2P4KA

Contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAANVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2p4kA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2p4kA02
4C7UA 1KKCA 1VARA 1SZXA 1BSMA 5A9GA 1WB7A 2GDSA 1MSDA 1I08A 4F6EA 2QKCA 4YIPA 1PL4A 4GUNA 1EM1A 3TJTA 3BFRA 3K9SA 1XREA 3KKYA 1XDCA 1GN4A 1ZSPA 3EVKA 4JZ2A 1IX9A 1D5NA 2CE4A 1GN2A 1ZLZA 1MMMA 3MDSA 3CEIA 4FFKA 4JZGA 1EN5A 1N0NA 1JA8A 3IC9A 1LUWA 3AK1A 5AG2A 2ADPA 3C3TA 1BT8A 1AR5A 1QNMA 1XUQA 1EN4A 4YIOA 1GN6A 1IXBA 1ZTEA 1AR4A 4E4EA 2ADQB 1P7GA 1IDSA 3AK2A 2CDYA 3QVNA 1AP6A 1I0HA 1Y67A 3DC5A 2RCVA 3C3SA 2P4KA 1XILA 1GN3A 3AK3A 1WB8A 1BS3A 1ZUQA 3LSUA 1B06A 4BR6A 4X9QA 1JR9A 3RN4A 1VEWA 3OT7A 1EN6A 4JYYA 1AVMA 2QKAA 3DC6A 1MNGA 1MA1A 1N0JA 1AP5A 1LUVA 2AW9A 1PM9A
chains in the Genus database with same CATH superfamily
4DV5B 4BIZA 4EFEA 3JD0A 4LFCB 3A2FA 4UCUA 5KHJA 2UUAO 5LP6A 3CCUV 2QWPB 1V55C 4FMTA 1XNRO 4DV4B 3NXSA 3ZMZA 5LXTB 3SYAA 1PNLA 1VQKV 4JI3B 3VQWA 3TJTA 3SYCA 1GKFA 4CH4A 5L3CA 2XHBA 3OGIB 4ICGA 3K59A 4X1YB 2CTPA 4O2AB 5ITZA 3AG3B 1JVMA 2Q69A 1G4YB 4GZRB 3APOA 3ML0A 4RAIA 3CCVV 2Q73A 1NR7A 2AHYA 2HJFC 5LXTA 3AG1C 1SETA 4GX5A 2WPDG 1XHXA 1BGYH 1WPXA 2A79B 3RYFB 2PGGA 3L73H 1V54B 5BMVB 4UFZA 3B40A 4J42A 1Y67A 1JJOA 4O2AA 4B3RO 2B1IA 1L8DA 3L9DA 4UVCA 1P4RA 2FYUH 2QA4V 1YITV 4H37A 4JYCA 3OAAG 1XL4A 3CCLV 1JR9A 1Y6XA 3G6EV 5FPRA 3ABLB 5HFLA 1YJNV 5LGTA 3RYFA 3K08A 2X7RB 2ZDIA 4F4LA 5BMVA 2RN9A 3UO3A 4LC1A 2M6YA 4PA3A 4U3JA 2UUCO 3U10A 3ZMVA 3HKEB 3H1KH 2OCCB 2ZE8A 2GBOA 2GDSA 5FNVA 1EFRG 4CC5A 5B1BC 5KHKA 2LW7A 2H8PC 2WLHA 2Y69C 3ZHUA 5KX5B 3FFQA 2QKCA 1Q3EA 1F51A 5JVDB 4MVSA 1PL4A 2HVJC 4GUNA 3JD4A 3F7YC 2CK3G 1EM1A 2ZDIC 4PI2A 1N4CA 3K9SA 3T4DA 2RMKB 3WFVA 1NVPD 1QLEC 1WP8A 1XDCA 4B7EA 1FS0G 1D5AA 3JSNA 1SA0A 1J5EO 4X8AA 4TV8B 2N05A 5L3EA 4L87A 4DR2O 3LDCA 4YHHB 3HKEA 1NZ6A 2Y4UA 2YIAA 2Z3YA 2QSAA 2QGNA 3CMAV 3IJ4A 2PZSA 2V1DA 5KX5A 2AXTZ 4LFBO 2QR4A 4IL6Z 4B3TB 2E75B 5CBHA 4FVMA 1NQTA 4JI5B 3UKMA 4LF9O 2L6LA 5JJEB 4W4LA 3CPWU 1XMOO 2B9ZA 2EZOA 4TV8A 3B8MA 3CX5F 3ETEA 3TETA 3BABA 2OTLV 1YF2A 4BR6A 4JTDB 4JTAB 3OT7A 3THOA 5IY5C 3ABKC 4I0XB 3ETDA 3RYHA 1FKAO 2ZNIA 4QGPA 2Q68A 1NBMG 3N2KB 2F93B 2BTQB 4XDLA 5F2VO 2D2CB 2WWWA 1T5EA 2ARHA 1M56C 2VWJA 2ZIOA 4HBNA 2E3CA 1FJGO 3LNNA 1I08A 5J9PC 3CB2A 2EINC 2YS8A 4JV5B 3ABTA 3K5OA 3E83A 2EJ7A 3EXAA 3OEHG 2Q9LA 3IFXA 4I0XA 1AI7A 1TAEA 4D7TA 3ZN0A 3N2KA 5LMUO 3JATB 2BTQA 2CTRA 4GKKB 3ZHVA 1N36O 1TGOA 4KP4A 4LF7B 1COWG 1SKVA 5CA1B 2EIJB 1KECA 3GVMA 1EN5A 5E1AC 5JCOC 1I7FA 1GH6A 3DTUB 1Q81W 2UXBO 4IGGA 4X88A 4MVUA 2Q8VA 2AGAA 3QO8A 4MW3A 3STZC 1BT8A 1XHZA 1PP9H 1E1RG 5KUMA 1G1XB 4MW8A 1NR1A 2ZKOA 1S5HC 5GTIZ 4MVRA 5IYZB 2Q4PA 1E1QG 1HWYA 4PDRA 4R7CA 1IJGA 2Q7EA 3L72H 3BCCH 3P32A 3QO7A 3GWKC 5CA1A 3L70H 2V4DA 3KG2A 2QM8A 1ZUQA 2H3OA 4WFAV 3LSUA 1YIJV 4DR3O 5BR8B 3Q4HB 1MOFA 5IYZA 3T1HO 3HKBB 1SQPH 1R3IC 3IC7A 1SS3A 4ZOLB 2IH1C 1K97A 2Q67A 1U97A 3OMNB 1K4DC 1YTFD 4FM2A 1SZXA 4J10A 2BOBC 1RM1C 3E2EA 1MSDA 5CBGA 5IDJA 1XI1A 4KL1A 5JQGB 2ATKC 1HNZO 3Q4HA 4I7ZB 4XDJA 2JGDB 2ZR3A 1IURA 2A0LA 1I94O 2ZD9A 2PYJA 3HKBA 4P9OA 4ZOLA 1IX9A 2DYRB 3W7TA 2DJVA 4HAMA 3P30A 3RWRD 2CUGA 3MDSA 1RP3B 2KG7B 4FPPA 4FZ1A 3FD9A 4O4HB 3VOUA 1NS1A 1A32A 3EFFK 2XOKG 3RYCB 1VQ6V 4TWKA 2B1GA 5JQGA 1K5QA 1XUQA 1FXKA 4TUYB 5KLVH 1H2NA 1YDXA 3CC7V 4D7SA 2VS0A 2JGUA 4FLZA 4DV6B 2YSUB 2ZT9B 4BAYA 1H8HG 3F5WC 4DR6B 5H6RA 4ZI7B 1UJWB 1KQSU 3ZMSA 4AQYO 2DWEC 1S3JA 3E22B 2KG7A 1GTOA 1R6KA 1KKDA 1ROPA 1FXKC 4O4HA 1N34O 5B1AC 2ZR2A 2KKWA 4JI0B 3RYCA 4DV1O 2OYQA 4JYYA 3H1LH 3OGCC 2LO1A 4HNAB 1VQ7V 3JCZA 1YVWA 4UCRA 4JI6O 2EILB 2A7WA 3FYIB 4G28B 4N23A 1VF6C 3SGIA 4FLVA 4ZI7A 2XASA 3FB8C 1IXMA 1K7DA 4OPHA 1H38A 2KSDA 1FPOA 3E22A 5A9GA 4DV3B 1OCZB 5GONA 5H2FZ 5EBMC 1XMQB 2VQEO 2F23A 1R3KC 1QU7A 4LNUA 1P7BA 3FB7C 4U7OA 3UM7A 4HNAA 3E8GA 3EVKA 3PN1A 1NH2D 1QR9A 1L1FA 1NKDA 4DRXB 2QJ1A 1MMMA 2A06H 4B7KA 2YXHA 2OTJV 4JI1O 1YJWV 3K58A 2LW1A 1DGSA 1VIBA 3BA9A 4DYLA 3C3TA 4LF5O 3BA8A 2XAQA 3UQ8A 3K0GA 4FK5C 4JI4O 4X64O 3A0RA 4AHCA 1SESA 1SQBH 5BZBA 2YXYA 4EEQA 4PHZA 2JS3A 1WNSA 1F7YA 4JYBA 1VQ5V 1AI6A 4B3SO 3C3SA 4I55B 4DRXA 3ZRSA 3OR7C 2ITCC 2RDCA 2CTWA 3CYOA 4U3FH 2R72A 3K5MA 2LFSA 4XDKA 3SJBC 4Z1VA 3VQYA 3WG7C 3CJHB 3TGUH 2E5LB 2X6CA 2M7WA 1QR8A 4X9QA 3OD4A 1JOYA 2IW5A 2UU9O 1AROP 4JYAB 1HNXO 4O4JB 3OE7G 1HNWB 4DUZB 1Z2GA 4IYIA 1M57C 4L8JA 5J2TB 4J9YB 3ZN1A 1MZEA 2UUAB 3K5NA 3M99B 1NVPB 1TUBB 1XEQA 5HFMA 4I50A 5IJ9A 2ZXWB 1PM9A 1X59A 1OCOC 2P6JA 1XNRB 4I55A 1ZX3A 1H2GA 2LGQA 4DUYO 3HKDB 1VQ4V 2QM7A 2DYSC 4N21A 1R1BA 3AG4C 2UXCO 4O4JA 4YJ3B 4QNHB 1DF4A 1GN4A 1GO3F 2P4VA 4EB6A 3MHHC 2UXXA 4DV2O 5IYBO 1AB3A 5LHGA 1TUBA 4NXMO 3S3WA 1DTOA 2GSMB 4JI7O 3F7VC 1SQQH 3FB6C 1FD9A 1SF9A 3OR6C 3AEIA 3HKDA 4KUMA 1F4MA 3T2MA 4J11A 2ZINA 3ZS8C 3FB5C 1VP7A 1QNMA 2EX3A 4CS2A 4B3RB 1AJPA 3LSSA 4YJ3A 3TK1A 1TUEB 1TVKB 2JK5C 1S72V 4GX0A 2ADQB 5LP6C 2IJHA 1AP6A 1SZTA 3CP1A 3N2GA 5KHIA 2DN9A 3ICXA 5LGUA 1NTZH 2XAGA 3T4ZA 4NB5A 4RQEA 4DR7O 1GN3A 2RNBA 4DR5O 1IBMO 2NN4A 5IE9A 3O9OA 3DGEA 1IBKO 1K5SA 1LR1A 1B06A 1XBLA 3ASOC 2FMLA 3D3IA 2UUCB 1WAZA 4X1YA 3L75H 1TVKA 1WA8B 4FLXA 3VQXA 2Y4TA 2JDIG 3T1CA 1URFA 3IGAC 2KQXA 3BEHA 4KHPO 3OUSA 2EZPA 3SYPA 5LHIA 4K0KB 1PD3A 3S3XA 5JWPA 1Z5WA 4MVZA 3TXQA 3AG3C 4RQFA 1H8EG 1J5EB 1PPJH 5FPOA 1ZWIC 2QDOA 4QE9A 4K35A 4DV7O 4X89A 1WA8A 1W59A 2N04A 5L3BA 3K57A 1JA8A 4LFBB 3AK1A 2YIDA 1Y76B 3RGBA 2C2AA 3CRCA 2YIBD 4LF9B 1V54C 1AR5A 5K1XA 4F6RB 3O65A 2ITDC 1XMOB 1OCRB 1M93A 1KB9F 5L3DA 1IXBA 1MSWD 4CBCA 4GLXA 1EZJA 1FFXB 4LFAO 1SERA 2WLLB 4MTXA 4BIOA 3BRCA 3CMEV 3SJCC 4G2KA 1CXZB 4OX9O 1DK1A 2QWQB 2IBZH 2ZM6O 4NTYA 4YJ2B 3F5TA 2KB1A 2W6IG 3ABLC 2DQ0A 1Q6HA 2F1MA 1YTFB 1Y76A 3AG7A 3FX7A 5JVDA 1VQLV 4QE7A 2RQ6A 4EKWA 3RN4A 3SDLA 1R3JC 2Q0AA 5LL6Y 5DN6G 4JF3A 4QPKA 1Y74B 2HHHO 2RJZA 2OCCC 4X20B 1FFXA 1N0JA 2UXDO 5KA6A 2WLLA 1FJGB 2EIKB 4MVMA 1LUVA 1AI4A 2FKXA 2VRZA 2WLMA 4ASUG 1BSMA 5H5NA 3OTFA 2BE3A 4IHJB 1QBZA 3SPGA 3CS5A 2XNDG 4GYCB 5LMUB 3CRRA 3IAYA 5C93A 1U96A 1N36B 3BHPA 4IIJB 1Y74A 3X2QB 3BY6A 3WU2Z 1ZSPA 3UT5B 4DV0O 1KC8W 3FAVB 2UXBB 2HFEC 2HVKC 3WB0A 1D5NA 4PA9A 4CS4A 3CEIA 3JASB 4MT8A 4CH6A 4PDVA 1N33O 3OMAB 5C8YB 1GRJA 1EZVH 1Q90D 2H94A 2IH3C 3CE2A 2ZE7A 1PKXA 2VWKA 4WFBV 2PY5A 4RUEA 3E8FA 4QPJA 2W0XA 1PNKA 2X6BA 2ETNA 2Z5UA 2CGOA 1BMFG 4X66B 1XNQO 2YXLA 1YCIA 4R8CA 3E8HA 4R50A 1KD1W 1I0HA 5A2QN 4ABMA 2OT5A 4CS3A 3MD0A 1TA8A 4DR3B 4FZ0A 1RPOA 5C8YA 1Y66A 3CRMA 1G6UA 2A3QA 3T1HB 1VF7A 5EBWC 3OFNG 3G4SV 3PJSK 5BY1A 1AVMA 3RVYA 4TOIA 2E74B 2W0FC 3JATA 3DC6A 1PV0A 5IWAO 1W0KG 4LF8O 1R73A 2GHYA 1NH2B 4TV9B 1VARA 2X6AA 1Q7YW 1HNZB 4I9QA 5JJJB 3H1HH 2O57A 4F6EA 3GB7C 1I94B 1KP2A 1NTMH 4BWAA 3AG2B 5LA6B 4O4LB 3JD3A 1K3EA 2EIJC 4OGQB 3KKYA 1Q5OA 1BHAA 2JJ2G 4JGSA 3B8NA 3JARB 1BHBA 1Q43A 2FTKA 3DSQA 4TT3G 1MZFA 4PA6A 5B3SB 4JI8O 3RVZA 2DOSA 3E8BA 3C90A 1SC5B 4J41A 2WLKA 4FFKA 4NXNO 3M8AA 4MTFA 4TV9A 1H2LA 5CB4B 5EBLC 2Y0IA 3APQA 3U11A 4H33A 4FJCC 2YICA 1OJHA 5KAIZ 1SQFA 3OTOO 2GUZB 5LA6A 1ORQC 3K06A 4O4LA 1CEZA 4KXRA 3CCRV 3H01A 1N32O 4AQYB 1IDSA 4H13B 4O4IB 3K9AA 1FFTB 3A0BZ 3JARA 4HYOA 1N34B 4GKJO 4NVPA 4DR4O 1NI8A 3ZMUA 5EYPB 4DV1B 4JASA 1S5JA 3J81N 4E2LA 3G6BA 2PF4E 3SYQA 5CB4A 1XL6A 4R6ZA 4DR1O 5LMNO 2JGDA 2AZ2A 2WA3A 4D6TH 5LBQA 4LF4O 4JI6B 4DK1A 2GUZA 3G80A 1RSOB 1L0LH 4JAUA 1X4TA 1MA1A 2EIMB 1AR1B 1JCHA 1H2MA 1SQXH 3D3QA 1OHHG 2AW9A 5J2UB 1YHQV 2PYLA 4GCZA 1KKCA 3P3PA 5EIBC 5CBFA 4CC6A 3U0ZA 3CC2V 3B77A 4TUYA 3KDRA 1RFYA 1H5WA 2QEXV 2Q6AA 4UCVA 4UB6Z 4G27B 4NYKA 4FLYA 2DYRC 1RSOA 4LF6O 3JD1A 1FAFA 5KMGB 4JI1B 2IJKA 4AI8A 5L3FA 1VQ9V 3JAKB 4A5UB 3KCXA 1ZLZA 3ZCCA 1M1KW 4JI4B 2QTOA 4B08A 4X64B 3J7AU 1DF5A 1IBLO 1HR0O 2WA4A 1E79G 1PL0A 5LOVB 2UUBO 2IM9A 4UV9A 2PI5A 2VQFO 4B3SB 4YXWG 5KHGA 1OCCB 4FM0A 1JQ0A 5KMGA 1M5IA 1S5LZ 2F95B 1QLNA 1K92A 1M4UA 4X62O 2YDEA 3SPHA 4WF9V 1Q82W 3ABMB 1QVFU 2UU9B 1HNXB 1K73W 1BS3A 4LWSB 2IU0A 2JEUA 4YY3O 2NR5A 5LHHA 4X1IB 2HJDA 2EILC 2PUSA 5LOVA 4FLTA 3OEEG 4JAAA 3VQVA 1KUQA 1XOUA 2ZNJA 4UCSA 2BCCH 3ZHTA 3K0DA 2EULA 1UPGA 4DUYB 1AP5A 1OCZC 4NR1A 1P84F 2P90A 3E89A 4LH6A 3H9VA 3RBZA 4X1KB 2UXCB 2LFRA 4LWSA 3CRQA 1AJNA 2ZQMA 3CWBH 4DV2B 4PELA 4NXMB 1V55B 4JI7B 1QVGU 4FM1A 3WB2A 4DW1A 5GW7A 2OCHA 3HB3B 1KMIZ 4GX2A 1YSCA 4JPRA 2YUAA 2HLDG 3CJHA 3B2EE 3ETGA 5GTHZ 2BTOA 3T1YO 1H2SB 3JD2A 4X1KA 2XUMA 3ASNB 1BL8A 4GT1A 3CRAA 4B3MO 2JS5A 5J2TA 4Q6GA 3P3NA 1GMGA 3LDEA 3MHSC 4ZBMA 1BZKA 3JALB 2HG5C 2P67A 2OWOA 4DR7B 4DR5B 1IBMB 2CDYA 4FLUA 4PD4F 1J95A 3AG1B 2YEVB 1IBKB 3DC5A 3SPCA 4K3AA 5ITZB 3JAMN 2P4KA 1ENVA 1O9GA 2B5UA 1K8AW 1GM8A 1WB8A 1P49A 4X65O 2ZE6A 4J80A 2R9IA 5B66Z 1Q6UA 4UB8Z 3FKSG 4J9ZB 5L3GA 2ZXWC 2F4VO 3JALA 4JI2O 4Z2WA 1BCCH 1MNGA 2OIGA 2WSSG 2DE0X 1HDJA 4KHPB 3FYEB 1KBHA 2D3OW 2YEVA 3N2GB 3SYOA 3GWOA 3E35A 3ASNC 5IYDO 3KCYA 1GAXA 1HP8A 4KFMA 1AJQA 3DXRB 3HPLC 2FB5A 1BQ0A 3CCJV 3CCQV 2JEXA 3LDDA 4H44B 4DV5O 4DV7B 3QG5A 2NLJC 4J7ZA 4LFCO 1SRYA 3K3WA 3K03A 4CH3A 4TQDA 1FXHA 2AHZA 3SR2C 3I55V 5B1BB 1M90W 2Y69B 4DV4O 1WP7A 4JI3O 3VBBA 3A8TA 2CE4A 2MW2B 4GX1A 1GN2A 5D5QA 1QQCA 4P2ZA 5DEDA 2FL4A 1QLEB 4U3JB 2ZIMA 3BVOA 3RW0A 3ZX6A 3ABUA 1M9NA 4DO2A 2UXNA 3DXRA 4I5SA 5FNVB 1DLBA 4LFAB 5CA0B 4DR2B 4MTOA 4OX9B 4YIOA 1GN6A 4UUJC 3K04A 5BXZA 2ZM6B 1JNBA 4FIPC 2E76B 4PV1B 4TQFA 4HZ3A 5E79Z 2RCVA 1R3LC 1SA0B 4PI0A 3BAAA 4O2BB 1WN7A 1VQPV 3B09A 4Q20A 2JRIA 4MS2A 2HHHB 2P22C 2GV9A 5LGNA 2DQ3A 3UCSC 3R65A 2N74A 5EC1C 2UXDB 5CA0A 4MSWC 1YI2V 3ZRXA 1AI5A 2L35A 5LYJB 1Q86W 2CGNA 2BSKB 4K0KO 5IY5B 3ABKB 1VEWA 3CCEV 4IT5A 4I4TB 4O2BA 1WB7A 3D36A 2P5OA 2HP8A 4F6RA 4NTWA 2GTSA 1M56B 3ZHRA 2QTSA 1R6NA 3I5DA 5B1OA 4YIPA 3UO2A 3W7UA 1AILA 4DV0B 3L71H 3D8CA 1WPBA 3SJQC 2JVDA 1N33B 1I5XA 5LYJA 1R6TA 3ZHSA 5CA3A 2EINB 2XTAA 3RYHB 2QE7G 1F23A 4DW0A 4YJ2A 2BSKA 3D36C 3ZRWB 4ZIBA 3QF7A 4JZGA 1CPYA 1B04A 1K33A 1FYJA 4AILC 1OCRC 1LUWA 4I4TA 1US6A 1Q6IA 1XNQB 4XBFA 3MAQA 4PDMA 4YHHO 2BOCC 3W7XA 1S0VA 1K9MW 3CXHF 4X20A 2R9AA 5TISZ 2JIZG 2DMXA 3E86A 1G8MA 1UFIA 4RWUA 2ILMA 4B3TO 3L74H 4JI5O 3ZRWA 4IHJA 2LP7A 2G38A 3KZIZ 4LBEC 1OV9A 5IJ0B 3ZHQA 3SPJA 2P06A 2ODMA 5IWAB 2QKSA 5FL7G 4WCEV 3R66A 4IIJA 4LF8B 5JCOA 2EIKC 4CZZA 3A0HZ 3UT5A 1I5YA 3QTCA 3FAVA 1B6QA 1S76D 1H2KA 5B1NA 4BW9A 4ZKIA 4JAVA 2ZCEA 1D2DA 3JASA 1Z5VA 4UVBA 3CXCU 3M7MX 3H1JH 3ZMTA 1BQZA 1N8RW 2W6JG 2OIEA 5IJ0A 3X2QC 3QO5A 1FXVA 4Z1MG 3W7WA 4K8XA 4WBNB 2XAFA 4JI8B 3BFRA 1RM1B 4P30A 1GK9A 1NJIW 4NXNB 2DWDC 4JV5O 2DW4A 1SQGA 4J7KA 2Q5ZA 3HKCB 5K1PA 5KAFZ 3BPZA 1S77D 3K5LA 1N0NA 1ZL8B 4X66O 3OTOB 3STLC 3LUTB 4GKKO 1W0JG 2Q7GA 4LF7O 2ADPA 1N32B 4W4KA 2XT9A 1W2BU 4WBNA 5DM6V 2PI4A 3CSXA 2NNUA 4GKJB 2HEPA 4DR4B 4LP8A 1NU1H 4PDLA 3TXSA 3QVNA 3OW2U 3JAWB 3ZIAG 1BE3H 3JSLA 3HKCA 3ZRVA 5KUKA 5IYCO 4DR1B 1IVSA 5LMNB 3AK3A 3RYIB 5FLXN 4LF4B 4I9WA 3ZBHA 1ZL8A 4MVQA 1B3QA 2IJIA 1MG1A 1O9HA 1NT2B 4DXWA 1EN6A 3J80N 2QKAA 3CHXA 1FXKB 4LCUC 5B1AB 5EC2C 2AZ0A 4LH7A 5BR8O 1K4CC 4P9PA 4WFEA 1K34A 2F43G 1GM9A 3QNEA 3JAWA 1YXBA 3LNMB 1EBOA 2XAJA 2Y0PA 3AG2C 3OMIB 4NTXA 4EFBA 2MK3A 4LR3A 4J7JA 3RYIA 4WFGA 1JMKC 3CD6V 2LJ2A 4LF6B 3WB1A 3ZEDA 1ZAUA 4UCTA 2P7TC 4DK0A 3RFRA 5B3SC 4RUFA 4O4IA 1THZA 2YC0A 5JH7B 3OM3B 1YEWA 1QCEA 5EYPA 2VQEB 2QM4A 4JTCB 5B5EZ 1VMGA 3W7SA 1IBLB 1HR0B 5D5PA 1PNMA 2V7QG 2UUBB 4K8ZA 1NTKH 2Z0AA 5AG2A 1KYOF 2VQFB 2K1EA 1VF6A 1EN4A 5GONB 1OZ0A 3SJAC 4X62B 4BIUA 5CN0A 5EZYB 4LNUB 4CH5A 2A9HA 1XQ8A 4E4EA 2X0LA 5KA5A 4LF5B 1P7GA 2EJRA 2R70A 3AK2A 5JH7A 5J2UA 3RT3C 2CH7B 2F66C 4YY3B 1RPRA 1Y4MA 2EBOA 1VQMV 3H1IH 1HW7A 3I56V 4DV6O 1QHTA 4DR6O 2WAMA 2EIMC 4FFBB 2PTMA 1IZ3A 3NR7A 3WG7B 4UVAA 3N27A 5EZYA 5EK0A 4JI0O 3JAKA 5IT9N 3EHBB 2JJ1G 2HR3A 4PA7A 4NKGB 2CH7A 1KU9A 2R9RB 4WFHA 4C7UA 1F4NA 1M57B 4RO2A 3G67A 1WLEA 1VQ8V 1SQVH 1OCOB 2IJJA 2IU3A 4ZHQB 4BW5A 1VQOV 1FOUA 4FFBA 4DV3O 4UXNA 2YI8A 1WJZA 1MABG 2Q0OC 1XREA 1JX9A 2DYSB 4JZ2A 5H6QA 3T1YB 3OUFA 1L0NH 1XMQO 3CC4V 3CCSV 2K9PA 2XAHA 2WLJA 3AG4B 2GTAA 4UV8A 2HKOA 1CP9A 3ZJZA 3JCUZ 4B3MB 3HR0A 4WFFA 2WLIB 2YI9A 4I50B 3LSQA 3IC9A 5IJ9B 1JJ2U 4UCOA 2LQTA 4X1IA 5EIBD 1JPXA 1VQNV 1OCCC 4U7NA 1LNQA 5KHHA 4ZHQA 1JFFB 5JJNB 4QIWF 2Q7HA 4OXSA 3K79A 5H9CA 3SPIA 1ZTEA 4IYHA 1V9PA 1AR4A 1YZBA 3ABMC 4H0LB 3TCUA 1GM7A 2QWNB 3B4SA 4X65B 1YJ9V 3JYCA 4EB6B 1Q8IA 2ZE5A 1XILA 2WLNA 1VF5B 2LGWA 2WLIA 2QWRB 4OPAA 5LP6B 4FLWA 2F4VB 5CMUA 4JI2B 4MTGA 5DECA 2YIBA 4PJ0Z 4MVOA 3ETQA 1JFFA 2CTQA 1KP3A 3G71V 2E5LO 4PA4A 3CCMV 2QWOB 4JYAO 3ASOB 4TSFG 2CAZC 1HNWO 4DUZO 4QJFB 2Y48A
chains in the Genus database with same CATH topology
4C7UA 1KKCA 1VARA 1SZXA 1BSMA 5A9GA 1WB7A 2GDSA 1MSDA 1I08A 3KDRA 4F6EA 2QKCA 4YIPA 1PL4A 4GUNA 1EM1A 3TJTA 3BFRA 3K9SA 1XREA 3KKYA 1XDCA 1GN4A 1ZSPA 3EVKA 4JZ2A 1IX9A 1D5NA 2CE4A 1GN2A 1ZLZA 1MMMA 3MDSA 3CEIA 4FFKA 4JZGA 1EN5A 1N0NA 1JA8A 3IC9A 1LUWA 3AK1A 5AG2A 2ADPA 3C3TA 1BT8A 1AR5A 1QNMA 1XUQA 1EN4A 4YIOA 1GN6A 1IXBA 1ZTEA 1AR4A 4E4EA 2ADQB 1P7GA 1IDSA 3AK2A 2CDYA 3QVNA 1AP6A 1I0HA 1Y67A 3DC5A 2RCVA 3C3SA 2P4KA 1XILA 1GN3A 3AK3A 1WB8A 1BS3A 1ZUQA 3LSUA 1B06A 4BR6A 4X9QA 1JR9A 3RN4A 1VEWA 3OT7A 1EN6A 4JYYA 1AVMA 2QKAA 3DC6A 1MNGA 1MA1A 1N0JA 1AP5A 1LUVA 2AW9A 1PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7U A;  1KKC A;  1VAR A;  1SZX A;  1BSM A;  5A9G A;  1WB7 A;  2GDS A;  1MSD A;  1I08 A;  4F6E A;  2QKC A;  4YIP A;  1PL4 A;  4GUN A;  1EM1 A;  3TJT A;  3BFR A;  3K9S A;  1XRE A;  3KKY A;  1XDC A;  1GN4 A;  1ZSP A;  3EVK A;  4JZ2 A;  1IX9 A;  1D5N A;  2CE4 A;  1GN2 A;  1ZLZ A;  1MMM A;  3MDS A;  3CEI A;  4FFK A;  4JZG A;  1EN5 A;  1N0N A;  1JA8 A;  3IC9 A;  1LUW A;  3AK1 A;  5AG2 A;  2ADP A;  3C3T A;  1BT8 A;  1AR5 A;  1QNM A;  1XUQ A;  1EN4 A;  4YIO A;  1GN6 A;  1IXB A;  1ZTE A;  1AR4 A;  4E4E A;  2ADQ B;  1P7G A;  1IDS A;  3AK2 A;  2CDY A;  3QVN A;  1AP6 A;  1I0H A;  1Y67 A;  3DC5 A;  2RCV A;  3C3S A;  2P4K A;  1XIL A;  1GN3 A;  3AK3 A;  1WB8 A;  1BS3 A;  1ZUQ A;  3LSU A;  1B06 A;  4BR6 A;  4X9Q A;  1JR9 A;  3RN4 A;  1VEW A;  3OT7 A;  1EN6 A;  4JYY A;  1AVM A;  2QKA A;  3DC6 A;  1MNG A;  1MA1 A;  1N0J A;  1AP5 A;  1LUV A;  2AW9 A;  1PM9 A; 
#chains in the Genus database with same CATH topology
 4DV5 B;  4BIZ A;  4EFE A;  3JD0 A;  4LFC B;  3A2F A;  4UCU A;  5KHJ A;  2UUA O;  5LP6 A;  3CCU V;  2QWP B;  1V55 C;  4FMT A;  1XNR O;  4DV4 B;  3NXS A;  3ZMZ A;  5LXT B;  3SYA A;  1PNL A;  1VQK V;  4JI3 B;  3VQW A;  3TJT A;  3SYC A;  1GKF A;  4CH4 A;  5L3C A;  2XHB A;  3OGI B;  4ICG A;  3K59 A;  4X1Y B;  2CTP A;  4O2A B;  5ITZ A;  3AG3 B;  1JVM A;  2Q69 A;  1G4Y B;  4GZR B;  3APO A;  3ML0 A;  4RAI A;  3CCV V;  2Q73 A;  1NR7 A;  2AHY A;  2HJF C;  5LXT A;  3AG1 C;  1SET A;  4GX5 A;  2WPD G;  1XHX A;  1BGY H;  1WPX A;  2A79 B;  3RYF B;  2PGG A;  3L73 H;  1V54 B;  5BMV B;  4UFZ A;  3B40 A;  4J42 A;  1Y67 A;  1JJO A;  4O2A A;  4B3R O;  2B1I A;  1L8D A;  3L9D A;  4UVC A;  1P4R A;  2FYU H;  2QA4 V;  1YIT V;  4H37 A;  4JYC A;  3OAA G;  1XL4 A;  3CCL V;  1JR9 A;  1Y6X A;  3G6E V;  5FPR A;  3ABL B;  5HFL A;  1YJN V;  5LGT A;  3RYF A;  3K08 A;  2X7R B;  2ZDI A;  4F4L A;  5BMV A;  2RN9 A;  3UO3 A;  4LC1 A;  2M6Y A;  4PA3 A;  4U3J A;  2UUC O;  3U10 A;  3ZMV A;  3HKE B;  3H1K H;  2OCC B;  2ZE8 A;  2GBO A;  2GDS A;  5FNV A;  1EFR G;  4CC5 A;  5B1B C;  5KHK A;  2LW7 A;  2H8P C;  2WLH A;  2Y69 C;  3ZHU A;  5KX5 B;  3FFQ A;  2QKC A;  1Q3E A;  1F51 A;  5JVD B;  4MVS A;  1PL4 A;  2HVJ C;  4GUN A;  3JD4 A;  3F7Y C;  2CK3 G;  1EM1 A;  2ZDI C;  4PI2 A;  1N4C A;  3K9S A;  3T4D A;  2RMK B;  3WFV A;  1NVP D;  1QLE C;  1WP8 A;  1XDC A;  4B7E A;  1FS0 G;  1D5A A;  3JSN A;  1SA0 A;  1J5E O;  4X8A A;  4TV8 B;  2N05 A;  5L3E A;  4L87 A;  4DR2 O;  3LDC A;  4YHH B;  3HKE A;  1NZ6 A;  2Y4U A;  2YIA A;  2Z3Y A;  2QSA A;  2QGN A;  3CMA V;  3IJ4 A;  2PZS A;  2V1D A;  5KX5 A;  2AXT Z;  4LFB O;  2QR4 A;  4IL6 Z;  4B3T B;  2E75 B;  5CBH A;  4FVM A;  1NQT A;  4JI5 B;  3UKM A;  4LF9 O;  2L6L A;  5JJE B;  4W4L A;  3CPW U;  1XMO O;  2B9Z A;  2EZO A;  4TV8 A;  3B8M A;  3CX5 F;  3ETE A;  3TET A;  3BAB A;  2OTL V;  1YF2 A;  4BR6 A;  4JTD B;  4JTA B;  3OT7 A;  3THO A;  5IY5 C;  3ABK C;  4I0X B;  3ETD A;  3RYH A;  1FKA O;  2ZNI A;  4QGP A;  2Q68 A;  1NBM G;  3N2K B;  2F93 B;  2BTQ B;  4XDL A;  5F2V O;  2D2C B;  2WWW A;  1T5E A;  2ARH A;  1M56 C;  2VWJ A;  2ZIO A;  4HBN A;  2E3C A;  1FJG O;  3LNN A;  1I08 A;  5J9P C;  3CB2 A;  2EIN C;  2YS8 A;  4JV5 B;  3ABT A;  3K5O A;  3E83 A;  2EJ7 A;  3EXA A;  3OEH G;  2Q9L A;  3IFX A;  4I0X A;  1AI7 A;  1TAE A;  4D7T A;  3ZN0 A;  3N2K A;  5LMU O;  3JAT B;  2BTQ A;  2CTR A;  4GKK B;  3ZHV A;  1N36 O;  1TGO A;  4KP4 A;  4LF7 B;  1COW G;  1SKV A;  5CA1 B;  2EIJ B;  1KEC A;  3GVM A;  1EN5 A;  5E1A C;  5JCO C;  1I7F A;  1GH6 A;  3DTU B;  1Q81 W;  2UXB O;  4IGG A;  4X88 A;  4MVU A;  2Q8V A;  2AGA A;  3QO8 A;  4MW3 A;  3STZ C;  1BT8 A;  1XHZ A;  1PP9 H;  1E1R G;  5KUM A;  1G1X B;  4MW8 A;  1NR1 A;  2ZKO A;  1S5H C;  5GTI Z;  4MVR A;  5IYZ B;  2Q4P A;  1E1Q G;  1HWY A;  4PDR A;  4R7C A;  1IJG A;  2Q7E A;  3L72 H;  3BCC H;  3P32 A;  3QO7 A;  3GWK C;  5CA1 A;  3L70 H;  2V4D A;  3KG2 A;  2QM8 A;  1ZUQ A;  2H3O A;  4WFA V;  3LSU A;  1YIJ V;  4DR3 O;  5BR8 B;  3Q4H B;  1MOF A;  5IYZ A;  3T1H O;  3HKB B;  1SQP H;  1R3I C;  3IC7 A;  1SS3 A;  4ZOL B;  2IH1 C;  1K97 A;  2Q67 A;  1U97 A;  3OMN B;  1K4D C;  1YTF D;  4FM2 A;  1SZX A;  4J10 A;  2BOB C;  1RM1 C;  3E2E A;  1MSD A;  5CBG A;  5IDJ A;  1XI1 A;  4KL1 A;  5JQG B;  2ATK C;  1HNZ O;  3Q4H A;  4I7Z B;  4XDJ A;  2JGD B;  2ZR3 A;  1IUR A;  2A0L A;  1I94 O;  2ZD9 A;  2PYJ A;  3HKB A;  4P9O A;  4ZOL A;  1IX9 A;  2DYR B;  3W7T A;  2DJV A;  4HAM A;  3P30 A;  3RWR D;  2CUG A;  3MDS A;  1RP3 B;  2KG7 B;  4FPP A;  4FZ1 A;  3FD9 A;  4O4H B;  3VOU A;  1NS1 A;  1A32 A;  3EFF K;  2XOK G;  3RYC B;  1VQ6 V;  4TWK A;  2B1G A;  5JQG A;  1K5Q A;  1XUQ A;  1FXK A;  4TUY B;  5KLV H;  1H2N A;  1YDX A;  3CC7 V;  4D7S A;  2VS0 A;  2JGU A;  4FLZ A;  4DV6 B;  2YSU B;  2ZT9 B;  4BAY A;  1H8H G;  3F5W C;  4DR6 B;  5H6R A;  4ZI7 B;  1UJW B;  1KQS U;  3ZMS A;  4AQY O;  2DWE C;  1S3J A;  3E22 B;  2KG7 A;  1GTO A;  1R6K A;  1KKD A;  1ROP A;  1FXK C;  4O4H A;  1N34 O;  5B1A C;  2ZR2 A;  2KKW A;  4JI0 B;  3RYC A;  4DV1 O;  2OYQ A;  4JYY A;  3H1L H;  3OGC C;  2LO1 A;  4HNA B;  1VQ7 V;  3JCZ A;  1YVW A;  4UCR A;  4JI6 O;  2EIL B;  2A7W A;  3FYI B;  4G28 B;  4N23 A;  1VF6 C;  3SGI A;  4FLV A;  4ZI7 A;  2XAS A;  3FB8 C;  1IXM A;  1K7D A;  4OPH A;  1H38 A;  2KSD A;  1FPO A;  3E22 A;  5A9G A;  4DV3 B;  1OCZ B;  5GON A;  5H2F Z;  5EBM C;  1XMQ B;  2VQE O;  2F23 A;  1R3K C;  1QU7 A;  4LNU A;  1P7B A;  3FB7 C;  4U7O A;  3UM7 A;  4HNA A;  3E8G A;  3EVK A;  3PN1 A;  1NH2 D;  1QR9 A;  1L1F A;  1NKD A;  4DRX B;  2QJ1 A;  1MMM A;  2A06 H;  4B7K A;  2YXH A;  2OTJ V;  4JI1 O;  1YJW V;  3K58 A;  2LW1 A;  1DGS A;  1VIB A;  3BA9 A;  4DYL A;  3C3T A;  4LF5 O;  3BA8 A;  2XAQ A;  3UQ8 A;  3K0G A;  4FK5 C;  4JI4 O;  4X64 O;  3A0R A;  4AHC A;  1SES A;  1SQB H;  5BZB A;  2YXY A;  4EEQ A;  4PHZ A;  2JS3 A;  1WNS A;  1F7Y A;  4JYB A;  1VQ5 V;  1AI6 A;  4B3S O;  3C3S A;  4I55 B;  4DRX A;  3ZRS A;  3OR7 C;  2ITC C;  2RDC A;  2CTW A;  3CYO A;  4U3F H;  2R72 A;  3K5M A;  2LFS A;  4XDK A;  3SJB C;  4Z1V A;  3VQY A;  3WG7 C;  3CJH B;  3TGU H;  2E5L B;  2X6C A;  2M7W A;  1QR8 A;  4X9Q A;  3OD4 A;  1JOY A;  2IW5 A;  2UU9 O;  1ARO P;  4JYA B;  1HNX O;  4O4J B;  3OE7 G;  1HNW B;  4DUZ B;  1Z2G A;  4IYI A;  1M57 C;  4L8J A;  5J2T B;  4J9Y B;  3ZN1 A;  1MZE A;  2UUA B;  3K5N A;  3M99 B;  1NVP B;  1TUB B;  1XEQ A;  5HFM A;  4I50 A;  5IJ9 A;  2ZXW B;  1PM9 A;  1X59 A;  1OCO C;  2P6J A;  1XNR B;  4I55 A;  1ZX3 A;  1H2G A;  2LGQ A;  4DUY O;  3HKD B;  1VQ4 V;  2QM7 A;  2DYS C;  4N21 A;  1R1B A;  3AG4 C;  2UXC O;  4O4J A;  4YJ3 B;  4QNH B;  1DF4 A;  1GN4 A;  1GO3 F;  2P4V A;  4EB6 A;  3MHH C;  2UXX A;  4DV2 O;  5IYB O;  1AB3 A;  5LHG A;  1TUB A;  4NXM O;  3S3W A;  1DTO A;  2GSM B;  4JI7 O;  3F7V C;  1SQQ H;  3FB6 C;  1FD9 A;  1SF9 A;  3OR6 C;  3AEI A;  3HKD A;  4KUM A;  1F4M A;  3T2M A;  4J11 A;  2ZIN A;  3ZS8 C;  3FB5 C;  1VP7 A;  1QNM A;  2EX3 A;  4CS2 A;  4B3R B;  1AJP A;  3LSS A;  4YJ3 A;  3TK1 A;  1TUE B;  1TVK B;  2JK5 C;  1S72 V;  4GX0 A;  2ADQ B;  5LP6 C;  2IJH A;  1AP6 A;  1SZT A;  3CP1 A;  3N2G A;  5KHI A;  2DN9 A;  3ICX A;  5LGU A;  1NTZ H;  2XAG A;  3T4Z A;  4NB5 A;  4RQE A;  4DR7 O;  1GN3 A;  2RNB A;  4DR5 O;  1IBM O;  2NN4 A;  5IE9 A;  3O9O A;  3DGE A;  1IBK O;  1K5S A;  1LR1 A;  1B06 A;  1XBL A;  3ASO C;  2FML A;  3D3I A;  2UUC B;  1WAZ A;  4X1Y A;  3L75 H;  1TVK A;  1WA8 B;  4FLX A;  3VQX A;  2Y4T A;  2JDI G;  3T1C A;  1URF A;  3IGA C;  2KQX A;  3BEH A;  4KHP O;  3OUS A;  2EZP A;  3SYP A;  5LHI A;  4K0K B;  1PD3 A;  3S3X A;  5JWP A;  1Z5W A;  4MVZ A;  3TXQ A;  3AG3 C;  4RQF A;  1H8E G;  1J5E B;  1PPJ H;  5FPO A;  1ZWI C;  2QDO A;  4QE9 A;  4K35 A;  4DV7 O;  4X89 A;  1WA8 A;  1W59 A;  2N04 A;  5L3B A;  3K57 A;  1JA8 A;  4LFB B;  3AK1 A;  2YID A;  1Y76 B;  3RGB A;  2C2A A;  3CRC A;  2YIB D;  4LF9 B;  1V54 C;  1AR5 A;  5K1X A;  4F6R B;  3O65 A;  2ITD C;  1XMO B;  1OCR B;  1M93 A;  1KB9 F;  5L3D A;  1IXB A;  1MSW D;  4CBC A;  4GLX A;  1EZJ A;  1FFX B;  4LFA O;  1SER A;  2WLL B;  4MTX A;  4BIO A;  3BRC A;  3CME V;  3SJC C;  4G2K A;  1CXZ B;  4OX9 O;  1DK1 A;  2QWQ B;  2IBZ H;  2ZM6 O;  4NTY A;  4YJ2 B;  3F5T A;  2KB1 A;  2W6I G;  3ABL C;  2DQ0 A;  1Q6H A;  2F1M A;  1YTF B;  1Y76 A;  3AG7 A;  3FX7 A;  5JVD A;  1VQL V;  4QE7 A;  2RQ6 A;  4EKW A;  3RN4 A;  3SDL A;  1R3J C;  2Q0A A;  5LL6 Y;  5DN6 G;  4JF3 A;  4QPK A;  1Y74 B;  2HHH O;  2RJZ A;  2OCC C;  4X20 B;  1FFX A;  1N0J A;  2UXD O;  5KA6 A;  2WLL A;  1FJG B;  2EIK B;  4MVM A;  1LUV A;  1AI4 A;  2FKX A;  2VRZ A;  2WLM A;  4ASU G;  1BSM A;  5H5N A;  3OTF A;  2BE3 A;  4IHJ B;  1QBZ A;  3SPG A;  3CS5 A;  2XND G;  4GYC B;  5LMU B;  3CRR A;  3IAY A;  5C93 A;  1U96 A;  1N36 B;  3BHP A;  4IIJ B;  1Y74 A;  3X2Q B;  3BY6 A;  3WU2 Z;  1ZSP A;  3UT5 B;  4DV0 O;  1KC8 W;  3FAV B;  2UXB B;  2HFE C;  2HVK C;  3WB0 A;  1D5N A;  4PA9 A;  4CS4 A;  3CEI A;  3JAS B;  4MT8 A;  4CH6 A;  4PDV A;  1N33 O;  3OMA B;  5C8Y B;  1GRJ A;  1EZV H;  1Q90 D;  2H94 A;  2IH3 C;  3CE2 A;  2ZE7 A;  1PKX A;  2VWK A;  4WFB V;  2PY5 A;  4RUE A;  3E8F A;  4QPJ A;  2W0X A;  1PNK A;  2X6B A;  2ETN A;  2Z5U A;  2CGO A;  1BMF G;  4X66 B;  1XNQ O;  2YXL A;  1YCI A;  4R8C A;  3E8H A;  4R50 A;  1KD1 W;  1I0H A;  5A2Q N;  4ABM A;  2OT5 A;  4CS3 A;  3MD0 A;  1TA8 A;  4DR3 B;  4FZ0 A;  1RPO A;  5C8Y A;  1Y66 A;  3CRM A;  1G6U A;  2A3Q A;  3T1H B;  1VF7 A;  5EBW C;  3OFN G;  3G4S V;  3PJS K;  5BY1 A;  1AVM A;  3RVY A;  4TOI A;  2E74 B;  2W0F C;  3JAT A;  3DC6 A;  1PV0 A;  5IWA O;  1W0K G;  4LF8 O;  1R73 A;  2GHY A;  1NH2 B;  4TV9 B;  1VAR A;  2X6A A;  1Q7Y W;  1HNZ B;  4I9Q A;  5JJJ B;  3H1H H;  2O57 A;  4F6E A;  3GB7 C;  1I94 B;  1KP2 A;  1NTM H;  4BWA A;  3AG2 B;  5LA6 B;  4O4L B;  3JD3 A;  1K3E A;  2EIJ C;  4OGQ B;  3KKY A;  1Q5O A;  1BHA A;  2JJ2 G;  4JGS A;  3B8N A;  3JAR B;  1BHB A;  1Q43 A;  2FTK A;  3DSQ A;  4TT3 G;  1MZF A;  4PA6 A;  5B3S B;  4JI8 O;  3RVZ A;  2DOS A;  3E8B A;  3C90 A;  1SC5 B;  4J41 A;  2WLK A;  4FFK A;  4NXN O;  3M8A A;  4MTF A;  4TV9 A;  1H2L A;  5CB4 B;  5EBL C;  2Y0I A;  3APQ A;  3U11 A;  4H33 A;  4FJC C;  2YIC A;  1OJH A;  5KAI Z;  1SQF A;  3OTO O;  2GUZ B;  5LA6 A;  1ORQ C;  3K06 A;  4O4L A;  1CEZ A;  4KXR A;  3CCR V;  3H01 A;  1N32 O;  4AQY B;  1IDS A;  4H13 B;  4O4I B;  3K9A A;  1FFT B;  3A0B Z;  3JAR A;  4HYO A;  1N34 B;  4GKJ O;  4NVP A;  4DR4 O;  1NI8 A;  3ZMU A;  5EYP B;  4DV1 B;  4JAS A;  1S5J A;  3J81 N;  4E2L A;  3G6B A;  2PF4 E;  3SYQ A;  5CB4 A;  1XL6 A;  4R6Z A;  4DR1 O;  5LMN O;  2JGD A;  2AZ2 A;  2WA3 A;  4D6T H;  5LBQ A;  4LF4 O;  4JI6 B;  4DK1 A;  2GUZ A;  3G80 A;  1RSO B;  1L0L H;  4JAU A;  1X4T A;  1MA1 A;  2EIM B;  1AR1 B;  1JCH A;  1H2M A;  1SQX H;  3D3Q A;  1OHH G;  2AW9 A;  5J2U B;  1YHQ V;  2PYL A;  4GCZ A;  1KKC A;  3P3P A;  5EIB C;  5CBF A;  4CC6 A;  3U0Z A;  3CC2 V;  3B77 A;  4TUY A;  3KDR A;  1RFY A;  1H5W A;  2QEX V;  2Q6A A;  4UCV A;  4UB6 Z;  4G27 B;  4NYK A;  4FLY A;  2DYR C;  1RSO A;  4LF6 O;  3JD1 A;  1FAF A;  5KMG B;  4JI1 B;  2IJK A;  4AI8 A;  5L3F A;  1VQ9 V;  3JAK B;  4A5U B;  3KCX A;  1ZLZ A;  3ZCC A;  1M1K W;  4JI4 B;  2QTO A;  4B08 A;  4X64 B;  3J7A U;  1DF5 A;  1IBL O;  1HR0 O;  2WA4 A;  1E79 G;  1PL0 A;  5LOV B;  2UUB O;  2IM9 A;  4UV9 A;  2PI5 A;  2VQF O;  4B3S B;  4YXW G;  5KHG A;  1OCC B;  4FM0 A;  1JQ0 A;  5KMG A;  1M5I A;  1S5L Z;  2F95 B;  1QLN A;  1K92 A;  1M4U A;  4X62 O;  2YDE A;  3SPH A;  4WF9 V;  1Q82 W;  3ABM B;  1QVF U;  2UU9 B;  1HNX B;  1K73 W;  1BS3 A;  4LWS B;  2IU0 A;  2JEU A;  4YY3 O;  2NR5 A;  5LHH A;  4X1I B;  2HJD A;  2EIL C;  2PUS A;  5LOV A;  4FLT A;  3OEE G;  4JAA A;  3VQV A;  1KUQ A;  1XOU A;  2ZNJ A;  4UCS A;  2BCC H;  3ZHT A;  3K0D A;  2EUL A;  1UPG A;  4DUY B;  1AP5 A;  1OCZ C;  4NR1 A;  1P84 F;  2P90 A;  3E89 A;  4LH6 A;  3H9V A;  3RBZ A;  4X1K B;  2UXC B;  2LFR A;  4LWS A;  3CRQ A;  1AJN A;  2ZQM A;  3CWB H;  4DV2 B;  4PEL A;  4NXM B;  1V55 B;  4JI7 B;  1QVG U;  4FM1 A;  3WB2 A;  4DW1 A;  5GW7 A;  2OCH A;  3HB3 B;  1KMI Z;  4GX2 A;  1YSC A;  4JPR A;  2YUA A;  2HLD G;  3CJH A;  3B2E E;  3ETG A;  5GTH Z;  2BTO A;  3T1Y O;  1H2S B;  3JD2 A;  4X1K A;  2XUM A;  3ASN B;  1BL8 A;  4GT1 A;  3CRA A;  4B3M O;  2JS5 A;  5J2T A;  4Q6G A;  3P3N A;  1GMG A;  3LDE A;  3MHS C;  4ZBM A;  1BZK A;  3JAL B;  2HG5 C;  2P67 A;  2OWO A;  4DR7 B;  4DR5 B;  1IBM B;  2CDY A;  4FLU A;  4PD4 F;  1J95 A;  3AG1 B;  2YEV B;  1IBK B;  3DC5 A;  3SPC A;  4K3A A;  5ITZ B;  3JAM N;  2P4K A;  1ENV A;  1O9G A;  2B5U A;  1K8A W;  1GM8 A;  1WB8 A;  1P49 A;  4X65 O;  2ZE6 A;  4J80 A;  2R9I A;  5B66 Z;  1Q6U A;  4UB8 Z;  3FKS G;  4J9Z B;  5L3G A;  2ZXW C;  2F4V O;  3JAL A;  4JI2 O;  4Z2W A;  1BCC H;  1MNG A;  2OIG A;  2WSS G;  2DE0 X;  1HDJ A;  4KHP B;  3FYE B;  1KBH A;  2D3O W;  2YEV A;  3N2G B;  3SYO A;  3GWO A;  3E35 A;  3ASN C;  5IYD O;  3KCY A;  1GAX A;  1HP8 A;  4KFM A;  1AJQ A;  3DXR B;  3HPL C;  2FB5 A;  1BQ0 A;  3CCJ V;  3CCQ V;  2JEX A;  3LDD A;  4H44 B;  4DV5 O;  4DV7 B;  3QG5 A;  2NLJ C;  4J7Z A;  4LFC O;  1SRY A;  3K3W A;  3K03 A;  4CH3 A;  4TQD A;  1FXH A;  2AHZ A;  3SR2 C;  3I55 V;  5B1B B;  1M90 W;  2Y69 B;  4DV4 O;  1WP7 A;  4JI3 O;  3VBB A;  3A8T A;  2CE4 A;  2MW2 B;  4GX1 A;  1GN2 A;  5D5Q A;  1QQC A;  4P2Z A;  5DED A;  2FL4 A;  1QLE B;  4U3J B;  2ZIM A;  3BVO A;  3RW0 A;  3ZX6 A;  3ABU A;  1M9N A;  4DO2 A;  2UXN A;  3DXR A;  4I5S A;  5FNV B;  1DLB A;  4LFA B;  5CA0 B;  4DR2 B;  4MTO A;  4OX9 B;  4YIO A;  1GN6 A;  4UUJ C;  3K04 A;  5BXZ A;  2ZM6 B;  1JNB A;  4FIP C;  2E76 B;  4PV1 B;  4TQF A;  4HZ3 A;  5E79 Z;  2RCV A;  1R3L C;  1SA0 B;  4PI0 A;  3BAA A;  4O2B B;  1WN7 A;  1VQP V;  3B09 A;  4Q20 A;  2JRI A;  4MS2 A;  2HHH B;  2P22 C;  2GV9 A;  5LGN A;  2DQ3 A;  3UCS C;  3R65 A;  2N74 A;  5EC1 C;  2UXD B;  5CA0 A;  4MSW C;  1YI2 V;  3ZRX A;  1AI5 A;  2L35 A;  5LYJ B;  1Q86 W;  2CGN A;  2BSK B;  4K0K O;  5IY5 B;  3ABK B;  1VEW A;  3CCE V;  4IT5 A;  4I4T B;  4O2B A;  1WB7 A;  3D36 A;  2P5O A;  2HP8 A;  4F6R A;  4NTW A;  2GTS A;  1M56 B;  3ZHR A;  2QTS A;  1R6N A;  3I5D A;  5B1O A;  4YIP A;  3UO2 A;  3W7U A;  1AIL A;  4DV0 B;  3L71 H;  3D8C A;  1WPB A;  3SJQ C;  2JVD A;  1N33 B;  1I5X A;  5LYJ A;  1R6T A;  3ZHS A;  5CA3 A;  2EIN B;  2XTA A;  3RYH B;  2QE7 G;  1F23 A;  4DW0 A;  4YJ2 A;  2BSK A;  3D36 C;  3ZRW B;  4ZIB A;  3QF7 A;  4JZG A;  1CPY A;  1B04 A;  1K33 A;  1FYJ A;  4AIL C;  1OCR C;  1LUW A;  4I4T A;  1US6 A;  1Q6I A;  1XNQ B;  4XBF A;  3MAQ A;  4PDM A;  4YHH O;  2BOC C;  3W7X A;  1S0V A;  1K9M W;  3CXH F;  4X20 A;  2R9A A;  5TIS Z;  2JIZ G;  2DMX A;  3E86 A;  1G8M A;  1UFI A;  4RWU A;  2ILM A;  4B3T O;  3L74 H;  4JI5 O;  3ZRW A;  4IHJ A;  2LP7 A;  2G38 A;  3KZI Z;  4LBE C;  1OV9 A;  5IJ0 B;  3ZHQ A;  3SPJ A;  2P06 A;  2ODM A;  5IWA B;  2QKS A;  5FL7 G;  4WCE V;  3R66 A;  4IIJ A;  4LF8 B;  5JCO A;  2EIK C;  4CZZ A;  3A0H Z;  3UT5 A;  1I5Y A;  3QTC A;  3FAV A;  1B6Q A;  1S76 D;  1H2K A;  5B1N A;  4BW9 A;  4ZKI A;  4JAV A;  2ZCE A;  1D2D A;  3JAS A;  1Z5V A;  4UVB A;  3CXC U;  3M7M X;  3H1J H;  3ZMT A;  1BQZ A;  1N8R W;  2W6J G;  2OIE A;  5IJ0 A;  3X2Q C;  3QO5 A;  1FXV A;  4Z1M G;  3W7W A;  4K8X A;  4WBN B;  2XAF A;  4JI8 B;  3BFR A;  1RM1 B;  4P30 A;  1GK9 A;  1NJI W;  4NXN B;  2DWD C;  4JV5 O;  2DW4 A;  1SQG A;  4J7K A;  2Q5Z A;  3HKC B;  5K1P A;  5KAF Z;  3BPZ A;  1S77 D;  3K5L A;  1N0N A;  1ZL8 B;  4X66 O;  3OTO B;  3STL C;  3LUT B;  4GKK O;  1W0J G;  2Q7G A;  4LF7 O;  2ADP A;  1N32 B;  4W4K A;  2XT9 A;  1W2B U;  4WBN A;  5DM6 V;  2PI4 A;  3CSX A;  2NNU A;  4GKJ B;  2HEP A;  4DR4 B;  4LP8 A;  1NU1 H;  4PDL A;  3TXS A;  3QVN A;  3OW2 U;  3JAW B;  3ZIA G;  1BE3 H;  3JSL A;  3HKC A;  3ZRV A;  5KUK A;  5IYC O;  4DR1 B;  1IVS A;  5LMN B;  3AK3 A;  3RYI B;  5FLX N;  4LF4 B;  4I9W A;  3ZBH A;  1ZL8 A;  4MVQ A;  1B3Q A;  2IJI A;  1MG1 A;  1O9H A;  1NT2 B;  4DXW A;  1EN6 A;  3J80 N;  2QKA A;  3CHX A;  1FXK B;  4LCU C;  5B1A B;  5EC2 C;  2AZ0 A;  4LH7 A;  5BR8 O;  1K4C C;  4P9P A;  4WFE A;  1K34 A;  2F43 G;  1GM9 A;  3QNE A;  3JAW A;  1YXB A;  3LNM B;  1EBO A;  2XAJ A;  2Y0P A;  3AG2 C;  3OMI B;  4NTX A;  4EFB A;  2MK3 A;  4LR3 A;  4J7J A;  3RYI A;  4WFG A;  1JMK C;  3CD6 V;  2LJ2 A;  4LF6 B;  3WB1 A;  3ZED A;  1ZAU A;  4UCT A;  2P7T C;  4DK0 A;  3RFR A;  5B3S C;  4RUF A;  4O4I A;  1THZ A;  2YC0 A;  5JH7 B;  3OM3 B;  1YEW A;  1QCE A;  5EYP A;  2VQE B;  2QM4 A;  4JTC B;  5B5E Z;  1VMG A;  3W7S A;  1IBL B;  1HR0 B;  5D5P A;  1PNM A;  2V7Q G;  2UUB B;  4K8Z A;  1NTK H;  2Z0A A;  5AG2 A;  1KYO F;  2VQF B;  2K1E A;  1VF6 A;  1EN4 A;  5GON B;  1OZ0 A;  3SJA C;  4X62 B;  4BIU A;  5CN0 A;  5EZY B;  4LNU B;  4CH5 A;  2A9H A;  1XQ8 A;  4E4E A;  2X0L A;  5KA5 A;  4LF5 B;  1P7G A;  2EJR A;  2R70 A;  3AK2 A;  5JH7 A;  5J2U A;  3RT3 C;  2CH7 B;  2F66 C;  4YY3 B;  1RPR A;  1Y4M A;  2EBO A;  1VQM V;  3H1I H;  1HW7 A;  3I56 V;  4DV6 O;  1QHT A;  4DR6 O;  2WAM A;  2EIM C;  4FFB B;  2PTM A;  1IZ3 A;  3NR7 A;  3WG7 B;  4UVA A;  3N27 A;  5EZY A;  5EK0 A;  4JI0 O;  3JAK A;  5IT9 N;  3EHB B;  2JJ1 G;  2HR3 A;  4PA7 A;  4NKG B;  2CH7 A;  1KU9 A;  2R9R B;  4WFH A;  4C7U A;  1F4N A;  1M57 B;  4RO2 A;  3G67 A;  1WLE A;  1VQ8 V;  1SQV H;  1OCO B;  2IJJ A;  2IU3 A;  4ZHQ B;  4BW5 A;  1VQO V;  1FOU A;  4FFB A;  4DV3 O;  4UXN A;  2YI8 A;  1WJZ A;  1MAB G;  2Q0O C;  1XRE A;  1JX9 A;  2DYS B;  4JZ2 A;  5H6Q A;  3T1Y B;  3OUF A;  1L0N H;  1XMQ O;  3CC4 V;  3CCS V;  2K9P A;  2XAH A;  2WLJ A;  3AG4 B;  2GTA A;  4UV8 A;  2HKO A;  1CP9 A;  3ZJZ A;  3JCU Z;  4B3M B;  3HR0 A;  4WFF A;  2WLI B;  2YI9 A;  4I50 B;  3LSQ A;  3IC9 A;  5IJ9 B;  1JJ2 U;  4UCO A;  2LQT A;  4X1I A;  5EIB D;  1JPX A;  1VQN V;  1OCC C;  4U7N A;  1LNQ A;  5KHH A;  4ZHQ A;  1JFF B;  5JJN B;  4QIW F;  2Q7H A;  4OXS A;  3K79 A;  5H9C A;  3SPI A;  1ZTE A;  4IYH A;  1V9P A;  1AR4 A;  1YZB A;  3ABM C;  4H0L B;  3TCU A;  1GM7 A;  2QWN B;  3B4S A;  4X65 B;  1YJ9 V;  3JYC A;  4EB6 B;  1Q8I A;  2ZE5 A;  1XIL A;  2WLN A;  1VF5 B;  2LGW A;  2WLI A;  2QWR B;  4OPA A;  5LP6 B;  4FLW A;  2F4V B;  5CMU A;  4JI2 B;  4MTG A;  5DEC A;  2YIB A;  4PJ0 Z;  4MVO A;  3ETQ A;  1JFF A;  2CTQ A;  1KP3 A;  3G71 V;  2E5L O;  4PA4 A;  3CCM V;  2QWO B;  4JYA O;  3ASO B;  4TSF G;  2CAZ C;  1HNW O;  4DUZ O;  4QJF B;  2Y48 A; 
#chains in the Genus database with same CATH homology
 4C7U A;  1KKC A;  1VAR A;  1SZX A;  1BSM A;  5A9G A;  1WB7 A;  2GDS A;  1MSD A;  1I08 A;  3KDR A;  4F6E A;  2QKC A;  4YIP A;  1PL4 A;  4GUN A;  1EM1 A;  3TJT A;  3BFR A;  3K9S A;  1XRE A;  3KKY A;  1XDC A;  1GN4 A;  1ZSP A;  3EVK A;  4JZ2 A;  1IX9 A;  1D5N A;  2CE4 A;  1GN2 A;  1ZLZ A;  1MMM A;  3MDS A;  3CEI A;  4FFK A;  4JZG A;  1EN5 A;  1N0N A;  1JA8 A;  3IC9 A;  1LUW A;  3AK1 A;  5AG2 A;  2ADP A;  3C3T A;  1BT8 A;  1AR5 A;  1QNM A;  1XUQ A;  1EN4 A;  4YIO A;  1GN6 A;  1IXB A;  1ZTE A;  1AR4 A;  4E4E A;  2ADQ B;  1P7G A;  1IDS A;  3AK2 A;  2CDY A;  3QVN A;  1AP6 A;  1I0H A;  1Y67 A;  3DC5 A;  2RCV A;  3C3S A;  2P4K A;  1XIL A;  1GN3 A;  3AK3 A;  1WB8 A;  1BS3 A;  1ZUQ A;  3LSU A;  1B06 A;  4BR6 A;  4X9Q A;  1JR9 A;  3RN4 A;  1VEW A;  3OT7 A;  1EN6 A;  4JYY A;  1AVM A;  2QKA A;  3DC6 A;  1MNG A;  1MA1 A;  1N0J A;  1AP5 A;  1LUV A;  2AW9 A;  1PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...