2P4KA

Contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAANVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2p4kA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2p4kA02
1XILA 3LSUA 4BR6A 4FFKA 1ZTEA 2CE4A 1WB8A 1AP5A 1VEWA 1IXBA 1D5NA 1BT8A 3KKYA 1N0JA 3C3SA 1EN5A 4YIPA 5A9GA 3AK3A 1AVMA 1ZSPA 2AW9A 1QNMA 1N0NA 1Y67A 1EN6A 1KKCA 1AP6A 2CDYA 3C3TA 1LUWA 3AK1A 4F6EA 1JA8A 1JR9A 2ADQB 1PL4A 1BS3A 1IX9A 3RN4A 2GDSA 4JZGA 4E4EA 4C7UA 2QKCA 2QKAA 3DC6A 3AK2A 5AG2A 1GN3A 1EM1A 1XREA 3OT7A 1I0HA 1MMMA 1P7GA 1MA1A 3K9SA 1GN4A 1XDCA 1PM9A 1VARA 3BFRA 1MSDA 1AR4A 1AR5A 1B06A 3DC5A 3EVKA 1WB7A 3MDSA 1EN4A 1GN2A 1I08A 3CEIA 3QVNA 1ZLZA 4JZ2A 4X9QA 1MNGA 1ZUQA 2ADPA 1LUVA 4YIOA 1BSMA 3TJTA 1IDSA 4JYYA 1GN6A 2P4KA 1XUQA 4GUNA 1SZXA 2RCVA 3IC9A
chains in the Genus database with same CATH superfamily
1K5SA 4DW0A 2QM7A 4DV0O 3KCXA 5IDJA 2HEPA 3G67A 1XNQO 4O4JA 1OCCB 5B1OA 1WAZA 1TUBB 2W6IG 4FM1A 5B1AC 1JMKC 3ABTA 2H8PC 4U3JB 3DSQA 1KP3A 2WLIA 4RUFA 4F4LA 2B9ZA 2M6YA 2R9RB 4O4HB 3OMIB 4I9QA 3C3TA 2JRIA 4UUJC 2WA4A 2E3CA 4LC1A 1S5HC 4KP4A 1YTFD 4LF4B 1PL4A 2GUZB 5LMNO 5CBGA 1QBZA 2EIJB 3R65A 4GLXA 2P67A 1IXMA 3RYCA 3RYHB 1IBKB 2IJHA 3L73H 3CX5F 2Q7EA 2W0XA 4WFAV 1MZFA 3OM3B 4E2LA 2XHBA 1ORQC 3CE2A 4YJ3B 3KG2A 1XQ8A 4X64B 4DUYO 5J9PC 4RAIA 3GVMA 1PV0A 1OCOC 2WLMA 4TOIA 3E8BA 3B2EE 3FAVB 3FB8C 1SF9A 3ZHRA 3WG7C 4PV1B 4UV8A 1NTMH 3JCUZ 1K73W 5DN6G 4GKJO 3JALB 2IM9A 2EZOA 5CA0A 1VQ5V 2C2AA 5F2VO 3VQWA 2Q5ZA 4W4KA 4BW9A 3APOA 4TSFG 2ZR3A 5LP6C 3O9OA 4HAMA 3NR7A 2FTKA 1NVPD 2YUAA 1GKFA 2Q0OC 5FPRA 2H94A 1VF6C 1YXBA 2KSDA 4YXWG 3OTFA 4X88A 2QGNA 1ZL8A 4IYIA 4LF7B 1NS1A 4DV3O 1V55C 1G1XB 2E74B 1KD1W 3WB1A 1XMQO 1DGSA 1UPGA 3CYOA 4G27B 4YY3O 1HNWO 2GHYA 4FVMA 1B3QA 5EYPB 1BGYH 2WLLB 1GK9A 4QE7A 2AW9A 4JI0O 3G71V 3ASNC 1IURA 4TQDA 1QVFU 2CTPA 4D7TA 4MTGA 2N04A 5L3FA 3CJHA 2QKSA 5LXTB 1RSOB 1BS3A 1IX9A 4OPHA 5H6RA 4JI5B 1FFXB 4J7ZA 1MSWD 3LDDA 3JAMN 3ZN1A 4JI4O 3CCSV 1NBMG 2V7QG 3RGBA 1K3EA 3UQ8A 1IZ3A 4B7EA 4GX1A 1NU1H 2A0LA 5JVDA 1SQPH 5KUKA 3VOUA 5IY5B 3CPWU 1M4UA 2Y0PA 4H13B 4WBNA 2CH7B 1N36O 3HKEB 3LSSA 2Q7GA 2A79B 1K4DC 1Q43A 1XBLA 2ZE6A 1XL6A 2D2CB 3L70H 4UCSA 3S3WA 3T1CA 1AR5A 1VQ6V 1VF7A 1JCHA 2M7WA 3TETA 1BCCH 2FKXA 1P7BA 3ABLC 4ZOLA 2V4DA 1H2KA 2JK5C 1K97A 2UXXA 4DV6O 4CS4A 2N05A 2A06H 3J7AU 1WA8B 1ZWIC 2NN4A 4A5UB 4NXNO 2ZINA 4K8XA 5JQGA 2OCHA 4O2BA 3AG1C 1GMGA 3JASB 2DE0X 3ETDA 4YHHO 1SQFA 1ZTEA 3LSQA 1Y4MA 2CTQA 3OD4A 3ICXA 2DW4A 2DYSB 3K59A 3KCYA 1OHHG 5KHJA 1R3LC 5J2UA 1AP5A 5JJJB 3I5DA 4UCOA 3JSNA 4JI1O 3H9VA 3UM7A 3D36C 1H2GA 3ML0A 3SYOA 3X2QB 1O9GA 4J7KA 3ABUA 2LFSA 4D7SA 4O4IB 1OCCC 4DV7O 2X0LA 1RM1B 4JF3A 4FFBA 2ADQB 4JYBA 3RYFB 5LMUO 1H2NA 3CCRV 2YC0A 4JV5O 1RFYA 3F5TA 3SPJA 1Q81W 4DR4B 3CXCU 5FPOA 2VQEB 4DV4O 2JS5A 5KAIZ 4GZRB 3ZMVA 1E1QG 1KUQA 4XBFA 1F4MA 1I0HA 4HNAA 3O65A 3K9SA 1GAXA 1E79G 5IWAO 1FXVA 2ZIMA 2EIJC 3W7XA 4DR7O 1EBOA 2F93B 5ITZB 1S77D 4JPRA 2QDOA 1URFA 1AR1B 3LNNA 3MDSA 2XOKG 2QWOB 1JX9A 2AHYA 3ABMB 4WFFA 1ZUQA 2DMXA 2A9HA 1S5JA 4GX2A 5GONA 3Q4HA 2OT5A 5LOVA 1AJQA 5D5PA 5H2FZ 3CRQA 1R3IC 3ABKB 5JCOA 4DK1A 2EIKB 5H5NA 4CH5A 5JWPA 1WPBA 4DR2B 2JIZG 1Q7YW 3ASOC 3CRMA 4LNUB 2YEVA 2Q0AA 4LFCB 3ZHTA 3BHPA 4FLVA 4UV9A 4FM0A 2JEXA 2F4VB 1WB8A 1P84F 2OCCB 1VEWA 1EZVH 2OTJV 4TWKA 5FL7G 2BCCH 2WLHA 4J41A 4YJ2A 2ATKC 2R70A 1M57B 1SQBH 2ZM6O 4FLWA 1N0NA 1FAFA 2NLJC 1QCEA 4WFEA 4DR3O 2ITDC 4R8CA 4IIJA 4FIPC 3AG7A 2ZD9A 2ZDIC 4J9ZB 4NTWA 3SJAC 1SA0A 5JH7A 4NXMB 1IVSA 2QTSA 4R50A 1S76D 1XOUA 2PZSA 3JAWA 2D3OW 3K58A 1QR8A 4JAUA 4B3TB 2ODMA 1AROP 3E8FA 3EFFK 2ZNJA 5GW7A 1YTFB 4DR6B 2PI4A 1XI1A 2P06A 2YIAA 5LGUA 3L75H 4IT5A 3VQXA 3TK1A 3K0DA 4I4TA 1XL4A 3C90A 1FFTB 1ROPA 4CH6A 1Q86W 5IY5C 4O4LB 4UCTA 3UT5A 2UU9B 3ZMZA 1HR0B 1G6UA 5C8YA 1AI5A 3FX7A 4LF4O 2EILB 2BSKB 3SYCA 1RPOA 4FPPA 1IDSA 3JARA 4TUYB 2UXBB 4JTCB 1NJIW 3U11A 4LWSA 4ASUG 3HKDB 1FOUA 4Z1VA 1IBKO 4UVAA 4X89A 2RCVA 4TT3G 3K3WA 4WCEV 2GV9A 3ZRVA 4QGPA 2EJRA 2JJ1G 1YSCA 2LW1A 3CCUV 4X64O 3FB7C 4F6RB 3H1HH 4HZ3A 4X1KA 5IYDO 5LBQA 2Y48A 2WSSG 4MTFA 1QLNA 3AK3A 1AVMA 4X1IA 4JI7B 1FXKB 3BPZA 3BEHA 1BQZA 2DYSC 3OAAG 2P6JA 2BOCC 1V54B 4EB6B 4Q20A 1H2SB 5CBFA 3JD3A 2L6LA 3SJBC 3P3PA 4IHJB 4JI2B 2XUMA 2GDSA 2YXLA 5IWAB 2X7RB 2JGDB 1Q6IA 4CS3A 1Q6UA 1M9NA 3K04A 3D3QA 5CA1A 4FLXA 2HFEC 5KUMA 2W6JG 1M56B 4MVSA 2EX3A 3ZRWB 4LF7O 5LYJA 2IH1C 2RMKB 5KAFZ 3CC7V 4Q6GA 3H1KH 5LHGA 4ABMA 1AR4A 1JVMA 2UUBB 1FXHA 3IFXA 3RYIB 4Z2WA 4ZHQA 5EZYA 1K8AW 2GSMB 5CBHA 1MG1A 3UO2A 2JDIG 5JJNB 5EC1C 3LDEA 2AGAA 1LUVA 5B1BC 3CCLV 1XNRB 4JI5O 4P9PA 2ZE7A 2QWPB 3W7TA 3ETEA 1XILA 4X1YB 4OX9B 1OCRB 1Y6XA 2B5UA 3T4DA 1P4RA 4FLZA 4X65B 1KBHA 3ABKC 2EIKC 2CTRA 1NTKH 4JYCA 4L87A 1JPXA 5CB4B 3WB0A 3OFNG 3QF7A 3BA9A 2DYRB 4KFMA 3F5WC 2OCCC 4UVCA 3BVOA 3T4ZA 4BIUA 2QSAA 4O2BB 1QHTA 4JI8B 4C7UA 1M57C 1Q82W 3ZCCA 2CGOA 3F7VC 1NZ6A 3DXRA 1I5XA 2A3QA 5AG2A 1GN3A 3HR0A 2CAZC 3OGCC 3JAKB 3N2GB 1ZAUA 1VQ7V 2YIBD 3LDCA 4GKKB 3SYAA 4LF5B 2LJ2A 3M8AA 4MVUA 3QO5A 1AILA 3SJCC 1N32B 3BFRA 1F23A 3ZX6A 3B09A 1NH2D 1PKXA 1QLEB 2UXDB 1DK1A 1NR1A 4I50B 1PNLA 4EFEA 1I08A 3A8TA 2F95B 3CSXA 3B8MA 2Q67A 3S3XA 2EULA 2IH3C 1J5EB 3EXAA 1TVKA 4O2AB 3TCUA 4JASA 4DR4O 1Y76B 2VQEO 4IYHA 2QWQB 1JQ0A 2XAGA 3AEIA 2W0FC 1LR1A 4FFKA 2XAHA 1Y74B 5KHIA 2EILC 5LP6A 4X62B 3P3NA 2CE4A 4JTAB 4GYCB 4UCVA 1MZEA 1THZA 1D5AA 4UCRA 1VF6A 3KKYA 1N0JA 3ZRXA 1SS3A 3K06A 4J11A 3SJQC 3TXQA 3I56V 3Q4HB 2PF4E 3B77A 4ZIBA 2BTOA 2HR3A 1AP6A 5EBLC 4UB8Z 5KHGA 4WFBV 3ZMTA 2FB5A 2HJFC 5IJ9B 4TV9B 1R6NA 4PA9A 4JZGA 3FYIB 2YEVB 4DR2O 3FFQA 3CCEV 1FXKC 3QG5A 1WP7A 2H3OA 4X20A 1V54C 4LFCO 2YXYA 3OMNB 2B1GA 5L3DA 1I94B 1SETA 2F4VO 2O57A 2RNBA 4U3FH 3N2KA 2ITCC 5L3GA 3K5NA 3BRCA 1VARA 4OXSA 3K5LA 1MSDA 3E8GA 5E79Z 1K34A 1UFIA 2CGNA 2PGGA 3MD0A 2Y0IA 3OTOB 4HBNA 3THOA 3K03A 4UVBA 4FLTA 4I55A 4QPKA 5KLVH 2YSUB 1BHAA 1W2BU 2EIMB 1SZTA 1X4TA 4J7JA 2XAJA 2Q8VA 4CZZA 3LNMB 4BWAA 3E35A 3OE7G 4NXMO 3GWOA 3G6BA 4I0XA 2RQ6A 3IC9A 2K9PA 4OPAA 4DV5B 4DRXB 3EHBB 3I55V 2ZXWC 4B3TO 5FNVB 1XMOB 2OYQA 4DR6O 4I4TB 3K5OA 4XDLA 2LFRA 3HKBB 1TAEA 3IGAC 3BABA 1M1KW 1LNQA 5BY1A 1K33A 4H37A 1OV9A 3L9DA 4P2ZA 3FB5C 3SDLA 3CWBH 5A2QN 4N21A 2HKOA 2Q7HA 2UU9O 4TV8A 3K0GA 3OR7C 1OCRC 1HR0O 3JARB 5J2TA 4LP8A 2VS0A 1KKCA 4ZI7B 2QA4V 3D36A 3RBZA 2UXBO 2X6AA 2NNUA 1QU7A 2YICA 1V9PA 1VQKV 3APQA 4B3SB 1TUBA 2FMLA 2HVKC 1SQQH 1Z2GA 4LF8B 2DYRC 5LHIA 5KMGB 3AG4B 1YZBA 4U3JA 2IJIA 1EM1A 1R3KC 2LQTA 3CP1A 4NTXA 3E83A 1MMMA 4O4HA 2X6BA 1IBLB 1XDCA 3CC4V 4LFBB 1PP9H 5IYZB 4H44B 4CBCA 4JI7O 1W59A 4G28B 2GUZA 1JFFB 1SESA 1S72V 4DR1B 3MHSC 3RYHA 2QWRB 4PDRA 3K9AA 2BTQA 4JI2O 1YCIA 2GTAA 1S0VA 4EKWA 5DEDA 3HKCB 2K1EA 1QLEC 5LL6Y 3SPHA 4YJ3A 1KYOF 1XUQA 2Z0AA 1K9MW 3SPGA 5JJEB 3J81N 4LH6A 1Q90D 1GO3F 1BQ0A 3JALA 3ZN0A 5H9CA 1N8RW 3CCQV 2UUBO 2KG7B 2DQ0A 3T1YB 4J80A 1BT8A 1GTOA 4J10A 3CB2A 3JD4A 3JSLA 4P30A 2E76B 1M5IA 4YIPA 1HDJA 5FLXN 1N33B 3SPIA 1PD3A 1YHQV 5IJ0B 3FKSG 4NR1A 2X6CA 2YIDA 2HHHB 1XNRO 1ENVA 1GH6A 1HWYA 2KQXA 2LGWA 4UFZA 1YF2A 3RN4A 3J80N 2DWEC 2ZT9B 3BY6A 1AI7A 5LA6B 4I7ZB 4R6ZA 3H01A 5H6QA 3DC6A 4OX9O 1K4CC 3RW0A 4Z1MG 2Z5UA 1ZX3A 2YXHA 2ZDIA 4X65O 2RN9A 2YI9A 3RWRD 1XREA 4MVZA 5EYPA 3ZMUA 2WLLA 5TISZ 2AZ0A 1KMIZ 3UKMA 2P22C 3W7SA 1N4CA 2Q69A 5DM6V 3TXSA 3B4SA 1CXZB 1KB9F 4PA7A 3OR6C 1VQ4V 4LFAB 5B1AB 4PDLA 5BMVA 3JD0A 5LXTA 2E75B 3ZBHA 1NQTA 1FFXA 4O4JB 4PJ0Z 3RFRA 1VQLV 2JS3A 5B1NA 3LUTB 4K0KB 4FM2A 4LCUC 4K3AA 2QR4A 4FMTA 3CXHF 3U0ZA 2WLIB 4JI8O 1TA8A 4QPJA 5D5QA 1GN6A 4DR5B 1NH2B 1R73A 2CH7A 4ZKIA 1S5LZ 2ETNA 2WPDG 2EIMC 2RDCA 1HNXB 2Q6AA 1K5QA 3K08A 4K8ZA 4X66B 2HG5C 4MT8A 4GKKO 3WB2A 1VQMV 1SERA 1BMFG 4LF5O 2UUCB 4LF9B 1JJOA 1N32O 4PA3A 5E1AC 3RYCB 1D5NA 1Y66A 1L0NH 2UXDO 3RVZA 1WA8A 4DYLA 1KQSU 1Z5WA 3BCCH 2QWNB 1YJNV 2IU0A 2DWDC 3K5MA 1TVKB 2P4VA 3BAAA 1SC5B 3JASA 4JAAA 2ZE5A 4AQYB 1J5EO 3D3IA 3SR2C 5KX5A 3OEEG 2QTOA 1GRJA 4E4EA 2Y69B 1BZKA 3JCZA 5CA0B 2Q73A 1YJWV 4X62O 2ZNIA 2F66C 1XEQA 4PD4F 4MSWC 1RPRA 5BR8B 4ICGA 1PM9A 5HFMA 3X2QC 2KKWA 2AZ2A 4JI3B 1F7YA 3AG4C 4JTDB 3OUSA 1WPXA 1H38A 4G2KA 1ZL8B 3A0HZ 4NKGB 1JOYA 4KHPB 3CEIA 1RM1C 3OMAB 2R72A 4MTXA 1CP9A 2VWJA 4PA4A 1K92A 4DV2B 3ZHVA 3E22A 4DW1A 2R9AA 2PI5A 3OGIB 4GUNA 1TGOA 4MVOA 5BXZA 2Y4TA 1R6KA 5ITZA 3CJHB 2L35A 4U7OA 1P49A 5IE9A 1IBMB 1I94O 1PL0A 1M90W 2QE7G 4JAVA 2IBZH 3G6EV 4B3RB 3OW2U 4NYKA 3CCJV 3FYEB 1X59A 3OUFA 5B3SB 3OTOO 2F1MA 1OJHA 5JVDB 2JVDA 2CTWA 4WBNB 2HLDG 4H33A 4CS2A 3FB6C 2OIEA 3ABMC 3SPCA 5CN0A 3ABLB 1Q6HA 1JJ2U 1JA8A 4LNUA 4RQFA 1FJGB 5EIBD 5B66Z 3CS5A 1VIBA 1J95A 4DO2A 2QKCA 4ZOLB 1EZJA 2QKAA 3RVYA 1SQVH 4DV5O 5L3BA 4X8AA 3AK2A 1XMOO 3DTUB 3MAQA 4JGSA 5C93A 5JQGB 1KECA 3SYQA 4FZ1A 4TV8B 3F7YC 5J2TB 1B06A 4XDJA 1R3JC 2GBOA 2LGQA 3ZS8C 3CMAV 3OEHG 4CC6A 5J2UB 2E5LB 3JATA 1KP2A 1VQOV 4R7CA 3TGUH 2UXCB 4LR3A 4MVRA 1MABG 1VF5B 1YJ9V 2YIBA 1AJPA 4B3SO 2P4KA 4GX0A 4LF8O 3CCMV 3IJ4A 4FFBB 4TQFA 4RWUA 1FD9A 3PJSK 1PNMA 4CC5A 2P7TC 2EINB 1IBLO 4D6TH 4O4LA 4QE9A 4B3MB 1G8MA 4LFBO 1YDXA 4J42A 5IYCO 1IXBA 3ZHQA 2BSKA 1SQXH 3C3SA 4NB5A 4PI0A 1N34B 4TUYA 4HNAB 2Q68A 2JGUA 2BTQB 3NXSA 4DR1O 1NTZH 4FJCC 2MK3A 1NR7A 3HKDA 4GX5A 4KXRA 1COWG 2A7WA 2EBOA 1DTOA 2WLNA 2F23A 4B08A 5K1PA 4F6RA 2ZKOA 1WLEA 3ETQA 1Q3EA 2QM4A 4J9YB 4KL1A 5EBMC 3D8CA 3K57A 4DV1B 5GONB 5LOVB 3ASOB 3JD2A 5LHHA 3OT7A 1PPJH 1PNKA 1FXKA 1MA1A 3PN1A 1H2LA 4UCUA 1HNZB 2Y69C 2VQFB 4I5SA 3T1YO 1VQ9V 5HFLA 3CD6V 5GTIZ 2UUAB 1W0KG 2HVJC 4EB6A 1BL8A 1DF4A 1OCZB 3AG2B 3ZEDA 4FLYA 1N33O 5B5EZ 4IHJA 2WLKA 2JGDA 2HHHO 4JYAO 2OIGA 4UB6Z 3VQYA 3KDRA 2FL4A 2IW5A 4DUZB 2P5OA 4YJ2B 3T1HB 1H8EG 1BHBA 4PDMA 4MVQA 3ZRWA 2LP7A 2QEXV 1T5EA 1TUEB 3K79A 1U96A 2ZE8A 1SZXA 3DGEA 4IIJB 3LSUA 1M56C 2FYUH 2P90A 2YS8A 2ZR2A 3RYIA 3H1LH 1SA0B 4B7KA 4LF6B 5JH7B 4RO2A 5BMVB 4MS2A 4N23A 2B1IA 1YEWA 3L71H 4LFAO 4AHCA 3JAWB 2XNDG 4JI6B 1M93A 4NTYA 1Q8IA 5A9GA 4BAYA 4K0KO 2JJ2G 4PI2A 4X1YA 1JR9A 2AHZA 3GWKC 3IC7A 1NKDA 5B3SC 2V1DA 4DR5O 3L74H 3IAYA 4PELA 4QJFB 1YIJV 1A32A 2Q9LA 3UT5B 5IYBO 3QO8A 2DQ3A 1KC8W 1F51A 3QTCA 5EBWC 4BW5A 1HNXO 5C8YB 4EFBA 2QM8A 4X66O 5CB4A 2NR5A 3CRCA 3RT3C 4DV0B 1FS0G 2XT9A 4LWSB 3T2MA 2UUCO 4LF9O 1KKDA 3L72H 2CK3G 1XNQB 2YDEA 1QQCA 2ZCEA 1UJWB 1GM7A 2ARHA 3DC5A 3EVKA 1VQ8V 3M7MX 5KX5B 3CHXA 3P30A 3QVNA 2ILMA 4X1KB 1ZLZA 1YVWA 4AQYO 4LBEC 1MNGA 4KUMA 3ZMSA 4LH7A 4DK0A 4GT1A 3CMEV 3JAKA 3N2GA 4JYYA 1L8DA 4X1IB 5LMNB 2PTMA 2R9IA 4RQEA 3MHHC 3W7UA 5KA6A 5L3EA 2PY5A 1HW7A 1EFRG 4WFGA 1I7FA 5BR8O 4I50A 1AI4A 1H2MA 1K7DA 5CA1B 4JI3O 4DUYB 2BOBC 1DF5A 3CC2V 4CH3A 1NI8A 4KHPO 4ZBMA 1H8HG 4O2AA 5LYJB 3FAVA 2IU3A 2EINC 1EN6A 1Y76A 3E89A 2XAQA 3A0BZ 3UO3A 2CDYA 4MW8A 4DXWA 4GKJB 3E22B 1XHXA 1G4YB 4DV2O 4I9WA 1Y74A 3AG3B 1W0JG 4ZHQB 5B1BB 2LW7A 5EZYB 3P32A 2XTAA 2Z3YA 4HYOA 2WAMA 1KU9A 1VQNV 1IBMO 2AXTZ 2G38A 2QJ1A 1VP7A 3CRRA 4K35A 1Q5OA 2EZPA 5KHHA 2OWOA 4JYAB 4B3RO 4IGGA 2MW2B 1CEZA 4DV3B 4AILC 1GM8A 5IJ9A 3STZC 1WB7A 4BIZA 4YY3B 1XMQB 1HNWB 4TV9A 4L8JA 4JI0B 1O9HA 1US6A 5DECA 5BZBA 1GN2A 5JCOC 4EEQA 2OTLV 3QO7A 1FJGO 1R6TA 5EC2C 3KZIZ 1GM9A 1OCZC 3AG2C 1BE3H 4QIWF 2HJDA 1XHZA 2PUSA 4NVPA 1RSOA 1YITV 4JI4B 4BR6A 4FK5C 1WNSA 2WLJA 4OGQB 1VMGA 2PYJA 1B04A 2HP8A 4UXNA 2Y4UA 3CRAA 3DXRB 1N36B 1JNBA 3ZIAG 3JATB 1R1BA 3GB7C 3JYCA 3HKEA 3CCVV 3WFVA 2E5LO 1YI2V 1D2DA 1QNMA 3STLC 2IJJA 5CMUA 2UXCO 3AK1A 4BIOA 4F6EA 3A2FA 2DOSA 2GTSA 4FZ0A 1RP3B 4CH4A 4DRXA 4GCZA 2UXNA 4DV6B 3HPLC 5FNVA 1SQGA 4PA6A 3WU2Z 3HKBA 4NXNB 1OCOB 3JD1A 3WG7B 3U10A 3UCSC 4YHHB 5IT9N 4WF9V 4U7NA 3E2EA 4H0LB 4B3MO 2XAFA 3A0RA 2CUGA 1GN4A 4W4LA 2WA3A 4ZI7A 5KHKA 1N34O 1E1RG 3N27A 1WJZA 5LP6B 4JI1B 4RUEA 1FKAO 2VWKA 1S3JA 2PYLA 3W7WA 4X9QA 4MW3A 5KA5A 3HB3B 2ADPA 4DV7B 3ZHUA 5KMGA 1BSMA 1L0LH 4O4IA 5LMUB 1WP8A 2EJ7A 1OZ0A 2N74A 4JV5B 1V55B 4DV1O 1NVPB 2BE3A 3RYFA 1QVGU 3H1IH 3BA8A 4FLUA 5EK0A 1FPOA 5IYZA 4DV4B 3ASNB 2WWWA 1QR9A 1U97A 1L1FA 1JFFA 3ZRSA 1HNZO 2VQFO 3E86A 2UUAO 2IJKA 3G80A 1HP8A 1VQPV 4AI8A 4X20B 4DR7B 3FD9A 1EN5A 4XDKA 3HKCA 1ZSPA 1MOFA 1DLBA 1Y67A 2KB1A 3B8NA 3N2KB 4QNHB 1LUWA 4DUZO 3T1HO 3ETGA 2DJVA 2VRZA 2JEUA 4I55B 2ZIOA 2Q4PA 5L3CA 4WFHA 2LO1A 1F4NA 3B40A 2KG7A 2F43G 3QNEA 1FYJA 3R66A 2RJZA 4LF6O 1AJNA 2ZXWB 1P7GA 3AG3C 5K1XA 1B6QA 5IJ0A 4I0XB 1I5YA 1SRYA 2XASA 3ZJZA 2ZQMA 4JI6O 3SGIA 3ZHSA 5CA3A 5LGTA 4MVMA 4IL6Z 4P9OA 1SKVA 3E8HA 3AG1B 4PHZA 3VQVA 1EN4A 2ZM6B 1NT2B 5LA6A 5EIBC 4JZ2A 3VBBA 1AB3A 1WN7A 4DR3B 4MTOA 4PDVA 1H5WA 4YIOA 3G4SV 3H1JH 2DN9A 3TJTA 1Z5VA 5LGNA 3SYPA 2YI8A 1CPYA 3M99B 1IJGA 5GTHZ 1AI6A
chains in the Genus database with same CATH topology
1XILA 3LSUA 4BR6A 4FFKA 1ZTEA 2CE4A 1WB8A 1AP5A 1VEWA 1IXBA 1D5NA 1BT8A 3KKYA 1N0JA 3C3SA 1EN5A 4YIPA 5A9GA 3AK3A 1AVMA 1ZSPA 2AW9A 1QNMA 1N0NA 1Y67A 1EN6A 1KKCA 1AP6A 2CDYA 3C3TA 1LUWA 3AK1A 4F6EA 1JA8A 1JR9A 2ADQB 1PL4A 1BS3A 1IX9A 3RN4A 2GDSA 4JZGA 4E4EA 4C7UA 2QKCA 2QKAA 3DC6A 3AK2A 5AG2A 1GN3A 1EM1A 1XREA 3OT7A 1I0HA 1MMMA 1P7GA 1MA1A 3K9SA 1GN4A 1XDCA 1PM9A 1VARA 3BFRA 1MSDA 1AR4A 1AR5A 1B06A 3DC5A 3EVKA 1WB7A 3MDSA 1EN4A 1GN2A 1I08A 3CEIA 3QVNA 1ZLZA 4JZ2A 4X9QA 1MNGA 3KDRA 1ZUQA 2ADPA 1LUVA 4YIOA 1BSMA 3TJTA 1IDSA 4JYYA 1GN6A 2P4KA 1XUQA 4GUNA 1SZXA 2RCVA 3IC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XIL A;  3LSU A;  4BR6 A;  4FFK A;  1ZTE A;  2CE4 A;  1WB8 A;  1AP5 A;  1VEW A;  1IXB A;  1D5N A;  1BT8 A;  3KKY A;  1N0J A;  3C3S A;  1EN5 A;  4YIP A;  5A9G A;  3AK3 A;  1AVM A;  1ZSP A;  2AW9 A;  1QNM A;  1N0N A;  1Y67 A;  1EN6 A;  1KKC A;  1AP6 A;  2CDY A;  3C3T A;  1LUW A;  3AK1 A;  4F6E A;  1JA8 A;  1JR9 A;  2ADQ B;  1PL4 A;  1BS3 A;  1IX9 A;  3RN4 A;  2GDS A;  4JZG A;  4E4E A;  4C7U A;  2QKC A;  2QKA A;  3DC6 A;  3AK2 A;  5AG2 A;  1GN3 A;  1EM1 A;  1XRE A;  3OT7 A;  1I0H A;  1MMM A;  1P7G A;  1MA1 A;  3K9S A;  1GN4 A;  1XDC A;  1PM9 A;  1VAR A;  3BFR A;  1MSD A;  1AR4 A;  1AR5 A;  1B06 A;  3DC5 A;  3EVK A;  1WB7 A;  3MDS A;  1EN4 A;  1GN2 A;  1I08 A;  3CEI A;  3QVN A;  1ZLZ A;  4JZ2 A;  4X9Q A;  1MNG A;  1ZUQ A;  2ADP A;  1LUV A;  4YIO A;  1BSM A;  3TJT A;  1IDS A;  4JYY A;  1GN6 A;  2P4K A;  1XUQ A;  4GUN A;  1SZX A;  2RCV A;  3IC9 A; 
#chains in the Genus database with same CATH topology
 1K5S A;  4DW0 A;  2QM7 A;  4DV0 O;  3KCX A;  5IDJ A;  2HEP A;  3G67 A;  1XNQ O;  4O4J A;  1OCC B;  5B1O A;  1WAZ A;  1TUB B;  2W6I G;  4FM1 A;  5B1A C;  1JMK C;  3ABT A;  2H8P C;  4U3J B;  3DSQ A;  1KP3 A;  2WLI A;  4RUF A;  4F4L A;  2B9Z A;  2M6Y A;  2R9R B;  4O4H B;  3OMI B;  4I9Q A;  3C3T A;  2JRI A;  4UUJ C;  2WA4 A;  2E3C A;  4LC1 A;  1S5H C;  4KP4 A;  1YTF D;  4LF4 B;  1PL4 A;  2GUZ B;  5LMN O;  5CBG A;  1QBZ A;  2EIJ B;  3R65 A;  4GLX A;  2P67 A;  1IXM A;  3RYC A;  3RYH B;  1IBK B;  2IJH A;  3L73 H;  3CX5 F;  2Q7E A;  2W0X A;  4WFA V;  1MZF A;  3OM3 B;  4E2L A;  2XHB A;  1ORQ C;  3CE2 A;  4YJ3 B;  3KG2 A;  1XQ8 A;  4X64 B;  4DUY O;  5J9P C;  4RAI A;  3GVM A;  1PV0 A;  1OCO C;  2WLM A;  4TOI A;  3E8B A;  3B2E E;  3FAV B;  3FB8 C;  1SF9 A;  3ZHR A;  3WG7 C;  4PV1 B;  4UV8 A;  1NTM H;  3JCU Z;  1K73 W;  5DN6 G;  4GKJ O;  3JAL B;  2IM9 A;  2EZO A;  5CA0 A;  1VQ5 V;  2C2A A;  5F2V O;  3VQW A;  2Q5Z A;  4W4K A;  4BW9 A;  3APO A;  4TSF G;  2ZR3 A;  5LP6 C;  3O9O A;  4HAM A;  3NR7 A;  2FTK A;  1NVP D;  2YUA A;  1GKF A;  2Q0O C;  5FPR A;  2H94 A;  1VF6 C;  1YXB A;  2KSD A;  4YXW G;  3OTF A;  4X88 A;  2QGN A;  1ZL8 A;  4IYI A;  4LF7 B;  1NS1 A;  4DV3 O;  1V55 C;  1G1X B;  2E74 B;  1KD1 W;  3WB1 A;  1XMQ O;  1DGS A;  1UPG A;  3CYO A;  4G27 B;  4YY3 O;  1HNW O;  2GHY A;  4FVM A;  1B3Q A;  5EYP B;  1BGY H;  2WLL B;  1GK9 A;  4QE7 A;  2AW9 A;  4JI0 O;  3G71 V;  3ASN C;  1IUR A;  4TQD A;  1QVF U;  2CTP A;  4D7T A;  4MTG A;  2N04 A;  5L3F A;  3CJH A;  2QKS A;  5LXT B;  1RSO B;  1BS3 A;  1IX9 A;  4OPH A;  5H6R A;  4JI5 B;  1FFX B;  4J7Z A;  1MSW D;  3LDD A;  3JAM N;  3ZN1 A;  4JI4 O;  3CCS V;  1NBM G;  2V7Q G;  3RGB A;  1K3E A;  3UQ8 A;  1IZ3 A;  4B7E A;  4GX1 A;  1NU1 H;  2A0L A;  5JVD A;  1SQP H;  5KUK A;  3VOU A;  5IY5 B;  3CPW U;  1M4U A;  2Y0P A;  4H13 B;  4WBN A;  2CH7 B;  1N36 O;  3HKE B;  3LSS A;  2Q7G A;  2A79 B;  1K4D C;  1Q43 A;  1XBL A;  2ZE6 A;  1XL6 A;  2D2C B;  3L70 H;  4UCS A;  3S3W A;  3T1C A;  1AR5 A;  1VQ6 V;  1VF7 A;  1JCH A;  2M7W A;  3TET A;  1BCC H;  2FKX A;  1P7B A;  3ABL C;  4ZOL A;  2V4D A;  1H2K A;  2JK5 C;  1K97 A;  2UXX A;  4DV6 O;  4CS4 A;  2N05 A;  2A06 H;  3J7A U;  1WA8 B;  1ZWI C;  2NN4 A;  4A5U B;  4NXN O;  2ZIN A;  4K8X A;  5JQG A;  2OCH A;  4O2B A;  3AG1 C;  1GMG A;  3JAS B;  2DE0 X;  3ETD A;  4YHH O;  1SQF A;  1ZTE A;  3LSQ A;  1Y4M A;  2CTQ A;  3OD4 A;  3ICX A;  2DW4 A;  2DYS B;  3K59 A;  3KCY A;  1OHH G;  5KHJ A;  1R3L C;  5J2U A;  1AP5 A;  5JJJ B;  3I5D A;  4UCO A;  3JSN A;  4JI1 O;  3H9V A;  3UM7 A;  3D36 C;  1H2G A;  3ML0 A;  3SYO A;  3X2Q B;  1O9G A;  4J7K A;  3ABU A;  2LFS A;  4D7S A;  4O4I B;  1OCC C;  4DV7 O;  2X0L A;  1RM1 B;  4JF3 A;  4FFB A;  2ADQ B;  4JYB A;  3RYF B;  5LMU O;  1H2N A;  3CCR V;  2YC0 A;  4JV5 O;  1RFY A;  3F5T A;  3SPJ A;  1Q81 W;  4DR4 B;  3CXC U;  5FPO A;  2VQE B;  4DV4 O;  2JS5 A;  5KAI Z;  4GZR B;  3ZMV A;  1E1Q G;  1KUQ A;  4XBF A;  1F4M A;  1I0H A;  4HNA A;  3O65 A;  3K9S A;  1GAX A;  1E79 G;  5IWA O;  1FXV A;  2ZIM A;  2EIJ C;  3W7X A;  4DR7 O;  1EBO A;  2F93 B;  5ITZ B;  1S77 D;  4JPR A;  2QDO A;  1URF A;  1AR1 B;  3LNN A;  3MDS A;  2XOK G;  2QWO B;  1JX9 A;  2AHY A;  3ABM B;  4WFF A;  1ZUQ A;  2DMX A;  2A9H A;  1S5J A;  4GX2 A;  5GON A;  3Q4H A;  2OT5 A;  5LOV A;  1AJQ A;  5D5P A;  5H2F Z;  3CRQ A;  1R3I C;  3ABK B;  5JCO A;  4DK1 A;  2EIK B;  5H5N A;  4CH5 A;  5JWP A;  1WPB A;  4DR2 B;  2JIZ G;  1Q7Y W;  3ASO C;  3CRM A;  4LNU B;  2YEV A;  2Q0A A;  4LFC B;  3ZHT A;  3BHP A;  4FLV A;  4UV9 A;  4FM0 A;  2JEX A;  2F4V B;  1WB8 A;  1P84 F;  2OCC B;  1VEW A;  1EZV H;  2OTJ V;  4TWK A;  5FL7 G;  2BCC H;  2WLH A;  4J41 A;  4YJ2 A;  2ATK C;  2R70 A;  1M57 B;  1SQB H;  2ZM6 O;  4FLW A;  1N0N A;  1FAF A;  2NLJ C;  1QCE A;  4WFE A;  4DR3 O;  2ITD C;  4R8C A;  4IIJ A;  4FIP C;  3AG7 A;  2ZD9 A;  2ZDI C;  4J9Z B;  4NTW A;  3SJA C;  1SA0 A;  5JH7 A;  4NXM B;  1IVS A;  2QTS A;  4R50 A;  1S76 D;  1XOU A;  2PZS A;  3JAW A;  2D3O W;  3K58 A;  1QR8 A;  4JAU A;  4B3T B;  2ODM A;  1ARO P;  3E8F A;  3EFF K;  2ZNJ A;  5GW7 A;  1YTF B;  4DR6 B;  2PI4 A;  1XI1 A;  2P06 A;  2YIA A;  5LGU A;  3L75 H;  4IT5 A;  3VQX A;  3TK1 A;  3K0D A;  4I4T A;  1XL4 A;  3C90 A;  1FFT B;  1ROP A;  4CH6 A;  1Q86 W;  5IY5 C;  4O4L B;  4UCT A;  3UT5 A;  2UU9 B;  3ZMZ A;  1HR0 B;  1G6U A;  5C8Y A;  1AI5 A;  3FX7 A;  4LF4 O;  2EIL B;  2BSK B;  3SYC A;  1RPO A;  4FPP A;  1IDS A;  3JAR A;  4TUY B;  2UXB B;  4JTC B;  1NJI W;  3U11 A;  4LWS A;  4ASU G;  3HKD B;  1FOU A;  4Z1V A;  1IBK O;  4UVA A;  4X89 A;  2RCV A;  4TT3 G;  3K3W A;  4WCE V;  2GV9 A;  3ZRV A;  4QGP A;  2EJR A;  2JJ1 G;  1YSC A;  2LW1 A;  3CCU V;  4X64 O;  3FB7 C;  4F6R B;  3H1H H;  4HZ3 A;  4X1K A;  5IYD O;  5LBQ A;  2Y48 A;  2WSS G;  4MTF A;  1QLN A;  3AK3 A;  1AVM A;  4X1I A;  4JI7 B;  1FXK B;  3BPZ A;  3BEH A;  1BQZ A;  2DYS C;  3OAA G;  2P6J A;  2BOC C;  1V54 B;  4EB6 B;  4Q20 A;  1H2S B;  5CBF A;  3JD3 A;  2L6L A;  3SJB C;  3P3P A;  4IHJ B;  4JI2 B;  2XUM A;  2GDS A;  2YXL A;  5IWA B;  2X7R B;  2JGD B;  1Q6I A;  4CS3 A;  1Q6U A;  1M9N A;  3K04 A;  3D3Q A;  5CA1 A;  4FLX A;  2HFE C;  5KUM A;  2W6J G;  1M56 B;  4MVS A;  2EX3 A;  3ZRW B;  4LF7 O;  5LYJ A;  2IH1 C;  2RMK B;  5KAF Z;  3CC7 V;  4Q6G A;  3H1K H;  5LHG A;  4ABM A;  1AR4 A;  1JVM A;  2UUB B;  1FXH A;  3IFX A;  3RYI B;  4Z2W A;  4ZHQ A;  5EZY A;  1K8A W;  2GSM B;  5CBH A;  1MG1 A;  3UO2 A;  2JDI G;  5JJN B;  5EC1 C;  3LDE A;  2AGA A;  1LUV A;  5B1B C;  3CCL V;  1XNR B;  4JI5 O;  4P9P A;  2ZE7 A;  2QWP B;  3W7T A;  3ETE A;  1XIL A;  4X1Y B;  4OX9 B;  1OCR B;  1Y6X A;  2B5U A;  3T4D A;  1P4R A;  4FLZ A;  4X65 B;  1KBH A;  3ABK C;  2EIK C;  2CTR A;  1NTK H;  4JYC A;  4L87 A;  1JPX A;  5CB4 B;  3WB0 A;  3OFN G;  3QF7 A;  3BA9 A;  2DYR B;  4KFM A;  3F5W C;  2OCC C;  4UVC A;  3BVO A;  3T4Z A;  4BIU A;  2QSA A;  4O2B B;  1QHT A;  4JI8 B;  4C7U A;  1M57 C;  1Q82 W;  3ZCC A;  2CGO A;  3F7V C;  1NZ6 A;  3DXR A;  1I5X A;  2A3Q A;  5AG2 A;  1GN3 A;  3HR0 A;  2CAZ C;  3OGC C;  3JAK B;  3N2G B;  1ZAU A;  1VQ7 V;  2YIB D;  3LDC A;  4GKK B;  3SYA A;  4LF5 B;  2LJ2 A;  3M8A A;  4MVU A;  3QO5 A;  1AIL A;  3SJC C;  1N32 B;  3BFR A;  1F23 A;  3ZX6 A;  3B09 A;  1NH2 D;  1PKX A;  1QLE B;  2UXD B;  1DK1 A;  1NR1 A;  4I50 B;  1PNL A;  4EFE A;  1I08 A;  3A8T A;  2F95 B;  3CSX A;  3B8M A;  2Q67 A;  3S3X A;  2EUL A;  2IH3 C;  1J5E B;  3EXA A;  1TVK A;  4O2A B;  3TCU A;  4JAS A;  4DR4 O;  1Y76 B;  2VQE O;  4IYH A;  2QWQ B;  1JQ0 A;  2XAG A;  3AEI A;  2W0F C;  1LR1 A;  4FFK A;  2XAH A;  1Y74 B;  5KHI A;  2EIL C;  5LP6 A;  4X62 B;  3P3N A;  2CE4 A;  4JTA B;  4GYC B;  4UCV A;  1MZE A;  1THZ A;  1D5A A;  4UCR A;  1VF6 A;  3KKY A;  1N0J A;  3ZRX A;  1SS3 A;  3K06 A;  4J11 A;  3SJQ C;  3TXQ A;  3I56 V;  3Q4H B;  2PF4 E;  3B77 A;  4ZIB A;  2BTO A;  2HR3 A;  1AP6 A;  5EBL C;  4UB8 Z;  5KHG A;  4WFB V;  3ZMT A;  2FB5 A;  2HJF C;  5IJ9 B;  4TV9 B;  1R6N A;  4PA9 A;  4JZG A;  3FYI B;  2YEV B;  4DR2 O;  3FFQ A;  3CCE V;  1FXK C;  3QG5 A;  1WP7 A;  2H3O A;  4X20 A;  1V54 C;  4LFC O;  2YXY A;  3OMN B;  2B1G A;  5L3D A;  1I94 B;  1SET A;  2F4V O;  2O57 A;  2RNB A;  4U3F H;  3N2K A;  2ITC C;  5L3G A;  3K5N A;  3BRC A;  1VAR A;  4OXS A;  3K5L A;  1MSD A;  3E8G A;  5E79 Z;  1K34 A;  1UFI A;  2CGN A;  2PGG A;  3MD0 A;  2Y0I A;  3OTO B;  4HBN A;  3THO A;  3K03 A;  4UVB A;  4FLT A;  4I55 A;  4QPK A;  5KLV H;  2YSU B;  1BHA A;  1W2B U;  2EIM B;  1SZT A;  1X4T A;  4J7J A;  2XAJ A;  2Q8V A;  4CZZ A;  3LNM B;  4BWA A;  3E35 A;  3OE7 G;  4NXM O;  3GWO A;  3G6B A;  4I0X A;  2RQ6 A;  3IC9 A;  2K9P A;  4OPA A;  4DV5 B;  4DRX B;  3EHB B;  3I55 V;  2ZXW C;  4B3T O;  5FNV B;  1XMO B;  2OYQ A;  4DR6 O;  4I4T B;  3K5O A;  4XDL A;  2LFR A;  3HKB B;  1TAE A;  3IGA C;  3BAB A;  1M1K W;  1LNQ A;  5BY1 A;  1K33 A;  4H37 A;  1OV9 A;  3L9D A;  4P2Z A;  3FB5 C;  3SDL A;  3CWB H;  5A2Q N;  4N21 A;  2HKO A;  2Q7H A;  2UU9 O;  4TV8 A;  3K0G A;  3OR7 C;  1OCR C;  1HR0 O;  3JAR B;  5J2T A;  4LP8 A;  2VS0 A;  1KKC A;  4ZI7 B;  2QA4 V;  3D36 A;  3RBZ A;  2UXB O;  2X6A A;  2NNU A;  1QU7 A;  2YIC A;  1V9P A;  1VQK V;  3APQ A;  4B3S B;  1TUB A;  2FML A;  2HVK C;  1SQQ H;  1Z2G A;  4LF8 B;  2DYR C;  5LHI A;  5KMG B;  3AG4 B;  1YZB A;  4U3J A;  2IJI A;  1EM1 A;  1R3K C;  2LQT A;  3CP1 A;  4NTX A;  3E83 A;  1MMM A;  4O4H A;  2X6B A;  1IBL B;  1XDC A;  3CC4 V;  4LFB B;  1PP9 H;  5IYZ B;  4H44 B;  4CBC A;  4JI7 O;  1W59 A;  4G28 B;  2GUZ A;  1JFF B;  1SES A;  1S72 V;  4DR1 B;  3MHS C;  3RYH A;  2QWR B;  4PDR A;  3K9A A;  2BTQ A;  4JI2 O;  1YCI A;  2GTA A;  1S0V A;  4EKW A;  5DED A;  3HKC B;  2K1E A;  1QLE C;  5LL6 Y;  3SPH A;  4YJ3 A;  1KYO F;  1XUQ A;  2Z0A A;  1K9M W;  3SPG A;  5JJE B;  3J81 N;  4LH6 A;  1Q90 D;  1GO3 F;  1BQ0 A;  3JAL A;  3ZN0 A;  5H9C A;  1N8R W;  3CCQ V;  2UUB O;  2KG7 B;  2DQ0 A;  3T1Y B;  4J80 A;  1BT8 A;  1GTO A;  4J10 A;  3CB2 A;  3JD4 A;  3JSL A;  4P30 A;  2E76 B;  1M5I A;  4YIP A;  1HDJ A;  5FLX N;  1N33 B;  3SPI A;  1PD3 A;  1YHQ V;  5IJ0 B;  3FKS G;  4NR1 A;  2X6C A;  2YID A;  2HHH B;  1XNR O;  1ENV A;  1GH6 A;  1HWY A;  2KQX A;  2LGW A;  4UFZ A;  1YF2 A;  3RN4 A;  3J80 N;  2DWE C;  2ZT9 B;  3BY6 A;  1AI7 A;  5LA6 B;  4I7Z B;  4R6Z A;  3H01 A;  5H6Q A;  3DC6 A;  4OX9 O;  1K4C C;  3RW0 A;  4Z1M G;  2Z5U A;  1ZX3 A;  2YXH A;  2ZDI A;  4X65 O;  2RN9 A;  2YI9 A;  3RWR D;  1XRE A;  4MVZ A;  5EYP A;  3ZMU A;  2WLL A;  5TIS Z;  2AZ0 A;  1KMI Z;  3UKM A;  2P22 C;  3W7S A;  1N4C A;  2Q69 A;  5DM6 V;  3TXS A;  3B4S A;  1CXZ B;  1KB9 F;  4PA7 A;  3OR6 C;  1VQ4 V;  4LFA B;  5B1A B;  4PDL A;  5BMV A;  3JD0 A;  5LXT A;  2E75 B;  3ZBH A;  1NQT A;  1FFX A;  4O4J B;  4PJ0 Z;  3RFR A;  1VQL V;  2JS3 A;  5B1N A;  3LUT B;  4K0K B;  4FM2 A;  4LCU C;  4K3A A;  2QR4 A;  4FMT A;  3CXH F;  3U0Z A;  2WLI B;  4JI8 O;  1TA8 A;  4QPJ A;  5D5Q A;  1GN6 A;  4DR5 B;  1NH2 B;  1R73 A;  2CH7 A;  4ZKI A;  1S5L Z;  2ETN A;  2WPD G;  2EIM C;  2RDC A;  1HNX B;  2Q6A A;  1K5Q A;  3K08 A;  4K8Z A;  4X66 B;  2HG5 C;  4MT8 A;  4GKK O;  3WB2 A;  1VQM V;  1SER A;  1BMF G;  4LF5 O;  2UUC B;  4LF9 B;  1JJO A;  1N32 O;  4PA3 A;  5E1A C;  3RYC B;  1D5N A;  1Y66 A;  1L0N H;  2UXD O;  3RVZ A;  1WA8 A;  4DYL A;  1KQS U;  1Z5W A;  3BCC H;  2QWN B;  1YJN V;  2IU0 A;  2DWD C;  3K5M A;  1TVK B;  2P4V A;  3BAA A;  1SC5 B;  3JAS A;  4JAA A;  2ZE5 A;  4AQY B;  1J5E O;  3D3I A;  3SR2 C;  5KX5 A;  3OEE G;  2QTO A;  1GRJ A;  4E4E A;  2Y69 B;  1BZK A;  3JCZ A;  5CA0 B;  2Q73 A;  1YJW V;  4X62 O;  2ZNI A;  2F66 C;  1XEQ A;  4PD4 F;  4MSW C;  1RPR A;  5BR8 B;  4ICG A;  1PM9 A;  5HFM A;  3X2Q C;  2KKW A;  2AZ2 A;  4JI3 B;  1F7Y A;  3AG4 C;  4JTD B;  3OUS A;  1WPX A;  1H38 A;  4G2K A;  1ZL8 B;  3A0H Z;  4NKG B;  1JOY A;  4KHP B;  3CEI A;  1RM1 C;  3OMA B;  2R72 A;  4MTX A;  1CP9 A;  2VWJ A;  4PA4 A;  1K92 A;  4DV2 B;  3ZHV A;  3E22 A;  4DW1 A;  2R9A A;  2PI5 A;  3OGI B;  4GUN A;  1TGO A;  4MVO A;  5BXZ A;  2Y4T A;  1R6K A;  5ITZ A;  3CJH B;  2L35 A;  4U7O A;  1P49 A;  5IE9 A;  1IBM B;  1I94 O;  1PL0 A;  1M90 W;  2QE7 G;  4JAV A;  2IBZ H;  3G6E V;  4B3R B;  3OW2 U;  4NYK A;  3CCJ V;  3FYE B;  1X59 A;  3OUF A;  5B3S B;  3OTO O;  2F1M A;  1OJH A;  5JVD B;  2JVD A;  2CTW A;  4WBN B;  2HLD G;  4H33 A;  4CS2 A;  3FB6 C;  2OIE A;  3ABM C;  3SPC A;  5CN0 A;  3ABL B;  1Q6H A;  1JJ2 U;  1JA8 A;  4LNU A;  4RQF A;  1FJG B;  5EIB D;  5B66 Z;  3CS5 A;  1VIB A;  1J95 A;  4DO2 A;  2QKC A;  4ZOL B;  1EZJ A;  2QKA A;  3RVY A;  1SQV H;  4DV5 O;  5L3B A;  4X8A A;  3AK2 A;  1XMO O;  3DTU B;  3MAQ A;  4JGS A;  5C93 A;  5JQG B;  1KEC A;  3SYQ A;  4FZ1 A;  4TV8 B;  3F7Y C;  5J2T B;  1B06 A;  4XDJ A;  1R3J C;  2GBO A;  2LGQ A;  3ZS8 C;  3CMA V;  3OEH G;  4CC6 A;  5J2U B;  2E5L B;  3JAT A;  1KP2 A;  1VQO V;  4R7C A;  3TGU H;  2UXC B;  4LR3 A;  4MVR A;  1MAB G;  1VF5 B;  1YJ9 V;  2YIB A;  1AJP A;  4B3S O;  2P4K A;  4GX0 A;  4LF8 O;  3CCM V;  3IJ4 A;  4FFB B;  4TQF A;  4RWU A;  1FD9 A;  3PJS K;  1PNM A;  4CC5 A;  2P7T C;  2EIN B;  1IBL O;  4D6T H;  4O4L A;  4QE9 A;  4B3M B;  1G8M A;  4LFB O;  1YDX A;  4J42 A;  5IYC O;  1IXB A;  3ZHQ A;  2BSK A;  1SQX H;  3C3S A;  4NB5 A;  4PI0 A;  1N34 B;  4TUY A;  4HNA B;  2Q68 A;  2JGU A;  2BTQ B;  3NXS A;  4DR1 O;  1NTZ H;  4FJC C;  2MK3 A;  1NR7 A;  3HKD A;  4GX5 A;  4KXR A;  1COW G;  2A7W A;  2EBO A;  1DTO A;  2WLN A;  2F23 A;  4B08 A;  5K1P A;  4F6R A;  2ZKO A;  1WLE A;  3ETQ A;  1Q3E A;  2QM4 A;  4J9Y B;  4KL1 A;  5EBM C;  3D8C A;  3K57 A;  4DV1 B;  5GON B;  5LOV B;  3ASO B;  3JD2 A;  5LHH A;  3OT7 A;  1PPJ H;  1PNK A;  1FXK A;  1MA1 A;  3PN1 A;  1H2L A;  4UCU A;  1HNZ B;  2Y69 C;  2VQF B;  4I5S A;  3T1Y O;  1VQ9 V;  5HFL A;  3CD6 V;  5GTI Z;  2UUA B;  1W0K G;  2HVJ C;  4EB6 A;  1BL8 A;  1DF4 A;  1OCZ B;  3AG2 B;  3ZED A;  4FLY A;  1N33 O;  5B5E Z;  4IHJ A;  2WLK A;  2JGD A;  2HHH O;  4JYA O;  2OIG A;  4UB6 Z;  3VQY A;  3KDR A;  2FL4 A;  2IW5 A;  4DUZ B;  2P5O A;  4YJ2 B;  3T1H B;  1H8E G;  1BHB A;  4PDM A;  4MVQ A;  3ZRW A;  2LP7 A;  2QEX V;  1T5E A;  1TUE B;  3K79 A;  1U96 A;  2ZE8 A;  1SZX A;  3DGE A;  4IIJ B;  3LSU A;  1M56 C;  2FYU H;  2P90 A;  2YS8 A;  2ZR2 A;  3RYI A;  3H1L H;  1SA0 B;  4B7K A;  4LF6 B;  5JH7 B;  4RO2 A;  5BMV B;  4MS2 A;  4N23 A;  2B1I A;  1YEW A;  3L71 H;  4LFA O;  4AHC A;  3JAW B;  2XND G;  4JI6 B;  1M93 A;  4NTY A;  1Q8I A;  5A9G A;  4BAY A;  4K0K O;  2JJ2 G;  4PI2 A;  4X1Y A;  1JR9 A;  2AHZ A;  3GWK C;  3IC7 A;  1NKD A;  5B3S C;  2V1D A;  4DR5 O;  3L74 H;  3IAY A;  4PEL A;  4QJF B;  1YIJ V;  1A32 A;  2Q9L A;  3UT5 B;  5IYB O;  3QO8 A;  2DQ3 A;  1KC8 W;  1F51 A;  3QTC A;  5EBW C;  4BW5 A;  1HNX O;  5C8Y B;  4EFB A;  2QM8 A;  4X66 O;  5CB4 A;  2NR5 A;  3CRC A;  3RT3 C;  4DV0 B;  1FS0 G;  2XT9 A;  4LWS B;  3T2M A;  2UUC O;  4LF9 O;  1KKD A;  3L72 H;  2CK3 G;  1XNQ B;  2YDE A;  1QQC A;  2ZCE A;  1UJW B;  1GM7 A;  2ARH A;  3DC5 A;  3EVK A;  1VQ8 V;  3M7M X;  5KX5 B;  3CHX A;  3P30 A;  3QVN A;  2ILM A;  4X1K B;  1ZLZ A;  1YVW A;  4AQY O;  4LBE C;  1MNG A;  4KUM A;  3ZMS A;  4LH7 A;  4DK0 A;  4GT1 A;  3CME V;  3JAK A;  3N2G A;  4JYY A;  1L8D A;  4X1I B;  5LMN B;  2PTM A;  2R9I A;  4RQE A;  3MHH C;  3W7U A;  5KA6 A;  5L3E A;  2PY5 A;  1HW7 A;  1EFR G;  4WFG A;  1I7F A;  5BR8 O;  4I50 A;  1AI4 A;  1H2M A;  1K7D A;  5CA1 B;  4JI3 O;  4DUY B;  2BOB C;  1DF5 A;  3CC2 V;  4CH3 A;  1NI8 A;  4KHP O;  4ZBM A;  1H8H G;  4O2A A;  5LYJ B;  3FAV A;  2IU3 A;  2EIN C;  1EN6 A;  1Y76 A;  3E89 A;  2XAQ A;  3A0B Z;  3UO3 A;  2CDY A;  4MW8 A;  4DXW A;  4GKJ B;  3E22 B;  1XHX A;  1G4Y B;  4DV2 O;  4I9W A;  1Y74 A;  3AG3 B;  1W0J G;  4ZHQ B;  5B1B B;  2LW7 A;  5EZY B;  3P32 A;  2XTA A;  2Z3Y A;  4HYO A;  2WAM A;  1KU9 A;  1VQN V;  1IBM O;  2AXT Z;  2G38 A;  2QJ1 A;  1VP7 A;  3CRR A;  4K35 A;  1Q5O A;  2EZP A;  5KHH A;  2OWO A;  4JYA B;  4B3R O;  4IGG A;  2MW2 B;  1CEZ A;  4DV3 B;  4AIL C;  1GM8 A;  5IJ9 A;  3STZ C;  1WB7 A;  4BIZ A;  4YY3 B;  1XMQ B;  1HNW B;  4TV9 A;  4L8J A;  4JI0 B;  1O9H A;  1US6 A;  5DEC A;  5BZB A;  1GN2 A;  5JCO C;  4EEQ A;  2OTL V;  3QO7 A;  1FJG O;  1R6T A;  5EC2 C;  3KZI Z;  1GM9 A;  1OCZ C;  3AG2 C;  1BE3 H;  4QIW F;  2HJD A;  1XHZ A;  2PUS A;  4NVP A;  1RSO A;  1YIT V;  4JI4 B;  4BR6 A;  4FK5 C;  1WNS A;  2WLJ A;  4OGQ B;  1VMG A;  2PYJ A;  1B04 A;  2HP8 A;  4UXN A;  2Y4U A;  3CRA A;  3DXR B;  1N36 B;  1JNB A;  3ZIA G;  3JAT B;  1R1B A;  3GB7 C;  3JYC A;  3HKE A;  3CCV V;  3WFV A;  2E5L O;  1YI2 V;  1D2D A;  1QNM A;  3STL C;  2IJJ A;  5CMU A;  2UXC O;  3AK1 A;  4BIO A;  4F6E A;  3A2F A;  2DOS A;  2GTS A;  4FZ0 A;  1RP3 B;  4CH4 A;  4DRX A;  4GCZ A;  2UXN A;  4DV6 B;  3HPL C;  5FNV A;  1SQG A;  4PA6 A;  3WU2 Z;  3HKB A;  4NXN B;  1OCO B;  3JD1 A;  3WG7 B;  3U10 A;  3UCS C;  4YHH B;  5IT9 N;  4WF9 V;  4U7N A;  3E2E A;  4H0L B;  4B3M O;  2XAF A;  3A0R A;  2CUG A;  1GN4 A;  4W4L A;  2WA3 A;  4ZI7 A;  5KHK A;  1N34 O;  1E1R G;  3N27 A;  1WJZ A;  5LP6 B;  4JI1 B;  4RUE A;  1FKA O;  2VWK A;  1S3J A;  2PYL A;  3W7W A;  4X9Q A;  4MW3 A;  5KA5 A;  3HB3 B;  2ADP A;  4DV7 B;  3ZHU A;  5KMG A;  1BSM A;  1L0L H;  4O4I A;  5LMU B;  1WP8 A;  2EJ7 A;  1OZ0 A;  2N74 A;  4JV5 B;  1V55 B;  4DV1 O;  1NVP B;  2BE3 A;  3RYF A;  1QVG U;  3H1I H;  3BA8 A;  4FLU A;  5EK0 A;  1FPO A;  5IYZ A;  4DV4 B;  3ASN B;  2WWW A;  1QR9 A;  1U97 A;  1L1F A;  1JFF A;  3ZRS A;  1HNZ O;  2VQF O;  3E86 A;  2UUA O;  2IJK A;  3G80 A;  1HP8 A;  1VQP V;  4AI8 A;  4X20 B;  4DR7 B;  3FD9 A;  1EN5 A;  4XDK A;  3HKC A;  1ZSP A;  1MOF A;  1DLB A;  1Y67 A;  2KB1 A;  3B8N A;  3N2K B;  4QNH B;  1LUW A;  4DUZ O;  3T1H O;  3ETG A;  2DJV A;  2VRZ A;  2JEU A;  4I55 B;  2ZIO A;  2Q4P A;  5L3C A;  4WFH A;  2LO1 A;  1F4N A;  3B40 A;  2KG7 A;  2F43 G;  3QNE A;  1FYJ A;  3R66 A;  2RJZ A;  4LF6 O;  1AJN A;  2ZXW B;  1P7G A;  3AG3 C;  5K1X A;  1B6Q A;  5IJ0 A;  4I0X B;  1I5Y A;  1SRY A;  2XAS A;  3ZJZ A;  2ZQM A;  4JI6 O;  3SGI A;  3ZHS A;  5CA3 A;  5LGT A;  4MVM A;  4IL6 Z;  4P9O A;  1SKV A;  3E8H A;  3AG1 B;  4PHZ A;  3VQV A;  1EN4 A;  2ZM6 B;  1NT2 B;  5LA6 A;  5EIB C;  4JZ2 A;  3VBB A;  1AB3 A;  1WN7 A;  4DR3 B;  4MTO A;  4PDV A;  1H5W A;  4YIO A;  3G4S V;  3H1J H;  2DN9 A;  3TJT A;  1Z5V A;  5LGN A;  3SYP A;  2YI8 A;  1CPY A;  3M99 B;  1IJG A;  5GTH Z;  1AI6 A; 
#chains in the Genus database with same CATH homology
 1XIL A;  3LSU A;  4BR6 A;  4FFK A;  1ZTE A;  2CE4 A;  1WB8 A;  1AP5 A;  1VEW A;  1IXB A;  1D5N A;  1BT8 A;  3KKY A;  1N0J A;  3C3S A;  1EN5 A;  4YIP A;  5A9G A;  3AK3 A;  1AVM A;  1ZSP A;  2AW9 A;  1QNM A;  1N0N A;  1Y67 A;  1EN6 A;  1KKC A;  1AP6 A;  2CDY A;  3C3T A;  1LUW A;  3AK1 A;  4F6E A;  1JA8 A;  1JR9 A;  2ADQ B;  1PL4 A;  1BS3 A;  1IX9 A;  3RN4 A;  2GDS A;  4JZG A;  4E4E A;  4C7U A;  2QKC A;  2QKA A;  3DC6 A;  3AK2 A;  5AG2 A;  1GN3 A;  1EM1 A;  1XRE A;  3OT7 A;  1I0H A;  1MMM A;  1P7G A;  1MA1 A;  3K9S A;  1GN4 A;  1XDC A;  1PM9 A;  1VAR A;  3BFR A;  1MSD A;  1AR4 A;  1AR5 A;  1B06 A;  3DC5 A;  3EVK A;  1WB7 A;  3MDS A;  1EN4 A;  1GN2 A;  1I08 A;  3CEI A;  3QVN A;  1ZLZ A;  4JZ2 A;  4X9Q A;  1MNG A;  3KDR A;  1ZUQ A;  2ADP A;  1LUV A;  4YIO A;  1BSM A;  3TJT A;  1IDS A;  4JYY A;  1GN6 A;  2P4K A;  1XUQ A;  4GUN A;  1SZX A;  2RCV A;  3IC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...