q82W 5TISZ 1I0HA 2VQEB 1R3JC 4UCOA 4TWKA 4UB6Z 2PYLA 4MVMA 4GKKO 1OCCC 4GX0A 2W6IG 1AI5A 4X88A 4WF9V 4DUYB 1OCRB 1VMGA 3G71V 3B8NA 2IU3A 3R65A 1OCOC 2DMXA 3WG7B 1PL0A 4JZ2A 2QDOA 1GKFA 2HJFC 1IXBA 4GUNA 2R70A 3CC4V 4JI1O 4PHZA 3OD4A 2YDEA 3ABLC 2L6LA 3D8CA 2YSUB 3ZS8C 2P7TC 2ARHA 3WB0A 5L3BA 2ZD9A 1HNWB 1I7FA 4MVQA 2K9PA 4DXWA 1H8HG 5AG2A 2OIEA 3FYEB 4PI2A 2X6CA 3EXAA 2JVDA 3RYHA 4U7OA 2Q73A 2UUCO 2WA3A 1KP3A 1TA8A 5CBGA 3JD3A 2FYUH 2NLJC 1XMOO 2OWOA 5FNVA 5E1AC 1QLEC 5IDJA 3E8HA 4BWAA 5KHGA 4TSFG 3RYIA 2ZQMA 4O4JB 3JD1A 3EHBB 3QTCA 2EULA 4LFAO 4OX9B 5CBHA 1AJQA 4NTWA 5IYZA 5JH7B 3NXSA 4OXSA 4GLXA 1EBOA 2F1MA 3K79A 5EIBC 4U3JA 4I5SA 4PA6A 1IDSA 1K5QA 3W7SA 2YXLA 1R1BA 4FLUA 4J9YB 3T1HO 1XEQA 1YITV 2RNBA 3AK3A 2ZM6O 1YJNV 4FLTA 1K8AW 4YJ2B 4DR3B 1Q43A 3ZEDA 3B8MA 2QKCA 4ZIBA 2DYRC 4ASUG 2JIZG 1K5SA 1L1FA 3KCYA 1CXZB 3CP1A 3GB7C 3HKDA 1S77D 3MDSA 1AP5A 4ZHQB 2YS8A 3CSXA 1VQ9V 1XREA 1PL4A 4LF9B 3O65A 3CMAV 3CCLV 1D5NA 5H2FZ 3QNEA 3OE7G 4O4HA 1YDXA 1GN4A 1VF5B 3CS5A 3RYCA 1OCOB 4WFHA 3AEIA 4DW1A 4JYYA 2VQFO 2CTQA 5KAFZ 5LXTB 3CC7V 5LGTA 3F7VC 2P67A 2AXTZ 3ABLB 1N33B 2WLIA 3UQ8A 3T1YO 3E8GA 2XAHA 3U0ZA 2UXCB 4WFGA 2JEXA 4O4IA 2EZPA 4MVSA 2DWDC 3OGIB 2QTOA 2CAZC 5B1BC 2E76B 4OPHA 4BW5A 2IM9A 4F6EA 1NH2B 2R9RB 4RWUA 4JI0O 4J10A 4O4IB 3SPIA 1JFFA 1R3IC 2EIKB 1L0LH 2WLLA 2JK5C 2Q5ZA 1VQ4V 3JAWA 4FK5C 1YI2V 4YJ3B 1IURA 2Y69B 5CB4A 1FFTB 3E8BA 3SR2C 2RQ6A 4G2KA 5BR8B 2BE3A 4I0XA 3ZRWA 2R9AA 5BXZA 3UO2A 2PUSA 2GBOA 4LF5O 3ZX6A 1B06A 3L72H 1G1XB 1QVFU 2P06A 1M56C 1NZ6A 4B7KA 1AI4A 3DGEA 5C93A 1BE3H 1EZVH 2GV9A 4DUZO 2HHHO 1SQBH 3H1JH 5IT9N 4WBNB 4PA4A 4DV2B 1ZL8A 3KDRA 1GO3F 4XDKA 4O4LB 4DR7B 2E75B 3E22A 3TK1A 2CTRA 1H38A 5EYPA 2QWQB 1HNXO 4JYCA 5JVDB 5ITZB 2AZ0A 4C7UA 3PN1A 1Z2GA 1Q6UA 3W7WA 3JSLA 4DR6B 4LFCO 4EFBA 2KG7A 1F23A 1AR1B 3N2KA 4DRXA 4YIOA 3K57A 3ASOB 1TUBA 3BABA 3Q4HA 4J41A 1J5EO 5IJ9A 4DV3B 4DV6O 3A0BZ 2QEXV 4X8AA 3JALA 4PDMA 4JYAB 1XL6A 2A0LA 1Y4MA 2F43G 3QVNA 4BW9A 1AB3A 3LNNA 1F7YA 2H3OA 1XNQB 3X2QC 4JI2B 3OUFA 4JI6O 3JARB 3ZMUA 1ZSPA 3AK1A 2XAQA 4IIJA 1LUVA 2Z3YA 4H33A 4DV7B 2JDIG 3K0DA 1Q8IA 2Q7HA 1ZLZA 5J2TB 3G4SV 4X20A 3J7AU 2Q8VA 4UCRA 2CH7B 1KC8W 2YIDA 1BGYH 3B4SA 3APOA 4K8ZA 4QPKA 3ABMC 1FXKC 1FXHA 4HNAA 1OCZB 4E4EA 4DR2B 5GONA 4TUYB 1ZAUA 5IY5C 5KLVH 4KP4A 2EJRA 1VQ6V 4QJFB 4L8JA 4ZKIA 3K59A 2ZT9B 3ICXA 3TCUA 2BTOA 4Z1MG 2BSKB 3N2GB 1JJOA 2UU9B 5EZYB 4B3TB 1HR0B 3HKBB 2GHYA 3BA9A 3STZC 2WLKA 3VQXA 3FB5C 2WLMA 3A0RA 1FXVA 1X4TA 1I94B 1SQQH 4EFEA 1VF6C 1HDJA 3JASB 1MZEA 5IJ0B 1EFRG 4AI8A 1KKDA 2AHZA 3CE2A 3OT7A 4J9ZB 3FKSG 2ZNIA 5CMUA 4AQYB 2CUGA 1Y74A 1GRJA 1Y67A 2UUBB 1NH2D 4ZOLA 3CRCA 1AROP 2ZE7A 1M56B 1JOYA 5H6QA 3OW2U 4JI5O 4P30A 2ZNJA 1LNQA 2A3QA 2PTMA 4TV8B 2LGWA 5DECA 2ZINA 3C3SA 3WU2Z 3IC7A 1CP9A 1VQKV 5KX5A 2DWEC 1FD9A 1YJ9V 1HWYA 1N34O 3RYFB 2VWJA 4YHHO 1MOFA 1YZBA 1ZX3A 4LCUC 3RW0A 1D5AA 2IW5A 2GSMB 5KMGB 3DXRA 1NBMG 4GKJO 4EB6B 2OT5A 4PI0A 4JI7B 4LC1A 4RQEA 1IBKB 5LMNO 1HW7A 3O9OA 2B9ZA 1GH6A 3AG2B 4ICGA 4MT8A 3A8TA 4FPPA 4R50A 1XL4A 1KB9F 5EIBD 4KXRA 3X2QB 1I08A 2NN4A 4WFEA 4X65O 2IBZH 2E5LB 3C3TA 1L0NH 3KKYA 5BMVA 4KUMA 3ZN1A 4J80A 1MG1A 3CCMV 1GMGA 4DR4B 3SGIA 2WLNA 4F4LA 1RM1B 4I4TA 3OR6C 5EC1C 5L3DA 1VEWA 4KHPO 1RP3B 2EBOA 2A06H 1FJGB 1QQCA 2ILMA 1M4UA 2QTSA 2WSSG 5LMUO 4J11A 5IY5B 4IHJB 1URFA 2GDSA 1DLBA 3AG1C 2EILC 1SA0B 3QO5A 3E8FA 1NQTA 4O2BB 5KHIA 1K97A 1KD1W 3UKMA 4ABMA 3ZMVA 4IYIA 1V54C 4UVCA 5JJJB 1GN3A 4I55A 3RWRD 3E89A 3AG3C 1BZKA 2X6BA 3H01A 5H5NA 3CXHF 5HFMA 4PELA 1P49A 5A2QN 2QGNA 4MVOA 2FTKA 1HNZB 3GWKC 5FL7G 1H2KA 1SKVA 4DV4B 4RQFA 5KHJA 4DR5B 3CRRA 1B6QA 1QNMA 4K8XA 3CX5F 4MW8A 1V55B 1QBZA 5FLXN 5LYJB 4PDLA 5EBWC 4D7TA 3THOA 4CBCA 3ZMZA 1BS3A 4FZ1A 3WB2A 4K0KO 5IWAB 2HVJC 1PM9A 3CRMA 1K9MW 1JMKC 2Y48A 2P22C 2CGOA 1GM8A 3IFXA 4DV5B 5EC2C 2F93B 2XHBA 2E3CA 2LFSA 3H9VA 5LP6C 3K08A 4AILC 4JI4O 4R6ZA 2N05A 4X1KB 1VQ7V 1BL8A 3CD6V 4YIPA 1Q81W 4RAIA 2ZE5A 1QR9A 4RO2A 1KUQA 4F6RB 4XDJA 2QWOB 3I5DA 4GX1A 2UXDO 4FIPC 1RSOB 1OZ0A 2GTAA
chains in the Genus database with same CATH topology
4JYYA 1Y67A 2GDSA 1WB8A 3IC9A 2AW9A 1JR9A 2ADPA 2ADQB 1XUQA 4BR6A 3QVNA 3C3SA 1KKCA 1GN3A 1BT8A 3RN4A 1ZTEA 4JZGA 1MSDA 4F6EA 1I0HA 1ZSPA 3AK1A 1LUVA 1GN2A 1VARA 1ZLZA 2QKAA 1IX9A 4X9QA 3EVKA 1MNGA 3TJTA 1IDSA 3CEIA 1AVMA 1QNMA 3DC5A 3BFRA 1N0NA 3AK2A 4E4EA 3AK3A 1EM1A 1SZXA 1AP6A 4JZ2A 1BS3A 1EN6A 1B06A 1XDCA 1IXBA 2P4KA 4GUNA 1BSMA 1MA1A 2RCVA 1PM9A 1JA8A 1AR5A 1EN5A 2QKCA 1I08A 1XILA 1N0JA 3LSUA 1ZUQA 3C3TA 3KKYA 3KDRA 1AR4A 1P7GA 3MDSA 1AP5A 1MMMA 1EN4A 1LUWA 1XREA 3K9SA 5A9GA 1PL4A 2CDYA 1WB7A 4YIPA 5AG2A 4C7UA 1VEWA 1D5NA 2CE4A 3DC6A 1GN4A 1GN6A 3OT7A 4YIOA 4FFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYY A;  1Y67 A;  2GDS A;  1WB8 A;  3IC9 A;  2AW9 A;  1JR9 A;  2ADP A;  2ADQ B;  1XUQ A;  4BR6 A;  3QVN A;  3C3S A;  1KKC A;  1GN3 A;  1BT8 A;  3RN4 A;  1ZTE A;  4JZG A;  1MSD A;  4F6E A;  1I0H A;  1ZSP A;  3AK1 A;  1LUV A;  1GN2 A;  1VAR A;  1ZLZ A;  2QKA A;  1IX9 A;  4X9Q A;  3EVK A;  1MNG A;  3TJT A;  1IDS A;  3CEI A;  1AVM A;  1QNM A;  3DC5 A;  3BFR A;  1N0N A;  3AK2 A;  4E4E A;  3AK3 A;  1EM1 A;  1SZX A;  1AP6 A;  4JZ2 A;  1BS3 A;  1EN6 A;  1B06 A;  1XDC A;  1IXB A;  2P4K A;  4GUN A;  1BSM A;  1MA1 A;  2RCV A;  1PM9 A;  1JA8 A;  1AR5 A;  1EN5 A;  2QKC A;  1I08 A;  1XIL A;  1N0J A;  3LSU A;  1ZUQ A;  3C3T A;  3KKY A;  1AR4 A;  1P7G A;  3MDS A;  1AP5 A;  1MMM A;  1EN4 A;  1LUW A;  1XRE A;  3K9S A;  5A9G A;  1PL4 A;  2CDY A;  1WB7 A;  4YIP A;  5AG2 A;  4C7U A;  1VEW A;  1D5N A;  2CE4 A;  3DC6 A;  1GN4 A;  1GN6 A;  3OT7 A;  4YIO A;  4FFK A; 
#chains in the Genus database with same CATH topology
 4X64 O;  2CTP A;  1NJI W;  1QU7 A;  4U3F H;  3TXS A;  4HZ3 A;  1KU9 A;  3HR0 A;  3JD4 A;  3JD0 A;  2EX3 A;  1OHH G;  3S3W A;  1IVS A;  3QO8 A;  3SDL A;  1ZTE A;  4B3M B;  1PKX A;  1TAE A;  2ZDI A;  4JV5 O;  4O4J A;  5JJE B;  4MTO A;  3CCQ V;  3W7T A;  1D2D A;  3UCS C;  4N21 A;  1GK9 A;  1WA8 B;  4FLY A;  3ML0 A;  4N23 A;  4FM0 A;  2ETN A;  1XNR B;  1AJN A;  4QNH B;  4GZR B;  1NR7 A;  1S76 D;  4B3R B;  1IX9 A;  3EVK A;  1SC5 B;  2AGA A;  1DF4 A;  3TJT A;  3M99 B;  4MVZ A;  5JH7 A;  3LSS A;  3ASN B;  2PI5 A;  1IBM B;  1AVM A;  1K73 W;  3LDD A;  3AK2 A;  3ABT A;  3OTO B;  3AG1 B;  3VQY A;  2UUA B;  3J81 N;  3CCJ V;  4CH3 A;  3IAY A;  1KP2 A;  4DV1 B;  1FFX B;  1EN5 A;  1JNB A;  1H8E G;  1V54 B;  1WLE A;  4LFB O;  3AG3 B;  4LF7 B;  1R73 A;  4JPR A;  4DR1 B;  4YJ2 A;  5D5P A;  2DYS B;  4QIW F;  1ZUQ A;  5LGN A;  1RPO A;  2Q67 A;  3HKC B;  3OEE G;  4X1Y B;  4LH7 A;  5JWP A;  1PNM A;  3P3P A;  2XAS A;  4W4K A;  5IYC O;  4LF6 O;  2D2C B;  2F4V O;  4ZHQ A;  3K0G A;  2CE4 A;  4JI3 B;  3ABK C;  2PGG A;  1GN6 A;  1H2N A;  4LWS B;  1S5L Z;  1ORQ C;  4X89 A;  3OMA B;  2ITD C;  2V7Q G;  3VQW A;  3ZIA G;  2HG5 C;  4DV0 B;  2PI4 A;  1G4Y B;  1X59 A;  3FX7 A;  1NT2 B;  1WB8 A;  1OCC B;  3K5L A;  2BOC C;  3FB7 C;  4MTX A;  5LXT A;  1XBL A;  1S5J A;  4JI8 B;  5LP6 B;  3I56 V;  2X0L A;  5CA1 A;  4X66 B;  3SYC A;  5L3E A;  4YY3 B;  3OTF A;  4MVU A;  1K4C C;  1Y76 B;  3JAT B;  2XT9 A;  1XI1 A;  1N8R W;  5JQG B;  1VQL V;  3OGC C;  4X62 O;  5CA1 B;  3HPL C;  3T4D A;  2CK3 G;  3KG2 A;  2BOB C;  2QE7 G;  4GCZ A;  1ZWI C;  4JTD B;  1P84 F;  5L3F A;  4YJ3 A;  3A2F A;  2JJ2 G;  2WWW A;  2GUZ A;  4X1I B;  2EJ7 A;  2VQE O;  4MTF A;  2ODM A;  1VP7 A;  1B04 A;  4XBF A;  4QGP A;  1IBL B;  1O9H A;  1BQZ A;  4DUY O;  1N36 B;  2GUZ B;  2M7W A;  1XMQ B;  3KCX A;  1DK1 A;  2P6J A;  1QLE B;  4GX5 A;  4TQD A;  4WBN A;  3E2E A;  3SYQ A;  4O4L A;  4BIO A;  4FLZ A;  5J2U B;  4H37 A;  4ZBM A;  5E79 Z;  1M57 C;  2Q69 A;  2P5O A;  3JYC A;  5JVD A;  5ITZ A;  3EFF K;  1NR1 A;  1F4N A;  3SYP A;  3OMN B;  3T1C A;  1SQF A;  2EZO A;  3FD9 A;  1Q7Y W;  3VBB A;  3GVM A;  2ADP A;  1XQ8 A;  4MVR A;  4TT3 G;  1HNW O;  3HKE B;  1GM7 A;  5LGU A;  4BR6 A;  2C2A A;  5B3S C;  1MAB G;  1JX9 A;  3JCZ A;  3LNM B;  3ABU A;  2QJ1 A;  4JZG A;  5DED A;  1MSD A;  3FAV B;  1BHB A;  2B1I A;  3CPW U;  2ZXW C;  1K34 A;  2HEP A;  1B3Q A;  3JAR A;  4FFB B;  4X9Q A;  1MNG A;  2DYR B;  2MW2 B;  4LF4 B;  2OCC C;  2PF4 E;  4IGG A;  2W0X A;  5CA0 B;  1UFI A;  4DYL A;  3BFR A;  5J2T A;  1DF5 A;  2YIA A;  2WLH A;  1QVG U;  5B1N A;  2EIN C;  3ZBH A;  3FB6 C;  2XAF A;  4OX9 O;  2CH7 A;  4B3S B;  4HYO A;  2UXB B;  1KYO F;  4NXM B;  4CC6 A;  1E1Q G;  2F23 A;  2QWN B;  4FZ0 A;  4UCT A;  3CYO A;  2H94 A;  4TUY A;  3JAK B;  3RFR A;  2N74 A;  4HBN A;  5CA3 A;  2ZIO A;  2P90 A;  2KB1 A;  4CH6 A;  1MMM A;  3D3Q A;  1SQG A;  2BSK A;  3N2G A;  2YIC A;  5EZY A;  5GW7 A;  3HKB A;  4TV9 B;  3IGA C;  3P3N A;  4DR3 O;  1YTF B;  3DC6 A;  3G6B A;  2Q9L A;  2FML A;  3CRQ A;  2LW1 A;  3TET A;  4NXN B;  1N32 B;  5B1B B;  3JAS A;  2IU0 A;  2F66 C;  2V1D A;  3SPH A;  5IJ0 A;  3SJQ C;  2CTW A;  5LOV B;  4GKK B;  2YEV B;  3JAM N;  1QCE A;  3B77 A;  3BEH A;  3D36 C;  4LNU B;  4ZI7 B;  4LF9 O;  5CBF A;  3ZN0 A;  2Z0A A;  4J7K A;  3B09 A;  3SJB C;  2JGU A;  1OV9 A;  2BTQ B;  2V4D A;  1IZ3 A;  1BQ0 A;  3L73 H;  4TV8 A;  2KKW A;  2O57 A;  4PV1 B;  5KA5 A;  4JI1 B;  4OGQ B;  3BAA A;  4FJC C;  1YJW V;  4MW3 A;  1M57 B;  2QKA A;  1N33 O;  3W7X A;  4P9O A;  3ZHU A;  1VQ8 V;  1PD3 A;  2Q0O C;  5KHH A;  3RYF A;  2UXC O;  1R3K C;  1VQM V;  2QSA A;  1NVP B;  1EM1 A;  4DK1 A;  1COW G;  5KMG A;  2JS3 A;  4EB6 A;  4NVP A;  1JA8 A;  3SJC C;  3CJH B;  2UUC B;  3UT5 B;  2ZKO A;  5JCO A;  1R6K A;  3CCR V;  3LDE A;  4WFF A;  1XMO B;  1OCR C;  4MTG A;  1WPX A;  2Q6A A;  4DW0 A;  3L9D A;  1H2M A;  4I50 B;  3CXC U;  3K9S A;  3CC2 V;  5BR8 O;  1TVK A;  2CDY A;  4Z1V A;  1H2S B;  2UXX A;  4LFA B;  5IE9 A;  2EIN B;  4W4L A;  2JGD B;  1TVK B;  2YC0 A;  5JJN B;  2JRI A;  4DV2 O;  1TGO A;  4DR7 O;  5C8Y B;  1XUQ A;  1M1K W;  4IHJ A;  4YXW G;  1M93 A;  3T1H B;  1KKC A;  1FXK B;  1YEW A;  3ABM B;  4UCU A;  4DR6 O;  1SA0 A;  4DO2 A;  3ETE A;  2ZM6 B;  3ETG A;  1Y6X A;  5KUK A;  3MD0 A;  4O2B A;  3BCC H;  3DSQ A;  5H6R A;  2BCC H;  1VQO V;  1I5X A;  1RPR A;  4GX2 A;  4DV3 O;  1VAR A;  4XDL A;  1U96 A;  4UCS A;  4JYA O;  1IJG A;  2DE0 X;  1U97 A;  1VF6 A;  2A79 B;  3F5T A;  3BVO A;  1K33 A;  2ZCE A;  2YIB D;  5IYB O;  5LHG A;  3VQV A;  5EBL C;  1XNQ O;  1P4R A;  4JI2 O;  5CN0 A;  2NNU A;  1AP6 A;  1NS1 A;  4BIU A;  1WNS A;  1WP7 A;  2A7W A;  1BSM A;  2FKX A;  5LYJ A;  4DV7 O;  2IJK A;  2B1G A;  2RDC A;  1S72 V;  2DOS A;  1YTF D;  1PNL A;  2QM7 A;  3MHS C;  3SPC A;  1N0J A;  2VQF B;  1BCC H;  1FS0 G;  4PJ0 Z;  2ZE8 A;  4UV9 A;  1EN4 A;  3T4Z A;  5KA6 A;  3ZHR A;  3TGU H;  3T1Y B;  4R8C A;  4U7N A;  1KEC A;  4DR2 O;  4IL6 Z;  4O2A B;  2XTA A;  4UCV A;  4GT1 A;  2B5U A;  3KZI Z;  4X1K A;  4CS3 A;  2AHY A;  3JD2 A;  5L3C A;  4FVM A;  4NTY A;  1H2L A;  5LL6 Y;  1UPG A;  2UU9 O;  4B3T O;  4JI0 B;  1HR0 O;  4F6R A;  2FL4 A;  1CPY A;  1R3L C;  1RSO A;  4FMT A;  3CCE V;  1I94 O;  5LA6 B;  1NKD A;  3RGB A;  4J7J A;  3OFN G;  1HP8 A;  4RUF A;  1NTK H;  3LDC A;  2VRZ A;  4LF5 B;  1OJH A;  2LW7 A;  2Q0A A;  1K7D A;  1NVP D;  4AQY O;  3A0H Z;  4IT5 A;  3CCV V;  2UUB O;  1EZJ A;  1SQP H;  2H8P C;  4DUZ B;  2IJH A;  2HHH B;  4A5U B;  1WA8 A;  2YI9 A;  3ZRS A;  2YI8 A;  2D3O W;  1WP8 A;  5IYD O;  1WN7 A;  2HFE C;  4JYB A;  3ZHT A;  4JAA A;  1HNX B;  2YXH A;  3F7Y C;  1EN6 A;  2UXN A;  4TOI A;  2RN9 A;  1V9P A;  3I55 V;  4JF3 A;  5H9C A;  4PA3 A;  4LFC B;  1AI7 A;  1W0K G;  4TQF A;  4D7S A;  2HKO A;  2EIK C;  3K58 A;  1FAF A;  3H1H H;  4FM1 A;  3DTU B;  3RVZ A;  2X7R B;  3LSU A;  3CB2 A;  1J5E B;  2Y69 C;  1WPB A;  4DV6 B;  1FFX A;  4JI7 O;  3N27 A;  3RYH B;  1VQP V;  2EIL B;  1NTZ H;  1IBK O;  3L71 H;  5B5E Z;  3BHP A;  1WB7 A;  3HKC A;  4X1Y A;  1XHZ A;  2Q4P A;  1JVM A;  1P7B A;  2DQ0 A;  3L74 H;  2EIM C;  3ZHQ A;  4UFZ A;  5FNV B;  4JI6 B;  1QR8 A;  4FFK A;  2GTS A;  5FPR A;  1FOU A;  1S5H C;  2FB5 A;  2E5L O;  1YVW A;  3RYI B;  3OAA G;  2HP8 A;  1JJ2 U;  1DTO A;  1TUE B;  2QWP B;  3OEH G;  4LWS A;  2OIG A;  2OYQ A;  3W7U A;  2EIJ C;  1M9N A;  4DR4 O;  1Q3E A;  1PP9 H;  4UB8 Z;  5IYZ B;  3BPZ A;  4WCE V;  2QM8 A;  4P9P A;  2PYJ A;  1VF7 A;  1FJG O;  4J42 A;  3QF7 A;  3HB3 B;  2Q7G A;  3P32 A;  3ASO C;  4LF8 B;  2XAJ A;  5LP6 A;  4U3J B;  3MHH C;  2Q68 A;  4I7Z B;  1FPO A;  4JTA B;  1GN2 A;  4EKW A;  4MSW C;  4CS2 A;  3K5N A;  1XOU A;  2OCH A;  1R6N A;  1Y76 A;  3JAT A;  2ZE6 A;  5JQG A;  1ROP A;  3U10 A;  1JQ0 A;  4IYH A;  2JS5 A;  2R72 A;  1Q5O A;  1FKA O;  1RFY A;  2K1E A;  1PV0 A;  4NKG B;  2IH1 C;  3E86 A;  1HNZ O;  3HKD B;  4JAS A;  1M5I A;  2QWR B;  1YXB A;  2OTJ V;  4X1I A;  4QE9 A;  5B1O A;  4DV4 O;  3M7M X;  4RUE A;  3B2E E;  3OR7 C;  4DR5 O;  1AR4 A;  5LHI A;  4O4H B;  1OCZ C;  4JI5 B;  5D5Q A;  1T5E A;  3RYC B;  3FB8 C;  1S3J A;  4J7Z A;  1WAZ A;  4UV8 A;  4BAY A;  5IWA O;  4FLW A;  4L87 A;  1Z5W A;  4Q20 A;  5GTH Z;  2WLI B;  2AZ2 A;  4DV5 O;  3JCU Z;  1YSC A;  5J2U A;  1PPJ H;  4K35 A;  1Q6I A;  1SQV H;  1N34 B;  1AI6 A;  1ENV A;  4LR3 A;  3CHX A;  1SQX H;  2Y0P A;  4YHH B;  1SER A;  3BY6 A;  4GYC B;  1NI8 A;  1MZF A;  3K03 A;  1G8M A;  2HLD G;  1JPX A;  5DM6 V;  4I9W A;  1YIJ V;  4QPJ A;  3F5W C;  3LUT B;  5B66 Z;  4GKJ B;  2OTL V;  2RJZ A;  3RT3 C;  1I5Y A;  1BT8 A;  5LMN B;  1SES A;  1JFF B;  3HKE A;  3JSN A;  2WLL B;  5EBM C;  2ITC C;  2QM4 A;  3CME V;  3JAW B;  5L3G A;  3SPJ A;  3K06 A;  1US6 A;  5CB4 B;  1JCH A;  3G80 A;  3G67 A;  2EIM B;  1YHQ V;  2R9I A;  3FAV A;  4I0X B;  3ZRW B;  4X65 B;  2JEU A;  2IJI A;  1GM9 A;  4H0L B;  3SJA C;  4AHC A;  2DJV A;  1PNK A;  4FFB A;  1R6T A;  3K5O A;  3ZHS A;  2IH3 C;  4BIZ A;  1SZX A;  2A9H A;  3AG4 C;  2EIJ B;  2DW4 A;  4B3M O;  5CA0 A;  4LBE C;  2WLJ A;  4FM2 A;  4KHP B;  3BRC A;  2LFR A;  3ABK B;  1ZL8 B;  1S0V A;  1NTM H;  2PY5 A;  1XNR O;  2Y0I A;  3E22 B;  3U11 A;  1KMI Z;  4B3R O;  3ZMS A;  5EYP B;  1Y66 A;  5LMU B;  4CH4 A;  1O9G A;  4UXN A;  4KL1 A;  1K4D C;  3D3I A;  1IBM O;  3T2M A;  1NU1 H;  1VIB A;  3B40 A;  5K1X A;  1WJZ A;  3JAK A;  2YIB A;  5A9G A;  1SZT A;  3IJ4 A;  3OTO O;  2W0F C;  1F51 A;  2KG7 B;  2LJ2 A;  3N2K B;  4DRX B;  4PD4 F;  5JCO C;  3ZHV A;  3AG2 C;  2UUA O;  4P2Z A;  4WFB V;  3C90 A;  2E74 B;  1TUB B;  1DGS A;  2XAG A;  1GAX A;  3Q4H B;  3SYO A;  5IJ9 B;  4DV1 O;  3JAL B;  4TV9 A;  5GTI Z;  4LF7 O;  4H13 B;  4DR1 O;  3K9A A;  1K92 A;  5LBQ A;  5LHH A;  2Z5U A;  4JGS A;  3TXQ A;  2ADQ B;  1RM1 C;  2Q7E A;  2F95 B;  1Z5V A;  5LOV A;  3SPG A;  4B08 A;  2YEV A;  2Y4T A;  4IIJ B;  1F4M A;  2X6A A;  2XND G;  2LO1 A;  4JI3 O;  4JAV A;  4LNU A;  2PZS A;  1SF9 A;  4DK0 A;  4NR1 A;  4LH6 A;  4ZI7 A;  4X20 B;  2M6Y A;  5B1A C;  4K0K B;  1N4C A;  4UUJ C;  1K3E A;  4LF8 O;  3WB1 A;  4DV0 O;  3L75 H;  3OUS A;  2BTQ A;  1Q90 D;  2KQX A;  3QG5 A;  2ZR2 A;  4HNA B;  3SYA A;  3RBZ A;  3CWB H;  4QE7 A;  5GON B;  4JI4 B;  4Q6G A;  2NR5 A;  3DC5 A;  4CZZ A;  1N0N A;  2QR4 A;  4JI8 O;  2XOK G;  1SRY A;  2RMK B;  3M8A A;  4FLV A;  2YXY A;  4X66 O;  1H5W A;  3LSQ A;  3K5M A;  3E83 A;  3ZMT A;  4YY3 O;  2QA4 V;  2QKS A;  1MA1 A;  2Y4U A;  5BY1 A;  3ZRX A;  3PJS K;  2ZIM A;  4H44 B;  1Q6H A;  2UXD B;  4K3A A;  1LR1 A;  3GWO A;  4X64 B;  4LP8 A;  1L8D A;  1XIL A;  1BMF G;  4WFA V;  2W6J G;  3CJH A;  2DN9 A;  3UT5 A;  1P7G A;  1V55 C;  5DN6 G;  1SET A;  1LUW A;  1W0J G;  3UO3 A;  1A32 A;  1VQN V;  4G28 B;  2IJJ A;  1VQ5 V;  2L35 A;  1GTO A;  4HAM A;  4PDR A;  3AG7 A;  1KQS U;  3K3W A;  4I50 A;  5B3S B;  1Y74 B;  2LQT A;  4UVA A;  2YUA A;  1UJW B;  4EEQ A;  4ZOL B;  1IBL O;  5KAI Z;  4JV5 B;  1J95 A;  4G27 B;  1E1R G;  2CGN A;  3AG4 B;  1E79 G;  3APQ A;  3P30 A;  3G6E V;  1N36 O;  2ZXW B;  1SS3 A;  1M90 W;  4CS4 A;  2VS0 A;  2N04 A;  1XMQ O;  1IXM A;  2AW9 A;  3K04 A;  2JGD A;  3WG7 C;  1JR9 A;  2ATK C;  5KX5 B;  1QLN A;  3VOU A;  2OCC B;  3H1K H;  5FPO A;  3BA8 A;  5C8Y A;  5KHK A;  1G6U A;  1KBH A;  1QHT A;  3STL C;  2WAM A;  2HJD A;  4JAU A;  1FXK A;  3MAQ A;  4PDV A;  3DXR B;  2HR3 A;  4LFB B;  3S3X A;  4PA9 A;  3QO7 A;  2WPD G;  3NR7 A;  2P4V A;  3ETQ A;  1FYJ A;  3ETD A;  3CCS V;  2ZR3 A;  4MS2 A;  4FLX A;  4JTC B;  3CEI A;  1YF2 A;  3ZRV A;  3OM3 B;  1H2G A;  3WFV A;  3J80 N;  2G38 A;  3CCU V;  1XDC A;  2P4K A;  4LF6 B;  2VWK A;  5F2V O;  2F4V B;  2RCV A;  5KUM A;  5J9P C;  1AR5 A;  5BMV B;  1W59 A;  1AIL A;  3FYI B;  3L70 H;  1W2B U;  3RVY A;  3D36 A;  4OPA A;  2ZDI C;  3E35 A;  4NYK A;  2MK3 A;  4LF4 O;  2KSD A;  2WA4 A;  3ASN C;  5B1A B;  4I4T B;  1BHA A;  1YCI A;  4CH5 A;  1CEZ A;  2LP7 A;  2DQ3 A;  5HFL A;  2JJ1 G;  5BZB A;  4I9Q A;  1THZ A;  1Q86 W;  3R66 A;  3ZJZ A;  4NB5 A;  1XHX A;  3CRA A;  4B3S O;  3H1I H;  4PA7 A;  2UXB O;  4NXM O;  4KFM A;  4NTX A;  4O2A A;  1MSW D;  4Z2W A;  2XUM A;  2DYS C;  3OMI B;  4B7E A;  5EK0 A;  4R7C A;  4X62 B;  4D6T H;  3UM7 A;  3IC9 A;  4UVB A;  3FFQ A;  4I55 B;  4E2L A;  3ZCC A;  2LGQ A;  5K1P A;  4CC5 A;  3H1L H;  3RN4 A;  2HVK C;  4NXN O;  5LA6 A;  1N32 O;  1AJP A;  1Q82 W;  5TIS Z;  1I0H A;  2VQE B;  1R3J C;  4UCO A;  4TWK A;  4UB6 Z;  2PYL A;  4MVM A;  4GKK O;  1OCC C;  4GX0 A;  2W6I G;  1AI5 A;  4X88 A;  4WF9 V;  4DUY B;  1OCR B;  1VMG A;  3G71 V;  3B8N A;  2IU3 A;  3R65 A;  1OCO C;  2DMX A;  3WG7 B;  1PL0 A;  4JZ2 A;  2QDO A;  1GKF A;  2HJF C;  1IXB A;  4GUN A;  2R70 A;  3CC4 V;  4JI1 O;  4PHZ A;  3OD4 A;  2YDE A;  3ABL C;  2L6L A;  3D8C A;  2YSU B;  3ZS8 C;  2P7T C;  2ARH A;  3WB0 A;  5L3B A;  2ZD9 A;  1HNW B;  1I7F A;  4MVQ A;  2K9P A;  4DXW A;  1H8H G;  5AG2 A;  2OIE A;  3FYE B;  4PI2 A;  2X6C A;  3EXA A;  2JVD A;  3RYH A;  4U7O A;  2Q73 A;  2UUC O;  2WA3 A;  1KP3 A;  1TA8 A;  5CBG A;  3JD3 A;  2FYU H;  2NLJ C;  1XMO O;  2OWO A;  5FNV A;  5E1A C;  1QLE C;  5IDJ A;  3E8H A;  4BWA A;  5KHG A;  4TSF G;  3RYI A;  2ZQM A;  4O4J B;  3JD1 A;  3EHB B;  3QTC A;  2EUL A;  4LFA O;  4OX9 B;  5CBH A;  1AJQ A;  4NTW A;  5IYZ A;  5JH7 B;  3NXS A;  4OXS A;  4GLX A;  1EBO A;  2F1M A;  3K79 A;  5EIB C;  4U3J A;  4I5S A;  4PA6 A;  1IDS A;  1K5Q A;  3W7S A;  2YXL A;  1R1B A;  4FLU A;  4J9Y B;  3T1H O;  1XEQ A;  1YIT V;  2RNB A;  3AK3 A;  2ZM6 O;  1YJN V;  4FLT A;  1K8A W;  4YJ2 B;  4DR3 B;  1Q43 A;  3ZED A;  3B8M A;  2QKC A;  4ZIB A;  2DYR C;  4ASU G;  2JIZ G;  1K5S A;  1L1F A;  3KCY A;  1CXZ B;  3CP1 A;  3GB7 C;  3HKD A;  1S77 D;  3MDS A;  1AP5 A;  4ZHQ B;  2YS8 A;  3CSX A;  1VQ9 V;  1XRE A;  1PL4 A;  4LF9 B;  3O65 A;  3CMA V;  3CCL V;  1D5N A;  5H2F Z;  3QNE A;  3OE7 G;  4O4H A;  1YDX A;  1GN4 A;  1VF5 B;  3CS5 A;  3RYC A;  1OCO B;  4WFH A;  3AEI A;  4DW1 A;  4JYY A;  2VQF O;  2CTQ A;  5KAF Z;  5LXT B;  3CC7 V;  5LGT A;  3F7V C;  2P67 A;  2AXT Z;  3ABL B;  1N33 B;  2WLI A;  3UQ8 A;  3T1Y O;  3E8G A;  2XAH A;  3U0Z A;  2UXC B;  4WFG A;  2JEX A;  4O4I A;  2EZP A;  4MVS A;  2DWD C;  3OGI B;  2QTO A;  2CAZ C;  5B1B C;  2E76 B;  4OPH A;  4BW5 A;  2IM9 A;  4F6E A;  1NH2 B;  2R9R B;  4RWU A;  4JI0 O;  4J10 A;  4O4I B;  3SPI A;  1JFF A;  1R3I C;  2EIK B;  1L0L H;  2WLL A;  2JK5 C;  2Q5Z A;  1VQ4 V;  3JAW A;  4FK5 C;  1YI2 V;  4YJ3 B;  1IUR A;  2Y69 B;  5CB4 A;  1FFT B;  3E8B A;  3SR2 C;  2RQ6 A;  4G2K A;  5BR8 B;  2BE3 A;  4I0X A;  3ZRW A;  2R9A A;  5BXZ A;  3UO2 A;  2PUS A;  2GBO A;  4LF5 O;  3ZX6 A;  1B06 A;  3L72 H;  1G1X B;  1QVF U;  2P06 A;  1M56 C;  1NZ6 A;  4B7K A;  1AI4 A;  3DGE A;  5C93 A;  1BE3 H;  1EZV H;  2GV9 A;  4DUZ O;  2HHH O;  1SQB H;  3H1J H;  5IT9 N;  4WBN B;  4PA4 A;  4DV2 B;  1ZL8 A;  3KDR A;  1GO3 F;  4XDK A;  4O4L B;  4DR7 B;  2E75 B;  3E22 A;  3TK1 A;  2CTR A;  1H38 A;  5EYP A;  2QWQ B;  1HNX O;  4JYC A;  5JVD B;  5ITZ B;  2AZ0 A;  4C7U A;  3PN1 A;  1Z2G A;  1Q6U A;  3W7W A;  3JSL A;  4DR6 B;  4LFC O;  4EFB A;  2KG7 A;  1F23 A;  1AR1 B;  3N2K A;  4DRX A;  4YIO A;  3K57 A;  3ASO B;  1TUB A;  3BAB A;  3Q4H A;  4J41 A;  1J5E O;  5IJ9 A;  4DV3 B;  4DV6 O;  3A0B Z;  2QEX V;  4X8A A;  3JAL A;  4PDM A;  4JYA B;  1XL6 A;  2A0L A;  1Y4M A;  2F43 G;  3QVN A;  4BW9 A;  1AB3 A;  3LNN A;  1F7Y A;  2H3O A;  1XNQ B;  3X2Q C;  4JI2 B;  3OUF A;  4JI6 O;  3JAR B;  3ZMU A;  1ZSP A;  3AK1 A;  2XAQ A;  4IIJ A;  1LUV A;  2Z3Y A;  4H33 A;  4DV7 B;  2JDI G;  3K0D A;  1Q8I A;  2Q7H A;  1ZLZ A;  5J2T B;  3G4S V;  4X20 A;  3J7A U;  2Q8V A;  4UCR A;  2CH7 B;  1KC8 W;  2YID A;  1BGY H;  3B4S A;  3APO A;  4K8Z A;  4QPK A;  3ABM C;  1FXK C;  1FXH A;  4HNA A;  1OCZ B;  4E4E A;  4DR2 B;  5GON A;  4TUY B;  1ZAU A;  5IY5 C;  5KLV H;  4KP4 A;  2EJR A;  1VQ6 V;  4QJF B;  4L8J A;  4ZKI A;  3K59 A;  2ZT9 B;  3ICX A;  3TCU A;  2BTO A;  4Z1M G;  2BSK B;  3N2G B;  1JJO A;  2UU9 B;  5EZY B;  4B3T B;  1HR0 B;  3HKB B;  2GHY A;  3BA9 A;  3STZ C;  2WLK A;  3VQX A;  3FB5 C;  2WLM A;  3A0R A;  1FXV A;  1X4T A;  1I94 B;  1SQQ H;  4EFE A;  1VF6 C;  1HDJ A;  3JAS B;  1MZE A;  5IJ0 B;  1EFR G;  4AI8 A;  1KKD A;  2AHZ A;  3CE2 A;  3OT7 A;  4J9Z B;  3FKS G;  2ZNI A;  5CMU A;  4AQY B;  2CUG A;  1Y74 A;  1GRJ A;  1Y67 A;  2UUB B;  1NH2 D;  4ZOL A;  3CRC A;  1ARO P;  2ZE7 A;  1M56 B;  1JOY A;  5H6Q A;  3OW2 U;  4JI5 O;  4P30 A;  2ZNJ A;  1LNQ A;  2A3Q A;  2PTM A;  4TV8 B;  2LGW A;  5DEC A;  2ZIN A;  3C3S A;  3WU2 Z;  3IC7 A;  1CP9 A;  1VQK V;  5KX5 A;  2DWE C;  1FD9 A;  1YJ9 V;  1HWY A;  1N34 O;  3RYF B;  2VWJ A;  4YHH O;  1MOF A;  1YZB A;  1ZX3 A;  4LCU C;  3RW0 A;  1D5A A;  2IW5 A;  2GSM B;  5KMG B;  3DXR A;  1NBM G;  4GKJ O;  4EB6 B;  2OT5 A;  4PI0 A;  4JI7 B;  4LC1 A;  4RQE A;  1IBK B;  5LMN O;  1HW7 A;  3O9O A;  2B9Z A;  1GH6 A;  3AG2 B;  4ICG A;  4MT8 A;  3A8T A;  4FPP A;  4R50 A;  1XL4 A;  1KB9 F;  5EIB D;  4KXR A;  3X2Q B;  1I08 A;  2NN4 A;  4WFE A;  4X65 O;  2IBZ H;  2E5L B;  3C3T A;  1L0N H;  3KKY A;  5BMV A;  4KUM A;  3ZN1 A;  4J80 A;  1MG1 A;  3CCM V;  1GMG A;  4DR4 B;  3SGI A;  2WLN A;  4F4L A;  1RM1 B;  4I4T A;  3OR6 C;  5EC1 C;  5L3D A;  1VEW A;  4KHP O;  1RP3 B;  2EBO A;  2A06 H;  1FJG B;  1QQC A;  2ILM A;  1M4U A;  2QTS A;  2WSS G;  5LMU O;  4J11 A;  5IY5 B;  4IHJ B;  1URF A;  2GDS A;  1DLB A;  3AG1 C;  2EIL C;  1SA0 B;  3QO5 A;  3E8F A;  1NQT A;  4O2B B;  5KHI A;  1K97 A;  1KD1 W;  3UKM A;  4ABM A;  3ZMV A;  4IYI A;  1V54 C;  4UVC A;  5JJJ B;  1GN3 A;  4I55 A;  3RWR D;  3E89 A;  3AG3 C;  1BZK A;  2X6B A;  3H01 A;  5H5N A;  3CXH F;  5HFM A;  4PEL A;  1P49 A;  5A2Q N;  2QGN A;  4MVO A;  2FTK A;  1HNZ B;  3GWK C;  5FL7 G;  1H2K A;  1SKV A;  4DV4 B;  4RQF A;  5KHJ A;  4DR5 B;  3CRR A;  1B6Q A;  1QNM A;  4K8X A;  3CX5 F;  4MW8 A;  1V55 B;  1QBZ A;  5FLX N;  5LYJ B;  4PDL A;  5EBW C;  4D7T A;  3THO A;  4CBC A;  3ZMZ A;  1BS3 A;  4FZ1 A;  3WB2 A;  4K0K O;  5IWA B;  2HVJ C;  1PM9 A;  3CRM A;  1K9M W;  1JMK C;  2Y48 A;  2P22 C;  2CGO A;  1GM8 A;  3IFX A;  4DV5 B;  5EC2 C;  2F93 B;  2XHB A;  2E3C A;  2LFS A;  3H9V A;  5LP6 C;  3K08 A;  4AIL C;  4JI4 O;  4R6Z A;  2N05 A;  4X1K B;  1VQ7 V;  1BL8 A;  3CD6 V;  4YIP A;  1Q81 W;  4RAI A;  2ZE5 A;  1QR9 A;  4RO2 A;  1KUQ A;  4F6R B;  4XDJ A;  2QWO B;  3I5D A;  4GX1 A;  2UXD O;  4FIP C;  1RSO B;  1OZ0 A;  2GTA A; 
#chains in the Genus database with same CATH homology
 4JYY A;  1Y67 A;  2GDS A;  1WB8 A;  3IC9 A;  2AW9 A;  1JR9 A;  2ADP A;  2ADQ B;  1XUQ A;  4BR6 A;  3QVN A;  3C3S A;  1KKC A;  1GN3 A;  1BT8 A;  3RN4 A;  1ZTE A;  4JZG A;  1MSD A;  4F6E A;  1I0H A;  1ZSP A;  3AK1 A;  1LUV A;  1GN2 A;  1VAR A;  1ZLZ A;  2QKA A;  1IX9 A;  4X9Q A;  3EVK A;  1MNG A;  3TJT A;  1IDS A;  3CEI A;  1AVM A;  1QNM A;  3DC5 A;  3BFR A;  1N0N A;  3AK2 A;  4E4E A;  3AK3 A;  1EM1 A;  1SZX A;  1AP6 A;  4JZ2 A;  1BS3 A;  1EN6 A;  1B06 A;  1XDC A;  1IXB A;  2P4K A;  4GUN A;  1BSM A;  1MA1 A;  2RCV A;  1PM9 A;  1JA8 A;  1AR5 A;  1EN5 A;  2QKC A;  1I08 A;  1XIL A;  1N0J A;  3LSU A;  1ZUQ A;  3C3T A;  3KKY A;  3KDR A;  1AR4 A;  1P7G A;  3MDS A;  1AP5 A;  1MMM A;  1EN4 A;  1LUW A;  1XRE A;  3K9S A;  5A9G A;  1PL4 A;  2CDY A;  1WB7 A;  4YIP A;  5AG2 A;  4C7U A;  1VEW A;  1D5N A;  2CE4 A;  3DC6 A;  1GN4 A;  1GN6 A;  3OT7 A;  4YIO A;  4FFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...