2P4KA

Contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAANVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2p4kA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2p4kA02
1B06A 1WB7A 1BS3A 2QKAA 1GN4A 4GUNA 3C3TA 1AVMA 1D5NA 1GN6A 3IC9A 2ADQB 1IX9A 1ZTEA 1LUVA 3MDSA 4C7UA 1N0NA 3AK2A 1I0HA 4BR6A 2GDSA 3KKYA 1EN4A 4JZGA 1BSMA 1XDCA 4X9QA 1XILA 1N0JA 1I08A 2RCVA 2QKCA 3AK3A 1JR9A 1AR5A 3CEIA 5AG2A 1VEWA 1XUQA 3RN4A 4FFKA 1EM1A 1ZLZA 3AK1A 1PL4A 2CDYA 1BT8A 1XREA 1LUWA 3DC6A 3TJTA 2CE4A 1MMMA 4YIOA 4YIPA 1Y67A 1JA8A 1GN2A 1P7GA 5A9GA 2ADPA 1EN5A 1EN6A 1QNMA 4F6EA 1KKCA 4JYYA 4JZ2A 2AW9A 1IXBA 2P4KA 1VARA 1SZXA 1AR4A 1ZSPA 3BFRA 1MNGA 3K9SA 1ZUQA 1WB8A 3LSUA 1MA1A 3DC5A 1MSDA 1AP5A 3EVKA 3QVNA 4E4EA 1IDSA 3C3SA 1GN3A 1PM9A 1AP6A 3OT7A
chains in the Genus database with same CATH superfamily
3L72H 4A5UB 1PNMA 3IJ4A 5EC2C 1F51A 1H8HG 2P22C 2PI5A 1HW7A 5D5QA 4X65O 1IBMO 4W4LA 1MZFA 5CA0B 1T5EA 3AK2A 1O9GA 3OUFA 2EZPA 2UUBB 3KKYA 4JI4O 4WBNB 1N34B 2JEXA 4PA9A 4B7EA 1XILA 2HR3A 4U7NA 1S5HC 3B40A 2R9AA 1TUBB 3G71V 3JASB 2OTLV 1K97A 1PP9H 1Q90D 3SPIA 4PA4A 1L1FA 3IAYA 3S3WA 5BMVA 1YITV 4JI5O 4YJ3A 2RQ6A 3RT3C 4LF6O 4DR4O 2PF4E 4IT5A 1HR0O 4IL6Z 4DK1A 2Z0AA 2QKSA 5KHIA 4JYAB 3ZBHA 1K34A 1K5SA 3P32A 1SERA 2OCCB 1I5YA 3JCZA 2ZDIC 4HBNA 2V7QG 4X8AA 3OGCC 4QE9A 4KL1A 3CCRV 1RM1C 1WP8A 1QBZA 4X62B 5LHGA 2A9HA 2ZD9A 3CCEV 2F93B 5EYPB 1K5QA 2D3OW 3JD2A 4X66O 1FJGB 5CN0A 3OTOO 4JI7O 1DTOA 4DR7O 5JVDB 3ETDA 4X20A 4DR3B 4JI8O 1HNWB 3QVNA 4NR1A 1WA8A 2A7WA 1GKFA 3A0BZ 2HKOA 4UCUA 3CCLV 3QF7A 3D3IA 1BGYH 3RYFB 1SETA 3ZX6A 4DV0O 4OXSA 1FXKA 1R1BA 2LFRA 3RW0A 3ICXA 4J7JA 3JSNA 1D5NA 2L35A 1H2SB 5BZBA 1IVSA 1SA0A 1B3QA 3APOA 2QJ1A 3ZHQA 2WLLB 2Q4PA 2DOSA 4N23A 4OX9O 3H01A 4CH5A 1LNQA 3JD4A 4JV5O 1WPBA 1WJZA 2N04A 5EZYB 1KUQA 1PNLA 3N27A 2NLJC 4DXWA 2RCVA 5KMGB 4NTYA 4JI6B 3HKEB 1YSCA 3H1IH 3T4DA 1N32B 5AG2A 3T2MA 4IIJB 4LF4B 4TT3G 2IJKA 3CCMV 2YEVA 2WPDG 4P30A 4FFBB 2FB5A 3OE7G 2A3QA 1MMMA 3WB2A 3AG3C 3HR0A 3J80N 5KHKA 2WWWA 2Q6AA 2ZNJA 2XUMA 5CA1A 1H5WA 4AI8A 3E83A 3L71H 3G4SV 1S72V 4B3RO 1BQ0A 4YHHO 4MVMA 3ZS8C 4K8XA 4FM0A 1EN6A 3CRCA 2DW4A 2W6IG 3A0RA 4JYYA 4O2BB 2HG5C 4UV8A 1ZL8A 1PD3A 4MVRA 3FD9A 1CXZB 2JDIG 3KCYA 3L73H 4MTOA 1AR4A 4OPHA 1YJWV 2QSAA 3RYCB 2Q0AA 4RUFA 1RM1B 4MTGA 3CB2A 4MTXA 3K04A 1N4CA 2EZOA 4UCRA 1AP5A 4X64O 3KDRA 3FAVA 1SQPH 4GX5A 1FS0G 2W6JG 5KHJA 3SDLA 4EEQA 1BS3A 1E79G 1BE3H 3UM7A 1D2DA 2V1DA 1VQ4V 5GTHZ 4Z1MG 3ZMUA 1XMOB 4I55B 1GMGA 2K9PA 3CRMA 3CX5F 3W7XA 4DV1B 4TV8A 1YJ9V 3H1HH 3STLC 2M6YA 1YZBA 2YXYA 2DE0X 3CSXA 4LF7B 3APQA 3ZMVA 4MT8A 2VRZA 3DXRB 4ZKIA 4JAVA 4EKWA 1FOUA 4B3SO 2OYQA 2QKCA 1P7BA 2XAJA 1W0JG 3QO5A 2P5OA 1EM1A 2ATKC 1YJNV 5JQGB 4I4TA 2XOKG 4NKGB 2Y4UA 4DUZO 3OMNB 1YTFD 1GTOA 4PDMA 3SGIA 1F4NA 5J2TA 3MD0A 4JI1O 1COWG 1HWYA 1Q8IA 1QNMA 3J7AU 2WSSG 2ZM6B 3AG3B 4DR5B 2UUBO 5GW7A 1FXKC 2B9ZA 1OV9A 2AZ2A 1N33B 3HKDB 4WFGA 1MZEA 4RO2A 4JTCB 1VARA 1QVFU 4O2AB 3ASOC 4LFAB 1TVKA 1MNGA 1JVMA 5CA3A 1S0VA 2Z5UA 3DC5A 1B6QA 5EIBC 1J95A 4E4EA 1S5JA 4YJ2B 4O4LB 1IDSA 4X1YB 1PM9A 2FL4A 5B1BC 2IW5A 3UKMA 4XDJA 2HVJC 2QKAA 1BZKA 1QCEA 2KG7B 2YS8A 4FM1A 2FYUH 4JYAO 1KBHA 3G80A 4O4IA 4C7UA 2VQEB 2UXCB 1NI8A 3RYIA 1BQZA 2GDSA 1YI2V 3BEHA 5KLVH 3JAWA 1XDCA 3JATB 4X62O 1I08A 1AILA 5BXZA 5L3DA 1BHBA 4PA3A 4I50B 3FB7C 4X88A 2DMXA 3QO8A 1EFRG 3KCXA 2NR5A 5BMVB 3CCUV 3SJBC 3GVMA 4KP4A 1HNXO 2JEUA 4DR3O 1HNWO 2Z3YA 3B8NA 1SF9A 1FFTB 2QM8A 3K5MA 1G8MA 3ZHVA 4YIPA 3K57A 1XOUA 5LA6B 2VWKA 1ORQC 1R3JC 3LSQA 2JJ1G 3W7TA 3F5TA 3CD6V 3LNNA 1US6A 3B77A 4LF5B 1K4DC 1H2LA 2Q7HA 1U97A 4WF9V 2OIEA 2DQ3A 3ZJZA 2H8PC 3OUSA 2UUAB 5IDJA 2WLIA 1NBMG 1M5IA 4O4HA 2ARHA 4UCOA 1F7YA 2DWDC 4DW1A 1K4CC 4JI6O 2ZT9B 2RJZA 4IYIA 4TUYB 1VQ5V 1N32O 1NR7A 4Q20A 5DN6G 4LF4O 4LNUA 2AHZA 1F23A 4F4LA 5J2UA 2JRIA 4PDVA 1JNBA 2ZE8A 3C3SA 5DM6V 3HKBB 5LP6A 3T1HB 3THOA 3UO2A 5KUKA 1SQGA 3ASOB 3FKSG 3BA8A 3FB8C 2IU0A 3ABUA 3ZMSA 3OAAG 2GSMB 4CBCA 1CP9A 3CJHB 1ZTEA 5IJ9A 5B1BB 1FFXA 1N0NA 5JJJB 5KA5A 2JS3A 4PI2A 1KMIZ 5B66Z 1V55C 1L0LH 1SKVA 1N0JA 4BAYA 4GKKB 1LR1A 2QR4A 2N05A 1NTKH 1JR9A 2NN4A 4ZOLB 3AG2C 5JH7B 4QE7A 1SQBH 4MW3A 1Q82W 5IYBO 2EJ7A 1XNQB 5LOVA 2KKWA 4P9PA 4U3JB 3E22A 4MTFA 3UT5A 3JD1A 1Q86W 2R9RB 1IBLB 1LUWA 4B3MB 3OR7C 2R9IA 3N2GB 1MOFA 4CS3A 5TISZ 3O9OA 4LCUC 1WPXA 1XMOO 1EZVH 5LMUB 4CH6A 3B2EE 3CHXA 2XASA 2GBOA 4DV1O 2N74A 2CH7A 1Y76B 1KKCA 1W2BU 4B3TB 4JI2B 4LF7O 1NH2B 3ZMTA 1R3LC 2P7TC 1NZ6A 4WFHA 4MVOA 4QPKA 4K8ZA 1IXBA 2NNUA 1Y6XA 1V54C 5F2VO 4YXWG 4H37A 3J81N 2LO1A 1WLEA 1Z5VA 3BFRA 3CS5A 4DRXB 3JARA 1FKAO 4YY3B 3OEHG 4XDKA 5KAFZ 2FMLA 3RGBA 2B1GA 2JGDA 5K1XA 3C90A 1GN4A 3C3TA 4FLTA 2Q68A 2CTQA 3ML0A 1O9HA 2RN9A 3CCVV 1D5AA 2ZM6O 4DR5O 4NTXA 4QNHB 2KSDA 4J42A 4LWSB 3SPCA 4X9QA 4DW0A 5KX5A 1N33O 1VQ8V 2HP8A 4F6RA 1QU7A 3UQ8A 2BE3A 3D8CA 1QLNA 4LFAO 3ZRVA 4QIWF 4RQEA 1V55B 4WFFA 1URFA 3ZN1A 3W7SA 2ZNIA 1GM8A 2CE4A 5LL6Y 3JAMN 3AG2B 1RSOB 2BTQA 2X6BA 5L3GA 4QGPA 3H1JH 5FNVA 4DYLA 5A9GA 4J7ZA 2ADPA 5GTIZ 2VQEO 1WP7A 2UXCO 4ICGA 2P90A 1W59A 3CYOA 3K06A 3CC7V 2ZCEA 4DV5B 3H1LH 1M9NA 2Q8VA 3BVOA 1QQCA 1VF6C 2JJ2G 3ZRWA 1Y74B 1SZXA 2HHHB 4JI0B 2F43G 4IHJB 3JALA 1AI5A 3SYOA 3JAKB 2EIKC 3FFQA 4LFCB 3CC4V 4UCVA 4UVCA 4JGSA 2MK3A 1V54B 1JMKC 4U3FH 1KP3A 4FLWA 3ABMB 3ZHTA 2UXDB 3RYIB 4GUNA 4L8JA 5IYCO 1MSWD 5GONA 4DV3B 1XHZA 1NR1A 1WNSA 1JFFA 3X2QC 3RYHB 2IU3A 4X1IB 3RWRD 3E8BA 4LF5O 2UUCB 1Q6IA 5E1AC 4DR2O 4BIZA 2MW2B 2QM4A 2UUAO 3Q4HB 3U11A 2EBOA 5JCOA 3T4ZA 5CMUA 5C8YA 3K0DA 3ABTA 4JI3B 4AQYB 5DECA 1X4TA 1X59A 4X1KB 1XUQA 2QWOB 4GX2A 2EJRA 1VMGA 4ASUG 5EBMC 4PA7A 1A32A 2BCCH 3BCCH 3QTCA 1IXMA 3T1HO 3HKCA 4TV9A 4LC1A 3K9AA 5IWAB 3JD0A 2YI8A 4JPRA 4I7ZB 4JASA 5LXTB 4MS2A 3SPGA 2VQFB 5DEDA 3TGUH 5D5PA 1Y4MA 4KHPB 1IJGA 4HNAB 1PKXA 1G6UA 1S3JA 2GHYA 3SYPA 4GKKO 3G6EV 3IC7A 5FL7G 3WG7C 1L8DA 4J10A 1XNQO 2QWQB 2X6CA 2Y48A 1N36B 1OCCC 2HJFC 1IBLO 1GAXA 3M8AA 1GN3A 4B3MO 3K59A 3CRAA 2GTSA 5EIBD 1P4RA 1PV0A 3FB6C 5J9PC 3LDCA 1K92A 2DYRC 1AVMA 2EIKB 4H44B 2B5UA 5LMUO 3VQVA 1AJQA 3TK1A 3ZCCA 5IYZB 4UXNA 2YI9A 2WLHA 3A2FA 1PNKA 4B3TO 4JI2O 2YIDA 5CB4A 4PA6A 4LR3A 4ZHQA 3HB3B 3X2QB 5HFMA 4LFBB 2RNBA 2WAMA 3E22B 1R6KA 2ZE5A 5LYJA 3GWOA 3TCUA 5KHHA 3HPLC 4KXRA 2Q69A 2ZXWC 1YDXA 1DGSA 4PDRA 4YY3O 1NTMH 3K03A 2QWPB 2IJJA 4I0XB 4ABMA 4BWAA 4MVZA 5ITZB 3F5WC 1TA8A 2QE7G 2BSKA 1UFIA 3D36A 3ABKC 2PUSA 2E75B 3BPZA 5FLXN 2D2CB 4BW9A 3DSQA 4O4JA 2LW7A 1H8EG 4JZ2A 2ZR2A 1VQKV 2AW9A 1GK9A 2XAHA 3SJAC 2QWNB 3G67A 2IH1C 3L9DA 3U10A 2IJIA 5C93A 1CEZA 1AJNA 2XHBA 4FZ1A 3I55V 3EVKA 3JYCA 3WG7B 1XQ8A 1K73W 2P06A 1MABG 4FLYA 1N34O 1H2KA 1KQSU 5CA0A 2Q9LA 2L6LA 1Z2GA 3GWKC 5BR8B 1OCCB 4WCEV 1JPXA 5KUMA 3BRCA 4F6RB 2AXTZ 3RFRA 4DV5O 3JASA 1NU1H 1AI6A 1PL0A 4FPPA 5CBHA 3OMAB 2WA3A 2HHHO 1ENVA 4RAIA 1QLEC 1E1QG 4LFCO 4RUEA 1SESA 4E2LA 3E8HA 4MVSA 4JI4B 3T1YB 3JD3A 2PZSA 3K0GA 4CC5A 2ZXWB 3CRQA 3TXQA 1AR1B 2UXDO 5H5NA 1NJIW 1VQ7V 3MHHC 4OPAA 4DV3O 1NT2B 1FJGO 5LHIA 4GT1A 4YJ3B 4DR1B 3IFXA 2UUCO 4RWUA 2PI4A 2YC0A 5EYPA 2F4VB 4ZBMA 4K0KB 2A06H 3FX7A 2CTRA 4FLUA 3ABKB 3MHSC 5JVDA 1F4MA 4JI3O 3ETGA 1NS1A 4AQYO 2YXLA 3N2KA 3G6BA 5FPRA 2CGNA 3RYFA 2IH3C 2HLDG 1ZUQA 1WB8A 1J5EB 1AROP 2UU9B 3AEIA 3LDDA 5GONB 2LW1A 3RBZA 1SC5B 1AP6A 3ETEA 2ILMA 4FMTA 1SRYA 2IBZH 2WLLA 4X20B 2DWEC 1WA8B 3FYEB 1OCOC 1OZ0A 3CCQV 2DQ0A 4JI7B 2Q5ZA 2XNDG 1VP7A 3ABLC 5EZYA 2VQFO 1FXKB 1LUVA 3CRRA 1BCCH 2CTPA 5KMGA 1THZA 2P4VA 2YSUB 3SYQA 5LMNB 1AJPA 2WA4A 3HKEA 4KHPO 3K08A 1EN4A 1XBLA 4JTDB 1SA0B 4J9YB 3OD4A 2JS5A 4IIJA 4KUMA 4LBEC 4X89A 4CS4A 1L0NH 3CP1A 5EK0A 4FLZA 1AR5A 3ASNC 3VQWA 1AI7A 4FFBA 1KYOF 1VQLV 4TV9B 4XBFA 3OTFA 2GUZA 4GX0A 1IBKB 2R72A 1QR8A 3BAAA 1ZX3A 3QNEA 3TJTA 4B08A 1JCHA 2EULA 5L3BA 3CE2A 1Y67A 1QLEB 2YEVB 3R66A 1XI1A 1JOYA 4L87A 1Z5WA 2CUGA 4FZ0A 3SPJA 3E8FA 3UO3A 1HDJA 5CA1B 3S3XA 1WN7A 2ZDIA 3ZMZA 3OGIB 4GKJB 3VBBA 4B7KA 4LFBO 2XTAA 2PTMA 3EFFK 3SYAA 3F7YC 1ZL8B 1GRJA 4DR6B 3LSUA 3B4SA 2AGAA 1SQVH 1VQPV 4DV4B 4I55A 3B09A 3OT7A 3TETA 3STZC 2ETNA 2BOCC 1M57C 3CMEV 3ZHSA 1I5XA 3BHPA 3QO7A 1GO3F 4PELA 5A2QN 3FAVB 3L75H 3DXRA 1HP8A 1M1KW 2YICA 4BIUA 3L70H 4BR6A 3K5LA 1VQNV 2O57A 4NVPA 2QWRB 4JZGA 1IZ3A 1OCOB 1Q6HA 3WU2Z 4BIOA 4TV8B 2PYLA 3ABLB 4UB6Z 2LP7A 4CZZA 4K3AA 3ZEDA 4HAMA 2LFSA 1H2GA 5JQGA 2Y0PA 2F66C 1B04A 1FXVA 2ITDC 1BT8A 2E3CA 4ZI7A 1R3IC 3ASNB 4FLXA 2VS0A 3OM3B 3AG1C 4FJCC 4UB8Z 5HFLA 1NVPB 1N8RW 2WLNA 4I4TB 4PD4F 5BR8O 3ZRSA 5IYDO 4JAAA 1AI4A 3HKDA 1XL4A 3CPWU 2E5LB 2UXBB 1JJOA 2ZR3A 2PYJA 5B3SC 5EC1C 4O2AA 1ZWIC 5J2TB 2JIZG 1H38A 4W4KA 3CCSV 1XEQA 4CH4A 3E2EA 1SQFA 4CH3A 4MVQA 4YJ2A 4O4LA 4EB6A 4X1YA 1M4UA 4JI1B 1RP3B 2Q73A 4PI0A 3K9SA 3EXAA 1TAEA 1MA1A 2DN9A 2KG7A 1FXHA 4NXNB 5LP6C 3SJQC 4JF3A 4FIPC 3T1YO 4TOIA 3W7UA 1TVKB 4WFBV 5E79Z 4DV6B 1VQ6V 2YUAA 4R6ZA 3DGEA 3ZHUA 1EBOA 4J11A 2E74B 1YIJV 1IX9A 3JATA 2ITCC 4R50A 3MDSA 3WB1A 1FPOA 2OCHA 2WLKA 1SZTA 4DR1O 1ROPA 2FTKA 2H94A 1I0HA 2FKXA 2F4VO 2P67A 5H6QA 4I50A 1M57B 3NR7A 4K0KO 1OCRC 1SQQH 4UCSA 4O4IB 4DO2A 2PY5A 4I5SA 2GTAA 2EIJC 3VQYA 2XAFA 4LH6A 2IJHA 5IT9N 3UCSC 3JAWB 4HYOA 4R7CA 2OTJV 4UV9A 1QVGU 4TSFG 2ZKOA 4D6TH 4N21A 1J5EO 1QR9A 5LA6A 2UU9O 2DJVA 1OCZC 3AK1A 4GZRB 1JQ0A 1Q43A 1I7FA 4DK0A 1BMFG 2CAZC 1M93A 3ZRXA 2WLJA 1VIBA 5B5EZ 4NXMB 1H2MA 3SR2C 3D3QA 5LHHA 5H2FZ 1XMQB 1HNXB 4G27B 1KU9A 1XNRB 2HVKC 4PHZA 4TWKA 2BTOA 1GM7A 3N2KB 2X7RB 4JYCA 5LMNO 1HNZB 3AG1B 3W7WA 1UPGA 4DUYB 3KZIZ 4TUYA 5LBQA 1G1XB 5L3CA 2KB1A 3OMIB 2P4KA 4PJ0Z 4PDLA 4LH7A 5B3SB 2WLIB 3HKBA 4O4HB 2LGWA 3P3PA 3M99B 1K8AW 5B1OA 1MSDA 1IBKO 2YDEA 3AG4C 1KKDA 1K7DA 1U96A 3CJHA 4LNUB 5J2UB 4J7KA 1NQTA 2H3OA 4FM2A 2X0LA 3GB7C 2YXHA 1GN6A 1IURA 5LP6B 2ADQB 3AG7A 4EFBA 3I5DA 4LF8B 2CK3G 1Q5OA 5LGUA 4LF9B 4ZOLA 5JH7A 4TQDA 5H6RA 3ZHRA 4UFZA 4ZIBA 1CPYA 4OGQB 5IJ9B 3E86A 4CS2A 4GKJO 3SPHA 1K3EA 2GUZB 1FFXB 1GM9A 2G38A 4U7OA 4JYBA 1M90W 4U3JA 1Q81W 1SS3A 2W0FC 4UCTA 4DR6O 3N2GA 1OCRB 5CBFA 2E76B 3H9VA 3NXSA 1S76D 3A8TA 3MAQA 2OWOA 3FB5C 2EIJB 4DV4O 3T1CA 1KECA 5LOVB 5KAIZ 1XL6A 1Y76A 3UT5B 2LJ2A 1K33A 4DV7B 3F7VC 3E35A 1OCZB 3K58A 2UXXA 4JTAB 3LUTB 4J80A 2DYSC 4XDLA 2XAGA 1SQXH 2OT5A 2P6JA 5FPOA 4RQFA 4DRXA 2CH7B 2ZE6A 4H0LB 2EINC 1DF5A 1RFYA 4FK5C 4J9ZB 1ZSPA 1NH2D 2YIBA 1K9MW 3CXCU 4DV2B 2Y69C 2AZ0A 2A0LA 4GCZA 2QDOA 2XT9A 2ZQMA 1H2NA 3JARB 1Y66A 1TUEB 3ZN0A 1DLBA 2JGUA 1YHQV 1S5LZ 3CWBH 2V4DA 5IJ0A 2LGQA 4LWSA 2QTOA 3AG4B 5L3EA 2A79B 3K5NA 2JGDB 2YIBD 2E5LO 5JJNB 2UXBO 5JCOC 2X6AA 3LSSA 3FYIB 3JSLA 1I94B 1V9PA 3OFNG 3K5OA 3BY6A 4MW8A 5CBGA 4H33A 4ZI7B 5B1NA 2LQTA 3SJCC 5KX5B 4WBNA 1Q3EA 1RSOA 3P3NA 4H13B 3RN4A 5EBWC 1ZLZA 3VOUA 5IE9A 3CCJV 1PL4A 1TUBA 4I9WA 4NXNO 1NVPD 1XHXA 5K1PA 2DYRB 3EHBB 3LNMB 2CGOA 3IGAC 4DV6O 1JA8A 4AHCA 2W0XA 4JI0O 2QA4V 2JVDA 3OEEG 4X65B 2BTQB 3RVZA 1IBMB 2VWJA 3BABA 1P49A 1EZJA 1EN5A 1VF7A 3H1KH 1Y74A 4IHJA 5FNVB 4EB6B 2RMKB 1YCIA 2EX3A 4QPJA 3JAKA 1YEWA 2R70A 3PN1A 1TGOA 3ETQA 4I9QA 2DYSB 1KD1W 4P2ZA 5JJEB 3K79A 1FAFA 5IY5C 3CC2V 2Y4TA 3E89A 3SYCA 3VQXA 1P84F 3ZRWB 1M56C 4HZ3A 2RDCA 3JALB 1VQ9V 2EILC 3RYHA 4NYKA 4JI5B 4X1IA 2EINB 1B06A 4LF6B 4DR4B 1WB7A 4NXMO 1HR0B 2K1EA 4UVBA 2Y69B 3Q4HA 3WB0A 5BY1A 3IC9A 4GLXA 1XMQO 4Z2WA 3K3WA 1DK1A 4LP8A 4Q6GA 1XNRO 5B1AC 4GX1A 2GV9A 2Q0OC 1HNZO 1ZAUA 2BOBC 1W0KG 4DUYO 1JFFB 2IM9A 4WFEA 2ODMA 4X1KA 3AK3A 4D7TA 4X66B 2Q7EA 3CEIA 5IWAO 3OTOB 2JK5C 1UJWB 4DR7B 4FFKA 5C8YB 4DR2B 1FYJA 4JI8B 3OR6C 4UUJC 2B1IA 5EBLC 1RPRA 2HFEC 5LGTA 3DC6A 1R6TA 3E8GA 1NKDA 5LXTA 1G4YB 4DV0B 4YIOA 1R73A 1KP2A 3D36C 4WFAV 1GN2A 2ZE7A 2OIGA 1JX9A 4KFMA 2C2AA 4HNAA 1VQMV 3O65A 1MG1A 1JJ2U 4Z1VA 2EIMC 3HKCB 4LF8O 5KHGA 2UXNA 4F6EA 1N36O 4OX9B 4LF9O 4JV5B 4JAUA 1YF2A 2QGNA 2QM7A 5L3FA 4D7SA 2KQXA 4MVUA 3QG5A 1VF6A 1KC8W 1S77D 4O2BA 5LGNA 4K35A 5H9CA 1VQOV 3P30A 2YIAA 3I56V 2HJDA 3RVYA 4BW5A 4CC6A 1FD9A 4TQFA 5IYZA 3RYCA 1GH6A 4GYCB 5IY5B 1Q6UA 3DTUB 4DV7O 4EFEA 3B8MA 1AB3A 1M56B 4B3RB 4YHHB 2EILB 1R6NA 5JWPA 3CXHF 2CTWA 4MSWC 3M7MX 3OW2U 1R3KC 3A0HZ 4QJFB 1BSMA 3PJSK 1VF5B 1BHAA 2ZIMA 3CMAV 1NTZH 1WAZA 2QEXV 3U0ZA 5B1AB 2F1MA 3WFVA 5CB4B 4I0XA 1KB9F 4J41A 1VEWA 4ZHQB 5ITZA 2Q7GA 4DV2O 2WLMA 4X64B 5LYJB 2CDYA 4IYHA 1XREA 3LDEA 1PPJH 1RPOA 2OCCC 5KA6A 2AHYA 4R8CA 1P7GA 2PGGA 2QTSA 3ABMC 1Q7YW 2ZIOA 1E1RG 1YTFB 3L74H 3ZIAG 1OHHG 2BSKB 2M7WA 1BL8A 2Q67A 4FVMA 1I94O 2ZINA 1DF4A 3TXSA 1YVWA 4B3SB 4NTWA 2EIMB 4O4JB 1QHTA 2HEPA 4AILC 1OJHA 3R65A 4G2KA 4IGGA 3JCUZ 1YXBA 4FLVA 4UVAA 3KG2A 2F23A 5IJ0B 3BA9A 4G28B 4P9OA 4PV1B 4DUZB 2Y0IA 2XAQA 2F95B 4NB5A
chains in the Genus database with same CATH topology
1B06A 1WB7A 1BS3A 2QKAA 1GN4A 4GUNA 3C3TA 1AVMA 1D5NA 1GN6A 3IC9A 2ADQB 1IX9A 1ZTEA 1LUVA 3MDSA 4C7UA 1N0NA 3AK2A 1I0HA 4BR6A 2GDSA 3KKYA 1EN4A 4JZGA 1BSMA 1XDCA 4X9QA 1XILA 1N0JA 1I08A 2RCVA 2QKCA 3AK3A 1JR9A 1AR5A 3CEIA 5AG2A 1VEWA 1XUQA 3RN4A 4FFKA 1EM1A 1ZLZA 3AK1A 1PL4A 2CDYA 1BT8A 1XREA 1LUWA 3DC6A 3TJTA 2CE4A 1MMMA 4YIOA 4YIPA 1Y67A 1JA8A 1GN2A 1P7GA 5A9GA 2ADPA 1EN5A 1EN6A 1QNMA 4F6EA 1KKCA 4JYYA 4JZ2A 2AW9A 1IXBA 2P4KA 1VARA 1SZXA 1AR4A 1ZSPA 3BFRA 1MNGA 3K9SA 1ZUQA 1WB8A 3LSUA 1MA1A 3DC5A 1MSDA 1AP5A 3EVKA 3QVNA 3KDRA 4E4EA 1IDSA 3C3SA 1GN3A 1PM9A 1AP6A 3OT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B06 A;  1WB7 A;  1BS3 A;  2QKA A;  1GN4 A;  4GUN A;  3C3T A;  1AVM A;  1D5N A;  1GN6 A;  3IC9 A;  2ADQ B;  1IX9 A;  1ZTE A;  1LUV A;  3MDS A;  4C7U A;  1N0N A;  3AK2 A;  1I0H A;  4BR6 A;  2GDS A;  3KKY A;  1EN4 A;  4JZG A;  1BSM A;  1XDC A;  4X9Q A;  1XIL A;  1N0J A;  1I08 A;  2RCV A;  2QKC A;  3AK3 A;  1JR9 A;  1AR5 A;  3CEI A;  5AG2 A;  1VEW A;  1XUQ A;  3RN4 A;  4FFK A;  1EM1 A;  1ZLZ A;  3AK1 A;  1PL4 A;  2CDY A;  1BT8 A;  1XRE A;  1LUW A;  3DC6 A;  3TJT A;  2CE4 A;  1MMM A;  4YIO A;  4YIP A;  1Y67 A;  1JA8 A;  1GN2 A;  1P7G A;  5A9G A;  2ADP A;  1EN5 A;  1EN6 A;  1QNM A;  4F6E A;  1KKC A;  4JYY A;  4JZ2 A;  2AW9 A;  1IXB A;  2P4K A;  1VAR A;  1SZX A;  1AR4 A;  1ZSP A;  3BFR A;  1MNG A;  3K9S A;  1ZUQ A;  1WB8 A;  3LSU A;  1MA1 A;  3DC5 A;  1MSD A;  1AP5 A;  3EVK A;  3QVN A;  4E4E A;  1IDS A;  3C3S A;  1GN3 A;  1PM9 A;  1AP6 A;  3OT7 A; 
#chains in the Genus database with same CATH topology
 3L72 H;  4A5U B;  1PNM A;  3IJ4 A;  5EC2 C;  1F51 A;  1H8H G;  2P22 C;  2PI5 A;  1HW7 A;  5D5Q A;  4X65 O;  1IBM O;  4W4L A;  1MZF A;  5CA0 B;  1T5E A;  3AK2 A;  1O9G A;  3OUF A;  2EZP A;  2UUB B;  3KKY A;  4JI4 O;  4WBN B;  1N34 B;  2JEX A;  4PA9 A;  4B7E A;  1XIL A;  2HR3 A;  4U7N A;  1S5H C;  3B40 A;  2R9A A;  1TUB B;  3G71 V;  3JAS B;  2OTL V;  1K97 A;  1PP9 H;  1Q90 D;  3SPI A;  4PA4 A;  1L1F A;  3IAY A;  3S3W A;  5BMV A;  1YIT V;  4JI5 O;  4YJ3 A;  2RQ6 A;  3RT3 C;  4LF6 O;  4DR4 O;  2PF4 E;  4IT5 A;  1HR0 O;  4IL6 Z;  4DK1 A;  2Z0A A;  2QKS A;  5KHI A;  4JYA B;  3ZBH A;  1K34 A;  1K5S A;  3P32 A;  1SER A;  2OCC B;  1I5Y A;  3JCZ A;  2ZDI C;  4HBN A;  2V7Q G;  4X8A A;  3OGC C;  4QE9 A;  4KL1 A;  3CCR V;  1RM1 C;  1WP8 A;  1QBZ A;  4X62 B;  5LHG A;  2A9H A;  2ZD9 A;  3CCE V;  2F93 B;  5EYP B;  1K5Q A;  2D3O W;  3JD2 A;  4X66 O;  1FJG B;  5CN0 A;  3OTO O;  4JI7 O;  1DTO A;  4DR7 O;  5JVD B;  3ETD A;  4X20 A;  4DR3 B;  4JI8 O;  1HNW B;  3QVN A;  4NR1 A;  1WA8 A;  2A7W A;  1GKF A;  3A0B Z;  2HKO A;  4UCU A;  3CCL V;  3QF7 A;  3D3I A;  1BGY H;  3RYF B;  1SET A;  3ZX6 A;  4DV0 O;  4OXS A;  1FXK A;  1R1B A;  2LFR A;  3RW0 A;  3ICX A;  4J7J A;  3JSN A;  1D5N A;  2L35 A;  1H2S B;  5BZB A;  1IVS A;  1SA0 A;  1B3Q A;  3APO A;  2QJ1 A;  3ZHQ A;  2WLL B;  2Q4P A;  2DOS A;  4N23 A;  4OX9 O;  3H01 A;  4CH5 A;  1LNQ A;  3JD4 A;  4JV5 O;  1WPB A;  1WJZ A;  2N04 A;  5EZY B;  1KUQ A;  1PNL A;  3N27 A;  2NLJ C;  4DXW A;  2RCV A;  5KMG B;  4NTY A;  4JI6 B;  3HKE B;  1YSC A;  3H1I H;  3T4D A;  1N32 B;  5AG2 A;  3T2M A;  4IIJ B;  4LF4 B;  4TT3 G;  2IJK A;  3CCM V;  2YEV A;  2WPD G;  4P30 A;  4FFB B;  2FB5 A;  3OE7 G;  2A3Q A;  1MMM A;  3WB2 A;  3AG3 C;  3HR0 A;  3J80 N;  5KHK A;  2WWW A;  2Q6A A;  2ZNJ A;  2XUM A;  5CA1 A;  1H5W A;  4AI8 A;  3E83 A;  3L71 H;  3G4S V;  1S72 V;  4B3R O;  1BQ0 A;  4YHH O;  4MVM A;  3ZS8 C;  4K8X A;  4FM0 A;  1EN6 A;  3CRC A;  2DW4 A;  2W6I G;  3A0R A;  4JYY A;  4O2B B;  2HG5 C;  4UV8 A;  1ZL8 A;  1PD3 A;  4MVR A;  3FD9 A;  1CXZ B;  2JDI G;  3KCY A;  3L73 H;  4MTO A;  1AR4 A;  4OPH A;  1YJW V;  2QSA A;  3RYC B;  2Q0A A;  4RUF A;  1RM1 B;  4MTG A;  3CB2 A;  4MTX A;  3K04 A;  1N4C A;  2EZO A;  4UCR A;  1AP5 A;  4X64 O;  3KDR A;  3FAV A;  1SQP H;  4GX5 A;  1FS0 G;  2W6J G;  5KHJ A;  3SDL A;  4EEQ A;  1BS3 A;  1E79 G;  1BE3 H;  3UM7 A;  1D2D A;  2V1D A;  1VQ4 V;  5GTH Z;  4Z1M G;  3ZMU A;  1XMO B;  4I55 B;  1GMG A;  2K9P A;  3CRM A;  3CX5 F;  3W7X A;  4DV1 B;  4TV8 A;  1YJ9 V;  3H1H H;  3STL C;  2M6Y A;  1YZB A;  2YXY A;  2DE0 X;  3CSX A;  4LF7 B;  3APQ A;  3ZMV A;  4MT8 A;  2VRZ A;  3DXR B;  4ZKI A;  4JAV A;  4EKW A;  1FOU A;  4B3S O;  2OYQ A;  2QKC A;  1P7B A;  2XAJ A;  1W0J G;  3QO5 A;  2P5O A;  1EM1 A;  2ATK C;  1YJN V;  5JQG B;  4I4T A;  2XOK G;  4NKG B;  2Y4U A;  4DUZ O;  3OMN B;  1YTF D;  1GTO A;  4PDM A;  3SGI A;  1F4N A;  5J2T A;  3MD0 A;  4JI1 O;  1COW G;  1HWY A;  1Q8I A;  1QNM A;  3J7A U;  2WSS G;  2ZM6 B;  3AG3 B;  4DR5 B;  2UUB O;  5GW7 A;  1FXK C;  2B9Z A;  1OV9 A;  2AZ2 A;  1N33 B;  3HKD B;  4WFG A;  1MZE A;  4RO2 A;  4JTC B;  1VAR A;  1QVF U;  4O2A B;  3ASO C;  4LFA B;  1TVK A;  1MNG A;  1JVM A;  5CA3 A;  1S0V A;  2Z5U A;  3DC5 A;  1B6Q A;  5EIB C;  1J95 A;  4E4E A;  1S5J A;  4YJ2 B;  4O4L B;  1IDS A;  4X1Y B;  1PM9 A;  2FL4 A;  5B1B C;  2IW5 A;  3UKM A;  4XDJ A;  2HVJ C;  2QKA A;  1BZK A;  1QCE A;  2KG7 B;  2YS8 A;  4FM1 A;  2FYU H;  4JYA O;  1KBH A;  3G80 A;  4O4I A;  4C7U A;  2VQE B;  2UXC B;  1NI8 A;  3RYI A;  1BQZ A;  2GDS A;  1YI2 V;  3BEH A;  5KLV H;  3JAW A;  1XDC A;  3JAT B;  4X62 O;  1I08 A;  1AIL A;  5BXZ A;  5L3D A;  1BHB A;  4PA3 A;  4I50 B;  3FB7 C;  4X88 A;  2DMX A;  3QO8 A;  1EFR G;  3KCX A;  2NR5 A;  5BMV B;  3CCU V;  3SJB C;  3GVM A;  4KP4 A;  1HNX O;  2JEU A;  4DR3 O;  1HNW O;  2Z3Y A;  3B8N A;  1SF9 A;  1FFT B;  2QM8 A;  3K5M A;  1G8M A;  3ZHV A;  4YIP A;  3K57 A;  1XOU A;  5LA6 B;  2VWK A;  1ORQ C;  1R3J C;  3LSQ A;  2JJ1 G;  3W7T A;  3F5T A;  3CD6 V;  3LNN A;  1US6 A;  3B77 A;  4LF5 B;  1K4D C;  1H2L A;  2Q7H A;  1U97 A;  4WF9 V;  2OIE A;  2DQ3 A;  3ZJZ A;  2H8P C;  3OUS A;  2UUA B;  5IDJ A;  2WLI A;  1NBM G;  1M5I A;  4O4H A;  2ARH A;  4UCO A;  1F7Y A;  2DWD C;  4DW1 A;  1K4C C;  4JI6 O;  2ZT9 B;  2RJZ A;  4IYI A;  4TUY B;  1VQ5 V;  1N32 O;  1NR7 A;  4Q20 A;  5DN6 G;  4LF4 O;  4LNU A;  2AHZ A;  1F23 A;  4F4L A;  5J2U A;  2JRI A;  4PDV A;  1JNB A;  2ZE8 A;  3C3S A;  5DM6 V;  3HKB B;  5LP6 A;  3T1H B;  3THO A;  3UO2 A;  5KUK A;  1SQG A;  3ASO B;  3FKS G;  3BA8 A;  3FB8 C;  2IU0 A;  3ABU A;  3ZMS A;  3OAA G;  2GSM B;  4CBC A;  1CP9 A;  3CJH B;  1ZTE A;  5IJ9 A;  5B1B B;  1FFX A;  1N0N A;  5JJJ B;  5KA5 A;  2JS3 A;  4PI2 A;  1KMI Z;  5B66 Z;  1V55 C;  1L0L H;  1SKV A;  1N0J A;  4BAY A;  4GKK B;  1LR1 A;  2QR4 A;  2N05 A;  1NTK H;  1JR9 A;  2NN4 A;  4ZOL B;  3AG2 C;  5JH7 B;  4QE7 A;  1SQB H;  4MW3 A;  1Q82 W;  5IYB O;  2EJ7 A;  1XNQ B;  5LOV A;  2KKW A;  4P9P A;  4U3J B;  3E22 A;  4MTF A;  3UT5 A;  3JD1 A;  1Q86 W;  2R9R B;  1IBL B;  1LUW A;  4B3M B;  3OR7 C;  2R9I A;  3N2G B;  1MOF A;  4CS3 A;  5TIS Z;  3O9O A;  4LCU C;  1WPX A;  1XMO O;  1EZV H;  5LMU B;  4CH6 A;  3B2E E;  3CHX A;  2XAS A;  2GBO A;  4DV1 O;  2N74 A;  2CH7 A;  1Y76 B;  1KKC A;  1W2B U;  4B3T B;  4JI2 B;  4LF7 O;  1NH2 B;  3ZMT A;  1R3L C;  2P7T C;  1NZ6 A;  4WFH A;  4MVO A;  4QPK A;  4K8Z A;  1IXB A;  2NNU A;  1Y6X A;  1V54 C;  5F2V O;  4YXW G;  4H37 A;  3J81 N;  2LO1 A;  1WLE A;  1Z5V A;  3BFR A;  3CS5 A;  4DRX B;  3JAR A;  1FKA O;  4YY3 B;  3OEH G;  4XDK A;  5KAF Z;  2FML A;  3RGB A;  2B1G A;  2JGD A;  5K1X A;  3C90 A;  1GN4 A;  3C3T A;  4FLT A;  2Q68 A;  2CTQ A;  3ML0 A;  1O9H A;  2RN9 A;  3CCV V;  1D5A A;  2ZM6 O;  4DR5 O;  4NTX A;  4QNH B;  2KSD A;  4J42 A;  4LWS B;  3SPC A;  4X9Q A;  4DW0 A;  5KX5 A;  1N33 O;  1VQ8 V;  2HP8 A;  4F6R A;  1QU7 A;  3UQ8 A;  2BE3 A;  3D8C A;  1QLN A;  4LFA O;  3ZRV A;  4QIW F;  4RQE A;  1V55 B;  4WFF A;  1URF A;  3ZN1 A;  3W7S A;  2ZNI A;  1GM8 A;  2CE4 A;  5LL6 Y;  3JAM N;  3AG2 B;  1RSO B;  2BTQ A;  2X6B A;  5L3G A;  4QGP A;  3H1J H;  5FNV A;  4DYL A;  5A9G A;  4J7Z A;  2ADP A;  5GTI Z;  2VQE O;  1WP7 A;  2UXC O;  4ICG A;  2P90 A;  1W59 A;  3CYO A;  3K06 A;  3CC7 V;  2ZCE A;  4DV5 B;  3H1L H;  1M9N A;  2Q8V A;  3BVO A;  1QQC A;  1VF6 C;  2JJ2 G;  3ZRW A;  1Y74 B;  1SZX A;  2HHH B;  4JI0 B;  2F43 G;  4IHJ B;  3JAL A;  1AI5 A;  3SYO A;  3JAK B;  2EIK C;  3FFQ A;  4LFC B;  3CC4 V;  4UCV A;  4UVC A;  4JGS A;  2MK3 A;  1V54 B;  1JMK C;  4U3F H;  1KP3 A;  4FLW A;  3ABM B;  3ZHT A;  2UXD B;  3RYI B;  4GUN A;  4L8J A;  5IYC O;  1MSW D;  5GON A;  4DV3 B;  1XHZ A;  1NR1 A;  1WNS A;  1JFF A;  3X2Q C;  3RYH B;  2IU3 A;  4X1I B;  3RWR D;  3E8B A;  4LF5 O;  2UUC B;  1Q6I A;  5E1A C;  4DR2 O;  4BIZ A;  2MW2 B;  2QM4 A;  2UUA O;  3Q4H B;  3U11 A;  2EBO A;  5JCO A;  3T4Z A;  5CMU A;  5C8Y A;  3K0D A;  3ABT A;  4JI3 B;  4AQY B;  5DEC A;  1X4T A;  1X59 A;  4X1K B;  1XUQ A;  2QWO B;  4GX2 A;  2EJR A;  1VMG A;  4ASU G;  5EBM C;  4PA7 A;  1A32 A;  2BCC H;  3BCC H;  3QTC A;  1IXM A;  3T1H O;  3HKC A;  4TV9 A;  4LC1 A;  3K9A A;  5IWA B;  3JD0 A;  2YI8 A;  4JPR A;  4I7Z B;  4JAS A;  5LXT B;  4MS2 A;  3SPG A;  2VQF B;  5DED A;  3TGU H;  5D5P A;  1Y4M A;  4KHP B;  1IJG A;  4HNA B;  1PKX A;  1G6U A;  1S3J A;  2GHY A;  3SYP A;  4GKK O;  3G6E V;  3IC7 A;  5FL7 G;  3WG7 C;  1L8D A;  4J10 A;  1XNQ O;  2QWQ B;  2X6C A;  2Y48 A;  1N36 B;  1OCC C;  2HJF C;  1IBL O;  1GAX A;  3M8A A;  1GN3 A;  4B3M O;  3K59 A;  3CRA A;  2GTS A;  5EIB D;  1P4R A;  1PV0 A;  3FB6 C;  5J9P C;  3LDC A;  1K92 A;  2DYR C;  1AVM A;  2EIK B;  4H44 B;  2B5U A;  5LMU O;  3VQV A;  1AJQ A;  3TK1 A;  3ZCC A;  5IYZ B;  4UXN A;  2YI9 A;  2WLH A;  3A2F A;  1PNK A;  4B3T O;  4JI2 O;  2YID A;  5CB4 A;  4PA6 A;  4LR3 A;  4ZHQ A;  3HB3 B;  3X2Q B;  5HFM A;  4LFB B;  2RNB A;  2WAM A;  3E22 B;  1R6K A;  2ZE5 A;  5LYJ A;  3GWO A;  3TCU A;  5KHH A;  3HPL C;  4KXR A;  2Q69 A;  2ZXW C;  1YDX A;  1DGS A;  4PDR A;  4YY3 O;  1NTM H;  3K03 A;  2QWP B;  2IJJ A;  4I0X B;  4ABM A;  4BWA A;  4MVZ A;  5ITZ B;  3F5W C;  1TA8 A;  2QE7 G;  2BSK A;  1UFI A;  3D36 A;  3ABK C;  2PUS A;  2E75 B;  3BPZ A;  5FLX N;  2D2C B;  4BW9 A;  3DSQ A;  4O4J A;  2LW7 A;  1H8E G;  4JZ2 A;  2ZR2 A;  1VQK V;  2AW9 A;  1GK9 A;  2XAH A;  3SJA C;  2QWN B;  3G67 A;  2IH1 C;  3L9D A;  3U10 A;  2IJI A;  5C93 A;  1CEZ A;  1AJN A;  2XHB A;  4FZ1 A;  3I55 V;  3EVK A;  3JYC A;  3WG7 B;  1XQ8 A;  1K73 W;  2P06 A;  1MAB G;  4FLY A;  1N34 O;  1H2K A;  1KQS U;  5CA0 A;  2Q9L A;  2L6L A;  1Z2G A;  3GWK C;  5BR8 B;  1OCC B;  4WCE V;  1JPX A;  5KUM A;  3BRC A;  4F6R B;  2AXT Z;  3RFR A;  4DV5 O;  3JAS A;  1NU1 H;  1AI6 A;  1PL0 A;  4FPP A;  5CBH A;  3OMA B;  2WA3 A;  2HHH O;  1ENV A;  4RAI A;  1QLE C;  1E1Q G;  4LFC O;  4RUE A;  1SES A;  4E2L A;  3E8H A;  4MVS A;  4JI4 B;  3T1Y B;  3JD3 A;  2PZS A;  3K0G A;  4CC5 A;  2ZXW B;  3CRQ A;  3TXQ A;  1AR1 B;  2UXD O;  5H5N A;  1NJI W;  1VQ7 V;  3MHH C;  4OPA A;  4DV3 O;  1NT2 B;  1FJG O;  5LHI A;  4GT1 A;  4YJ3 B;  4DR1 B;  3IFX A;  2UUC O;  4RWU A;  2PI4 A;  2YC0 A;  5EYP A;  2F4V B;  4ZBM A;  4K0K B;  2A06 H;  3FX7 A;  2CTR A;  4FLU A;  3ABK B;  3MHS C;  5JVD A;  1F4M A;  4JI3 O;  3ETG A;  1NS1 A;  4AQY O;  2YXL A;  3N2K A;  3G6B A;  5FPR A;  2CGN A;  3RYF A;  2IH3 C;  2HLD G;  1ZUQ A;  1WB8 A;  1J5E B;  1ARO P;  2UU9 B;  3AEI A;  3LDD A;  5GON B;  2LW1 A;  3RBZ A;  1SC5 B;  1AP6 A;  3ETE A;  2ILM A;  4FMT A;  1SRY A;  2IBZ H;  2WLL A;  4X20 B;  2DWE C;  1WA8 B;  3FYE B;  1OCO C;  1OZ0 A;  3CCQ V;  2DQ0 A;  4JI7 B;  2Q5Z A;  2XND G;  1VP7 A;  3ABL C;  5EZY A;  2VQF O;  1FXK B;  1LUV A;  3CRR A;  1BCC H;  2CTP A;  5KMG A;  1THZ A;  2P4V A;  2YSU B;  3SYQ A;  5LMN B;  1AJP A;  2WA4 A;  3HKE A;  4KHP O;  3K08 A;  1EN4 A;  1XBL A;  4JTD B;  1SA0 B;  4J9Y B;  3OD4 A;  2JS5 A;  4IIJ A;  4KUM A;  4LBE C;  4X89 A;  4CS4 A;  1L0N H;  3CP1 A;  5EK0 A;  4FLZ A;  1AR5 A;  3ASN C;  3VQW A;  1AI7 A;  4FFB A;  1KYO F;  1VQL V;  4TV9 B;  4XBF A;  3OTF A;  2GUZ A;  4GX0 A;  1IBK B;  2R72 A;  1QR8 A;  3BAA A;  1ZX3 A;  3QNE A;  3TJT A;  4B08 A;  1JCH A;  2EUL A;  5L3B A;  3CE2 A;  1Y67 A;  1QLE B;  2YEV B;  3R66 A;  1XI1 A;  1JOY A;  4L87 A;  1Z5W A;  2CUG A;  4FZ0 A;  3SPJ A;  3E8F A;  3UO3 A;  1HDJ A;  5CA1 B;  3S3X A;  1WN7 A;  2ZDI A;  3ZMZ A;  3OGI B;  4GKJ B;  3VBB A;  4B7K A;  4LFB O;  2XTA A;  2PTM A;  3EFF K;  3SYA A;  3F7Y C;  1ZL8 B;  1GRJ A;  4DR6 B;  3LSU A;  3B4S A;  2AGA A;  1SQV H;  1VQP V;  4DV4 B;  4I55 A;  3B09 A;  3OT7 A;  3TET A;  3STZ C;  2ETN A;  2BOC C;  1M57 C;  3CME V;  3ZHS A;  1I5X A;  3BHP A;  3QO7 A;  1GO3 F;  4PEL A;  5A2Q N;  3FAV B;  3L75 H;  3DXR A;  1HP8 A;  1M1K W;  2YIC A;  4BIU A;  3L70 H;  4BR6 A;  3K5L A;  1VQN V;  2O57 A;  4NVP A;  2QWR B;  4JZG A;  1IZ3 A;  1OCO B;  1Q6H A;  3WU2 Z;  4BIO A;  4TV8 B;  2PYL A;  3ABL B;  4UB6 Z;  2LP7 A;  4CZZ A;  4K3A A;  3ZED A;  4HAM A;  2LFS A;  1H2G A;  5JQG A;  2Y0P A;  2F66 C;  1B04 A;  1FXV A;  2ITD C;  1BT8 A;  2E3C A;  4ZI7 A;  1R3I C;  3ASN B;  4FLX A;  2VS0 A;  3OM3 B;  3AG1 C;  4FJC C;  4UB8 Z;  5HFL A;  1NVP B;  1N8R W;  2WLN A;  4I4T B;  4PD4 F;  5BR8 O;  3ZRS A;  5IYD O;  4JAA A;  1AI4 A;  3HKD A;  1XL4 A;  3CPW U;  2E5L B;  2UXB B;  1JJO A;  2ZR3 A;  2PYJ A;  5B3S C;  5EC1 C;  4O2A A;  1ZWI C;  5J2T B;  2JIZ G;  1H38 A;  4W4K A;  3CCS V;  1XEQ A;  4CH4 A;  3E2E A;  1SQF A;  4CH3 A;  4MVQ A;  4YJ2 A;  4O4L A;  4EB6 A;  4X1Y A;  1M4U A;  4JI1 B;  1RP3 B;  2Q73 A;  4PI0 A;  3K9S A;  3EXA A;  1TAE A;  1MA1 A;  2DN9 A;  2KG7 A;  1FXH A;  4NXN B;  5LP6 C;  3SJQ C;  4JF3 A;  4FIP C;  3T1Y O;  4TOI A;  3W7U A;  1TVK B;  4WFB V;  5E79 Z;  4DV6 B;  1VQ6 V;  2YUA A;  4R6Z A;  3DGE A;  3ZHU A;  1EBO A;  4J11 A;  2E74 B;  1YIJ V;  1IX9 A;  3JAT A;  2ITC C;  4R50 A;  3MDS A;  3WB1 A;  1FPO A;  2OCH A;  2WLK A;  1SZT A;  4DR1 O;  1ROP A;  2FTK A;  2H94 A;  1I0H A;  2FKX A;  2F4V O;  2P67 A;  5H6Q A;  4I50 A;  1M57 B;  3NR7 A;  4K0K O;  1OCR C;  1SQQ H;  4UCS A;  4O4I B;  4DO2 A;  2PY5 A;  4I5S A;  2GTA A;  2EIJ C;  3VQY A;  2XAF A;  4LH6 A;  2IJH A;  5IT9 N;  3UCS C;  3JAW B;  4HYO A;  4R7C A;  2OTJ V;  4UV9 A;  1QVG U;  4TSF G;  2ZKO A;  4D6T H;  4N21 A;  1J5E O;  1QR9 A;  5LA6 A;  2UU9 O;  2DJV A;  1OCZ C;  3AK1 A;  4GZR B;  1JQ0 A;  1Q43 A;  1I7F A;  4DK0 A;  1BMF G;  2CAZ C;  1M93 A;  3ZRX A;  2WLJ A;  1VIB A;  5B5E Z;  4NXM B;  1H2M A;  3SR2 C;  3D3Q A;  5LHH A;  5H2F Z;  1XMQ B;  1HNX B;  4G27 B;  1KU9 A;  1XNR B;  2HVK C;  4PHZ A;  4TWK A;  2BTO A;  1GM7 A;  3N2K B;  2X7R B;  4JYC A;  5LMN O;  1HNZ B;  3AG1 B;  3W7W A;  1UPG A;  4DUY B;  3KZI Z;  4TUY A;  5LBQ A;  1G1X B;  5L3C A;  2KB1 A;  3OMI B;  2P4K A;  4PJ0 Z;  4PDL A;  4LH7 A;  5B3S B;  2WLI B;  3HKB A;  4O4H B;  2LGW A;  3P3P A;  3M99 B;  1K8A W;  5B1O A;  1MSD A;  1IBK O;  2YDE A;  3AG4 C;  1KKD A;  1K7D A;  1U96 A;  3CJH A;  4LNU B;  5J2U B;  4J7K A;  1NQT A;  2H3O A;  4FM2 A;  2X0L A;  3GB7 C;  2YXH A;  1GN6 A;  1IUR A;  5LP6 B;  2ADQ B;  3AG7 A;  4EFB A;  3I5D A;  4LF8 B;  2CK3 G;  1Q5O A;  5LGU A;  4LF9 B;  4ZOL A;  5JH7 A;  4TQD A;  5H6R A;  3ZHR A;  4UFZ A;  4ZIB A;  1CPY A;  4OGQ B;  5IJ9 B;  3E86 A;  4CS2 A;  4GKJ O;  3SPH A;  1K3E A;  2GUZ B;  1FFX B;  1GM9 A;  2G38 A;  4U7O A;  4JYB A;  1M90 W;  4U3J A;  1Q81 W;  1SS3 A;  2W0F C;  4UCT A;  4DR6 O;  3N2G A;  1OCR B;  5CBF A;  2E76 B;  3H9V A;  3NXS A;  1S76 D;  3A8T A;  3MAQ A;  2OWO A;  3FB5 C;  2EIJ B;  4DV4 O;  3T1C A;  1KEC A;  5LOV B;  5KAI Z;  1XL6 A;  1Y76 A;  3UT5 B;  2LJ2 A;  1K33 A;  4DV7 B;  3F7V C;  3E35 A;  1OCZ B;  3K58 A;  2UXX A;  4JTA B;  3LUT B;  4J80 A;  2DYS C;  4XDL A;  2XAG A;  1SQX H;  2OT5 A;  2P6J A;  5FPO A;  4RQF A;  4DRX A;  2CH7 B;  2ZE6 A;  4H0L B;  2EIN C;  1DF5 A;  1RFY A;  4FK5 C;  4J9Z B;  1ZSP A;  1NH2 D;  2YIB A;  1K9M W;  3CXC U;  4DV2 B;  2Y69 C;  2AZ0 A;  2A0L A;  4GCZ A;  2QDO A;  2XT9 A;  2ZQM A;  1H2N A;  3JAR B;  1Y66 A;  1TUE B;  3ZN0 A;  1DLB A;  2JGU A;  1YHQ V;  1S5L Z;  3CWB H;  2V4D A;  5IJ0 A;  2LGQ A;  4LWS A;  2QTO A;  3AG4 B;  5L3E A;  2A79 B;  3K5N A;  2JGD B;  2YIB D;  2E5L O;  5JJN B;  2UXB O;  5JCO C;  2X6A A;  3LSS A;  3FYI B;  3JSL A;  1I94 B;  1V9P A;  3OFN G;  3K5O A;  3BY6 A;  4MW8 A;  5CBG A;  4H33 A;  4ZI7 B;  5B1N A;  2LQT A;  3SJC C;  5KX5 B;  4WBN A;  1Q3E A;  1RSO A;  3P3N A;  4H13 B;  3RN4 A;  5EBW C;  1ZLZ A;  3VOU A;  5IE9 A;  3CCJ V;  1PL4 A;  1TUB A;  4I9W A;  4NXN O;  1NVP D;  1XHX A;  5K1P A;  2DYR B;  3EHB B;  3LNM B;  2CGO A;  3IGA C;  4DV6 O;  1JA8 A;  4AHC A;  2W0X A;  4JI0 O;  2QA4 V;  2JVD A;  3OEE G;  4X65 B;  2BTQ B;  3RVZ A;  1IBM B;  2VWJ A;  3BAB A;  1P49 A;  1EZJ A;  1EN5 A;  1VF7 A;  3H1K H;  1Y74 A;  4IHJ A;  5FNV B;  4EB6 B;  2RMK B;  1YCI A;  2EX3 A;  4QPJ A;  3JAK A;  1YEW A;  2R70 A;  3PN1 A;  1TGO A;  3ETQ A;  4I9Q A;  2DYS B;  1KD1 W;  4P2Z A;  5JJE B;  3K79 A;  1FAF A;  5IY5 C;  3CC2 V;  2Y4T A;  3E89 A;  3SYC A;  3VQX A;  1P84 F;  3ZRW B;  1M56 C;  4HZ3 A;  2RDC A;  3JAL B;  1VQ9 V;  2EIL C;  3RYH A;  4NYK A;  4JI5 B;  4X1I A;  2EIN B;  1B06 A;  4LF6 B;  4DR4 B;  1WB7 A;  4NXM O;  1HR0 B;  2K1E A;  4UVB A;  2Y69 B;  3Q4H A;  3WB0 A;  5BY1 A;  3IC9 A;  4GLX A;  1XMQ O;  4Z2W A;  3K3W A;  1DK1 A;  4LP8 A;  4Q6G A;  1XNR O;  5B1A C;  4GX1 A;  2GV9 A;  2Q0O C;  1HNZ O;  1ZAU A;  2BOB C;  1W0K G;  4DUY O;  1JFF B;  2IM9 A;  4WFE A;  2ODM A;  4X1K A;  3AK3 A;  4D7T A;  4X66 B;  2Q7E A;  3CEI A;  5IWA O;  3OTO B;  2JK5 C;  1UJW B;  4DR7 B;  4FFK A;  5C8Y B;  4DR2 B;  1FYJ A;  4JI8 B;  3OR6 C;  4UUJ C;  2B1I A;  5EBL C;  1RPR A;  2HFE C;  5LGT A;  3DC6 A;  1R6T A;  3E8G A;  1NKD A;  5LXT A;  1G4Y B;  4DV0 B;  4YIO A;  1R73 A;  1KP2 A;  3D36 C;  4WFA V;  1GN2 A;  2ZE7 A;  2OIG A;  1JX9 A;  4KFM A;  2C2A A;  4HNA A;  1VQM V;  3O65 A;  1MG1 A;  1JJ2 U;  4Z1V A;  2EIM C;  3HKC B;  4LF8 O;  5KHG A;  2UXN A;  4F6E A;  1N36 O;  4OX9 B;  4LF9 O;  4JV5 B;  4JAU A;  1YF2 A;  2QGN A;  2QM7 A;  5L3F A;  4D7S A;  2KQX A;  4MVU A;  3QG5 A;  1VF6 A;  1KC8 W;  1S77 D;  4O2B A;  5LGN A;  4K35 A;  5H9C A;  1VQO V;  3P30 A;  2YIA A;  3I56 V;  2HJD A;  3RVY A;  4BW5 A;  4CC6 A;  1FD9 A;  4TQF A;  5IYZ A;  3RYC A;  1GH6 A;  4GYC B;  5IY5 B;  1Q6U A;  3DTU B;  4DV7 O;  4EFE A;  3B8M A;  1AB3 A;  1M56 B;  4B3R B;  4YHH B;  2EIL B;  1R6N A;  5JWP A;  3CXH F;  2CTW A;  4MSW C;  3M7M X;  3OW2 U;  1R3K C;  3A0H Z;  4QJF B;  1BSM A;  3PJS K;  1VF5 B;  1BHA A;  2ZIM A;  3CMA V;  1NTZ H;  1WAZ A;  2QEX V;  3U0Z A;  5B1A B;  2F1M A;  3WFV A;  5CB4 B;  4I0X A;  1KB9 F;  4J41 A;  1VEW A;  4ZHQ B;  5ITZ A;  2Q7G A;  4DV2 O;  2WLM A;  4X64 B;  5LYJ B;  2CDY A;  4IYH A;  1XRE A;  3LDE A;  1PPJ H;  1RPO A;  2OCC C;  5KA6 A;  2AHY A;  4R8C A;  1P7G A;  2PGG A;  2QTS A;  3ABM C;  1Q7Y W;  2ZIO A;  1E1R G;  1YTF B;  3L74 H;  3ZIA G;  1OHH G;  2BSK B;  2M7W A;  1BL8 A;  2Q67 A;  4FVM A;  1I94 O;  2ZIN A;  1DF4 A;  3TXS A;  1YVW A;  4B3S B;  4NTW A;  2EIM B;  4O4J B;  1QHT A;  2HEP A;  4AIL C;  1OJH A;  3R65 A;  4G2K A;  4IGG A;  3JCU Z;  1YXB A;  4FLV A;  4UVA A;  3KG2 A;  2F23 A;  5IJ0 B;  3BA9 A;  4G28 B;  4P9O A;  4PV1 B;  4DUZ B;  2Y0I A;  2XAQ A;  2F95 B;  4NB5 A; 
#chains in the Genus database with same CATH homology
 1B06 A;  1WB7 A;  1BS3 A;  2QKA A;  1GN4 A;  4GUN A;  3C3T A;  1AVM A;  1D5N A;  1GN6 A;  3IC9 A;  2ADQ B;  1IX9 A;  1ZTE A;  1LUV A;  3MDS A;  4C7U A;  1N0N A;  3AK2 A;  1I0H A;  4BR6 A;  2GDS A;  3KKY A;  1EN4 A;  4JZG A;  1BSM A;  1XDC A;  4X9Q A;  1XIL A;  1N0J A;  1I08 A;  2RCV A;  2QKC A;  3AK3 A;  1JR9 A;  1AR5 A;  3CEI A;  5AG2 A;  1VEW A;  1XUQ A;  3RN4 A;  4FFK A;  1EM1 A;  1ZLZ A;  3AK1 A;  1PL4 A;  2CDY A;  1BT8 A;  1XRE A;  1LUW A;  3DC6 A;  3TJT A;  2CE4 A;  1MMM A;  4YIO A;  4YIP A;  1Y67 A;  1JA8 A;  1GN2 A;  1P7G A;  5A9G A;  2ADP A;  1EN5 A;  1EN6 A;  1QNM A;  4F6E A;  1KKC A;  4JYY A;  4JZ2 A;  2AW9 A;  1IXB A;  2P4K A;  1VAR A;  1SZX A;  1AR4 A;  1ZSP A;  3BFR A;  1MNG A;  3K9S A;  1ZUQ A;  1WB8 A;  3LSU A;  1MA1 A;  3DC5 A;  1MSD A;  1AP5 A;  3EVK A;  3QVN A;  3KDR A;  4E4E A;  1IDS A;  3C3S A;  1GN3 A;  1PM9 A;  1AP6 A;  3OT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...