4JZGA

Crystal structure of a single cambialistic sod2 occupied by manganese ion from clostridium difficile
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
202
structure length
202
Chain Sequence
NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Crystal structure of a single cambialistic SOD2 occupied by Manganese ion from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Oxidoreductase
total genus 72
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4jzgA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4jzgA02
1AP6A 1ZTEA 1XREA 3AK1A 4BR6A 4YIPA 4X9QA 5AG2A 3C3TA 1GN6A 1XILA 1EM1A 4E4EA 4JZ2A 1D5NA 1VARA 1ZUQA 3RN4A 5A9GA 1PL4A 1AR4A 1GN2A 2QKAA 3IC9A 1AP5A 1N0NA 1KKCA 1XUQA 3KKYA 1IDSA 1IX9A 1VEWA 1XDCA 1LUWA 1JR9A 4FFKA 1IXBA 2ADQB 3AK2A 4JZGA 1EN5A 3QVNA 3LSUA 2AW9A 2P4KA 4JYYA 1MSDA 1MMMA 1GN4A 1QNMA 3DC6A 1ZLZA 1AVMA 1PM9A 1MNGA 2GDSA 1EN4A 1N0JA 1BS3A 2RCVA 3K9SA 1BSMA 3AK3A 1MA1A 1I08A 3OT7A 1EN6A 1SZXA 4GUNA 1Y67A 1WB8A 2QKCA 1WB7A 2CDYA 3EVKA 4YIOA 3TJTA 4F6EA 2ADPA 3BFRA 1ZSPA 1LUVA 3C3SA 1GN3A 1BT8A 1AR5A 3CEIA 3DC5A 1P7GA 1I0HA 2CE4A 3MDSA 4C7UA 1B06A 1JA8A
chains in the Genus database with same CATH superfamily
1EZVH 3IJ4A 4GT1A 5LHHA 3LUTB 1PNKA 3JSLA 2XAJA 4X1YA 4ASUG 1K8AW 4O4LB 1AI7A 2YC0A 2YI8A 3QO8A 1FKAO 1SF9A 2Q73A 1ZL8A 4MVMA 2K1EA 1XMQO 1H5WA 3HKCB 4PDVA 1OCZC 5IJ0B 1N4CA 4FFBA 2ITDC 4JI8B 1H8EG 4OGQB 1S77D 3UCSC 3QF7A 2Y48A 4O2BA 1LUWA 2CH7B 4KHPO 2G38A 1ORQC 5LA6B 1RFYA 1NTMH 4JYBA 1IXMA 4BW9A 4R7CA 1MMMA 3VOUA 1DK1A 4D7SA 5JJNB 1XNQB 5TISZ 1P49A 1QNMA 1TVKB 1WP8A 2ZXWB 5KHKA 2LGWA 4JPRA 3CWBH 5J9PC 2JS5A 2UXBO 1BHBA 5IY5C 2QKCA 3UO3A 4JI6O 2EZPA 3FAVA 2ZNJA 1JVMA 3ZHTA 3SYOA 3TXSA 4FZ0A 3MDSA 4UCTA 1R6TA 3GWKC 1HP8A 2CGNA 1KP2A 5KAFZ 1JFFA 3THOA 4WFEA 1BHAA 4UFZA 2LGQA 2Q6AA 3RYIB 4WFFA 5CA3A 2QWQB 4GZRB 4LF4B 1NI8A 2Q8VA 2A9HA 1Y4MA 4QGPA 5H2FZ 3K5NA 3SJCC 2QR4A 4DR7O 1AB3A 4LF7B 1WA8B 2DWEC 3KKYA 1E79G 1W0JG 3QG5A 2WA4A 1Q90D 3T1HO 1JR9A 4TV9A 3SJQC 3JARA 2GSMB 1SETA 3CCLV 3OTOB 3ZHVA 2C2AA 1H2NA 1L0LH 5E79Z 1Y74B 4X88A 3CCMV 3LDDA 4DR1B 1N36O 4FLTA 1THZA 2PYLA 4K0KO 4PA3A 5BXZA 2E75B 2P4VA 4AHCA 3W7WA 1ZAUA 4LF4O 4DV3B 2DYSC 4RO2A 4GUNA 5IYDO 3DSQA 1K9MW 2WLIB 1QQCA 4F6EA 4P9PA 1LR1A 3BFRA 3KCYA 1VQ7V 4IL6Z 1BT8A 3ABLB 5DEDA 4X20B 5K1XA 5CA1A 5KA6A 1YJWV 2BE3A 3RGBA 3M99B 3TETA 3OTOO 1BCCH 4DR3B 4I55A 4QE9A 3SPGA 4JTCB 2YEVA 2N05A 4XDJA 4X65O 2XAFA 1GM8A 1Q5OA 3BRCA 4RWUA 4A5UB 4FJCC 4E4EA 1F4NA 2X6CA 2QWPB 3SPJA 4UUJC 5LGTA 4LNUB 4H37A 5KX5B 1K33A 1AROP 1RPRA 2QM7A 4ICGA 4YHHB 2F4VO 2DOSA 1JOYA 4GX1A 3IC9A 2P7TC 3H1HH 5IYZB 4CH3A 2EIKC 4IHJB 4UCOA 1K73W 1RP3B 1P84F 2XOKG 3LSUA 3ABMB 1OCRB 2A06H 4H44B 5B5EZ 2IH3C 2KSDA 1X4TA 1I5YA 1FAFA 3STLC 5EZYA 3W7SA 3F7VC 2WLLB 3GWOA 3H01A 1FXVA 1IVSA 4PDRA 5HFLA 5C8YB 3CCSV 3L73H 4B3TB 1R3KC 3TK1A 1KYOF 4GX2A 1HW7A 1DTOA 3FB7C 5CA0B 1GK9A 1YSCA 1WNSA 1UPGA 3CEIA 3CYOA 4JI1B 4LF8O 1YI2V 4XDKA 3KZIZ 3ICXA 3ABKB 3ZN0A 4Q6GA 1AJNA 3G71V 1GRJA 3AK1A 2PUSA 5KHJA 4PDLA 5LGNA 3A0HZ 3OGCC 2Y69B 1KUQA 1IZ3A 4FLWA 4YJ2B 3ETDA 1DGSA 2UUAB 4PD4F 1AILA 4J7KA 2QWNB 1AJPA 1ROPA 2KG7A 1V9PA 3ZBHA 1BL8A 4ZBMA 1JX9A 5JH7A 3HKDB 2UUBB 3AG3B 2KKWA 3BA9A 3K59A 3CRQA 3ZMVA 3BCCH 2R9IA 2F93B 4LF5B 2OT5A 2HJFC 2ITCC 2ZE5A 4U3JB 1XMOO 3RYHA 1I5XA 1K34A 5B3SB 1KBHA 3B40A 1WPBA 3ASOB 5LHGA 3UT5A 2CGOA 2QWRB 4DV1B 4X1KB 2GUZA 1TUBB 2PY5A 3EXAA 1W0KG 2DN9A 5A2QN 1AR1B 4OX9O 4W4LA 3JD0A 5EBMC 4DV5B 1S3JA 3E89A 2VRZA 4LWSB 3KCXA 1H2KA 3K79A 2UUAO 4QNHB 5BR8B 1VF6A 1BSMA 5IE9A 3BHPA 3A0RA 1OV9A 1SQXH 1Y67A 4JYCA 5KMGB 3L72H 1VQ5V 2B9ZA 4MVUA 1WB7A 2F95B 1VQ6V 5JQGB 4TUYB 2ADPA 1PPJH 1ENVA 1VQNV 2ZKOA 2ZXWC 4TWKA 4MVOA 3ZHRA 4DK0A 1N34B 1J5EO 3B8MA 5H5NA 5LYJB 4JGSA 5LGUA 2F1MA 2CE4A 2DWDC 3CP1A 2FYUH 1IBLO 4GKJB 2RN9A 1NQTA 2AZ2A 2Y4TA 4WFAV 3I56V 1V55B 1EZJA 1F4MA 4LFAO 4D6TH 3H9VA 1SRYA 2MK3A 3HKCA 4BIUA 5KAIZ 4O4JB 1XOUA 5IJ0A 3P3PA 3B77A 2WLNA 3JALB 4FVMA 3OEHG 4QJFB 1E1RG 1JCHA 1OCOB 2BTOA 1F23A 1HNZO 2CH7A 4AQYO 1L1FA 3ZRSA 1XL6A 5D5QA 2GTAA 5CN0A 1SQGA 5LA6A 4X66O 3PN1A 5BZBA 5BMVB 1FOUA 1JMKC 2LP7A 1PNMA 1VEWA 1N33B 5IJ9A 1TVKA 4DV2O 2QJ1A 4B3SB 1VQLV 2Q5ZA 4JI4B 1YTFB 5EYPA 5CB4B 4DV4B 1RSOB 2CAZC 2JIZG 1WJZA 4KFMA 1VQ9V 1NVPD 1MABG 4BIZA 1SKVA 1J95A 3DC6A 3CRAA 2FTKA 5J2UA 1NT2B 4X89A 4MW3A 3CC4V 2KQXA 3QO5A 2E3CA 3DTUB 3N2GB 5LXTB 4DUZB 4FLZA 4DR5B 4O2AA 1GMGA 1VF5B 2Q0AA 3CE2A 4DR6O 3JAWB 3PJSK 1E1QG 1Q6IA 4IIJA 4RQEA 3J80N 4J7JA 2PZSA 4NTWA 4DR4B 4FIPC 3K0DA 3RYIA 2X7RB 4BR6A 2UXDB 3STZC 2P5OA 3T1YO 1I94O 2XAQA 3CD6V 3EHBB 1G1XB 3WG7B 2X6AA 3ABLC 2XAHA 2A79B 1QBZA 1Y66A 4TOIA 4J9YB 2VQFB 3ZS8C 3OE7G 1VARA 4CZZA 1M1KW 1WA8A 1Q3EA 2OWOA 1IBMO 4LFBB 4I5SA 1AR4A 3AEIA 4X62B 4CH4A 2JVDA 1N0NA 5FPRA 3K08A 1Z5WA 1L0NH 2UXCB 1Y74A 1UJWB 3LNNA 1XDCA 3BEHA 4O4IB 3JAMN 1PD3A 3OW2U 3OEEG 3J81N 4NXMB 5C93A 1MSDA 1N32B 3BVOA 3ZMUA 3JATB 5FLXN 3N27A 1PM9A 1MNGA 2WLIA 4ZKIA 4ABMA 3TXQA 1NH2D 2R70A 3ABMC 1OCRC 2JK5C 3BAAA 3CJHB 1Y76B 2R9RB 4X20A 2RMKB 1VQPV 4I0XB 3OD4A 4L8JA 2E5LB 4PV1B 2ZE7A 3CRMA 1M90W 1SQBH 2VWKA 4OPAA 1Z5VA 5LP6B 1I0HA 4I9WA 2Y0IA 5LOVB 3SDLA 4LF6B 3K9AA 2Y4UA 3HKBB 4OXSA 1B3QA 1S76D 4JTDB 3O65A 2Q0OC 1YEWA 1OJHA 4LNUA 4YY3B 1K4DC 3QTCA 4XBFA 3E8HA 4I4TB 2RDCA 4JI8O 1CP9A 3K06A 1PL0A 4FLUA 1F7YA 3WB1A 2Q9LA 4JZ2A 4NVPA 4Z1VA 2YS8A 3ABKC 1G6UA 1SQVH 2F23A 5IYZA 4YJ3B 2YIBA 3CMEV 2YIDA 4X64B 4IHJA 2Y69C 4I50B 3WU2Z 3E22B 2HKOA 1HNWB 2RJZA 3DXRA 3MHHC 2DJVA 1XNQO 1JJOA 2BSKB 2A7WA 4CH6A 2HHHB 4UVAA 3BA8A 3AG4B 4MW8A 4CH5A 1H8HG 3AG3C 3SPHA 1XHXA 3FYIB 2M7WA 1R73A 5LHIA 4YY3O 4FPPA 2WLLA 2XTAA 4JI3B 5L3DA 3CCQV 3BABA 5B3SC 5IT9N 4DW1A 3W7UA 3ASOC 5C8YA 1EN4A 3E8BA 1V54B 5CA0A 4JYAB 3DGEA 3GVMA 2M6YA 3JD1A 2E76B 1VF7A 1SZTA 3G67A 4JI2B 3K5OA 1S72V 1GAXA 3VQVA 4QE7A 1LNQA 2AZ0A 3B2EE 4KUMA 5LBQA 2ZE6A 4YJ2A 2RQ6A 3H1LH 3OR7C 1XREA 3SJAC 3MAQA 4DRXB 1D5AA 2OCCB 4B3RB 5AG2A 4UVCA 4B7KA 1PKXA 1MSWD 1SQQH 1FJGB 4DO2A 1ZL8B 3FFQA 3JASB 3HKDA 3E83A 4LF7O 2PI5A 2V1DA 3K03A 2PGGA 2DYRB 3OAAG 1MZFA 5A9GA 2ILMA 2QM4A 4JF3A 4JYAO 4QPKA 1PL4A 1V55C 4JTAB 1CXZB 4U3JA 3HR0A 4PI2A 1FYJA 2NN4A 3LDEA 4BW5A 3VQXA 3ZIAG 4JI7B 2EULA 3OUSA 3RYCB 4CS3A 2ZM6B 4WBNA 3D3IA 5GONB 3B8NA 4EB6B 3CSXA 1M5IA 1TUBA 4DR1O 1TUEB 3IC7A 2MW2B 4GCZA 4G28B 2PI4A 2HVJC 3BY6A 5JJJB 4B3MB 2JJ1G 3UKMA 1OCOC 4UXNA 2ADQB 4JZGA 5B66Z 3UO2A 2LQTA 4DV3O 2KB1A 3G6EV 1H38A 2CTWA 2PYJA 2PF4E 5H6QA 4JYYA 4F4LA 2AGAA 1VQKV 1FJGO 1FXKB 4DK1A 3ZHSA 4UB6Z 3OR6C 5KMGA 1AI4A 1KQSU 5B1AB 1AI6A 3FD9A 1VQ8V 4TUYA 1NU1H 5L3CA 1GKFA 3SGIA 4I7ZB 1JQ0A 3HKEB 2EJRA 3JAKB 5ITZA 1YHQV 2E74B 2YUAA 4JI5B 2F43G 5LYJA 4DR3O 3FB6C 4GKKB 2V4DA 4IGGA 1T5EA 1K7DA 5JCOC 1GM7A 4FM1A 5EIBC 3P30A 4J41A 4B3MO 3F5WC 3ZHQA 1JFFB 3ZJZA 4O4JA 1WLEA 1AP6A 4YHHO 1NR1A 5L3FA 2WLMA 2LFSA 3CB2A 3G4SV 3JALA 3L74H 1XI1A 1URFA 2QA4V 2GHYA 3ZMZA 1XILA 4JAVA 2Z5UA 5EC2C 3RVYA 2NNUA 2Q7GA 2QGNA 1SERA 3WFVA 1YXBA 1DF4A 2VQEB 2XHBA 3FKSG 4RUEA 5BMVA 1KC8W 3SYCA 4OPHA 4RUFA 5JJEB 3WG7C 2P67A 5H9CA 1GN2A 2WPDG 5E1AC 4TV8B 2JRIA 1U97A 4CC5A 4MVQA 1MG1A 3RFRA 2GBOA 5CB4A 1RSOA 5EBLC 3ZN1A 4FZ1A 5LMUB 3IAYA 4J42A 2Q4PA 1FFXB 2ZIMA 5F2VO 3AG1B 1YVWA 2IBZH 3IGAC 4P9OA 2XUMA 2OCHA 2ZINA 2HG5C 1GO3F 2IH1C 1KP3A 3SYPA 2AHYA 1GTOA 1AI5A 2HFEC 2OIGA 4D7TA 4LP8A 5JCOA 4B3TO 2CTRA 2JS3A 5LXTA 2P6JA 3T2MA 5D5PA 3FX7A 4WF9V 5L3BA 3CHXA 3RBZA 4LF9B 3U11A 3WB0A 1Q6HA 3JAWA 4U7OA 1SA0A 3AK3A 4JI1O 4DR2B 1R1BA 3CMAV 1XEQA 3E86A 4PHZA 4R50A 3LNMB 3D8CA 3OMNB 4YIOA 3NR7A 1XNRB 5CA1B 5JVDA 2W6IG 2PTMA 2L35A 4FK5C 1IJGA 4R6ZA 3P3NA 4LFCB 2WLHA 5L3EA 2EILB 5IWAB 1DF5A 1NZ6A 4DV0B 3L75H 3O9OA 1ZTEA 2UUBO 1VQOV 3G6BA 2AXTZ 3CCJV 3ZMSA 3CS5A 2YDEA 3APOA 4WFGA 5BY1A 4LF5O 2UXNA 4LR3A 4ZHQB 1XHZA 2P22C 2ZE8A 3ZX6A 5LP6C 2B1IA 1N8RW 3LSSA 4GX0A 4DUYB 3F5TA 4K8ZA 4JI0B 4J7ZA 3H1IH 4DR2O 5FNVB 4DV1O 4LC1A 4J10A 4O4LA 2OTLV 3RWRD 4NTYA 1IBKB 5LMNB 1Z2GA 1DLBA 4LH7A 4DV5O 1IX9A 3ETEA 1JPXA 1VMGA 3RW0A 5BR8O 1H2SB 3OM3B 5IWAO 4FFKA 1F51A 3JATA 4JV5B 4DV0O 1SC5B 2DW4A 2W0FC 2YXHA 2EBOA 3TGUH 1EBOA 2BTQB 3ZCCA 2N74A 1K4CC 4HBNA 3CXHF 1AVMA 1Y76A 4ZOLB 3AG4C 4UCVA 1HR0B 1N34O 4IYHA 4I0XA 1BS3A 1TGOA 2CUGA 2NR5A 1S5HC 2NLJC 3JD2A 2X0LA 3T1CA 5KLVH 3FB8C 4UVBA 3N2KB 4DXWA 4GKJO 2YIBD 2FB5A 5LP6A 2IJKA 3L70H 2JGUA 5LOVA 3M7MX 1IBKO 5LMNO 4NXNB 1SESA 4G2KA 3Q4HB 3HKBA 4NTXA 4HYOA 3RYFB 1V54C 4ZIBA 2ZR3A 2ZQMA 1HWYA 1KU9A 4MVZA 4O4HB 2YSUB 4I4TA 2QE7G 1US6A 1QVFU 2ATKC 4C7UA 2Q68A 2QEXV 1S0VA 2ZDIC 1CEZA 1R3IC 4DV6B 4NR1A 5J2TB 4I50A 2LJ2A 3K57A 2YIAA 3E22A 4K35A 1N33O 2UU9B 5B1BB 1Q7YW 1K92A 1Y6XA 2OCCC 2LW7A 4B3SO 4TT3G 4JI4O 3VQYA 1X59A 3S3WA 4BWAA 5LL6Y 3WB2A 4DV4O 3J7AU 3CRRA 2DYRC 2Z0AA 2Q69A 1KMIZ 3ZRXA 4N23A 2LO1A 2W6JG 4H0LB 2QDOA 4BIOA 3AK2A 3M8AA 1O9GA 4DUZO 4FM0A 3OTFA 4DR5O 3B09A 2JJ2G 2ARHA 4MVRA 1BMFG 1K5QA 1OZ0A 1YF2A 4DW0A 1COWG 4Z2WA 3CRCA 3K04A 4PJ0Z 4P30A 3JCUZ 2B5UA 3ASNB 4KHPB 2ZDIA 1R3JC 2YI9A 1I08A 4DR4O 2H3OA 4J11A 3S3XA 4QPJA 1SZXA 3K3WA 4IT5A 3HPLC 5EBWC 2UXDO 1FXKC 3ZRWB 3D36C 4ZI7B 1WAZA 2LFRA 5B1AC 5GTIZ 4MTFA 1GN3A 4DRXA 1FPOA 2VQFO 2OTJV 2JGDB 3K5LA 2K9PA 5FPOA 3SPCA 3JASA 4Z1MG 2BOCC 2UXBB 4NKGB 3T4DA 1QLNA 1B06A 4KXRA 2QTSA 4JI6B 4LFBO 3I5DA 2QWOB 2CTPA 4X62O 3JSNA 3CC2V 4H13B 1EFRG 1G4YB 1RPOA 1W59A 4NYKA 2O57A 4LCUC 3RYCA 2UXCO 4HNAB 5GONA 4EB6A 1QR8A 2Y0PA 1KD1W 2P06A 4CBCA 4NXMO 4JAAA 2EINB 4X1IB 5IJ9B 2BCCH 5KX5A 3TCUA 1N32O 4UV9A 3BPZA 1IDSA 3E8FA 5H6RA 1Q43A 5EYPB 4EFBA 1Q81W 1K97A 1VQMV 3ABUA 5IYBO 1FXKA 3D36A 1EN5A 4N21A 4FLYA 1I7FA 5J2UB 2Q7EA 5EC1C 1M56B 2QSAA 3GB7C 2IU0A 1GN4A 4PA4A 3HKEA 4DR7B 3JAKA 1NTZH 2XAGA 3AG2B 3AG1C 1XBLA 3APQA 5KHIA 2E5LO 2GDSA 4O2AB 3T1HB 4F6RB 1FXHA 1MA1A 2HLDG 1PV0A 4LF6O 3ZMTA 1FD9A 1WN7A 2WWWA 3ETGA 1RM1B 4IIJB 1BZKA 2QTOA 1S5LZ 2ETNA 1S5JA 2OIEA 1IURA 4FLVA 1YTFD 2L6LA 4TQDA 4LH6A 1N36B 2HJDA 4MSWC 4EEQA 4K0KB 1NKDA 4UCRA 4AILC 4H33A 3HB3B 1SQPH 2DE0X 3E8GA 3K0GA 4YIPA 4X64O 1HDJA 2ZT9B 5EIBD 2VS0A 3K5MA 2XT9A 1HNWO 1GN6A 3ABTA 4YXWG 4CS2A 4FM2A 2EILC 3A8TA 1YJ9V 4R8CA 3FYEB 2HHHO 4TV8A 1ZUQA 3RN4A 2EIMB 4CS4A 2UUCB 5K1PA 1CPYA 5HFMA 4WFHA 5KA5A 1FFXA 2CTQA 1HNXB 2QKAA 1G8MA 1M57B 1OCCB 4X1YB 4X65B 1VIBA 2ODMA 1XUQA 4JI3O 5CBFA 3X2QB 4GX5A 3W7TA 1YCIA 3SR2C 3U10A 4FFBB 2ZD9A 1BGYH 4JAUA 4MTOA 3SPIA 1YIJV 2P4KA 2HR3A 2F4VB 4K3AA 4JI2O 4O2BB 2ZCEA 2FKXA 1OHHG 2FMLA 1Q82W 1ZLZA 5KUKA 1K3EA 3LDCA 1QLEB 2Q7HA 4X1KA 2HEPA 2ZR2A 2BOBC 1N0JA 2YXLA 2RCVA 2P90A 4GLXA 2EIJB 2UUCO 1EN6A 4LWSA 3CCEV 4DYLA 2H94A 1BQZA 3NXSA 4E2LA 1HNXO 3TJTA 4B3RO 4B08A 4LBEC 1A32A 2QM8A 1ZSPA 1LUVA 4K8XA 1AR5A 2Q67A 3CCRV 2A3QA 1WPXA 4L87A 5JQGA 1U96A 2OYQA 3I55V 4ZHQA 3FAVB 1JJ2U 3ZRVA 4QIWF 2FL4A 2IJIA 2UXXA 2D2CB 4JI7O 4EKWA 2ZM6O 1D2DA 1OCZB 3E35A 3C3TA 5FNVA 1WP7A 3JD3A 4KL1A 3CCUV 4U7NA 4RQFA 1W2BU 4LF8B 3A2FA 4EFEA 2W0XA 3DXRB 1NVPB 3LSQA 1XQ8A 3OMAB 3T4ZA 3MHSC 2GTSA 1ZX3A 4MVSA 4KP4A 3JCZA 3W7XA 5B1BC 2EX3A 2BTQA 2YICA 3KG2A 1VQ4V 3QVNA 4TSFG 4UV8A 4ZOLA 1XL4A 2X6BA 4TQFA 4JI5O 4PA9A 2XNDG 1NBMG 5IY5B 3CC7V 4WCEV 2EJ7A 3OFNG 4TV9B 3N2KA 4GKKO 3JARB 1XMOB 5L3GA 3JYCA 4PELA 4MTGA 4NB5A 4MTXA 1QR9A 2IJJA 2IJHA 3K9SA 3Q4HA 4IYIA 1GM9A 3RYFA 2GV9A 2WLKA 3IFXA 1VF6C 2IW5A 1AJQA 1B6QA 2CK3G 2CDYA 3EVKA 4O4HA 3CX5F 5B1OA 1YDXA 4OX9B 2B1GA 5FL7G 2XASA 4I9QA 3SYQA 3UQ8A 1R6KA 3N2GA 1MZEA 2AHZA 1MOFA 2Z3YA 3ASNC 3DC5A 1P7GA 1Q8IA 2WAMA 4FLXA 2VQEO 4GYCB 5J2TA 2VWJA 3B4SA 1YJNV 2JEUA 4UCSA 2R72A 4MT8A 5EK0A 1ZWIC 1Q86W 3FB5C 5CBGA 1J5EB 3VBBA 1D5NA 5LMUO 4I55B 1TA8A 2JEXA 5CMUA 1M4UA 4FMTA 1Q6UA 1QHTA 2YEVB 4WBNB 1IBLB 3VQWA 2DMXA 1PNLA 1BQ0A 4B7EA 4U3FH 4AI8A 2HP8A 1H2LA 1R6NA 2RNBA 4LFAB 1M93A 4HAMA 5GTHZ 1NH2B 4CC6A 1NR7A 1SQFA 1KKCA 4RAIA 5GW7A 4P2ZA 2QKSA 4UCUA 3ZHUA 3C90A 5CBHA 4LF9O 3RT3C 4JASA 2WA3A 1IXBA 1R3LC 5IYCO 2EINC 3UM7A 1HNZB 2DYSB 2LW1A 4AQYB 4O4IA 2EZOA 1XNRO 4X66B 5ITZB 4LFCO 3ZRWA 4ZI7A 1NS1A 1PP9H 1YITV 3AG7A 4DV2B 3MD0A 1KKDA 1M56C 3OMIB 3OT7A 3H1KH 5KUMA 1K5SA 1WB8A 1JNBA 2JGDA 3L9DA 1TAEA 3AG2C 5EZYB 3RVZA 1B04A 4PDMA 2HVKC 2ZNIA 3CJHA 4W4KA 3OGIB 2F66C 1SS3A 5KHGA 4DUYO 4MS2A 3F7YC 1FFTB 1RM1C 4JI0O 3K58A 4X9QA 4HNAA 3ML0A 3H1JH 1KB9F 3D3QA 3E2EA 4UB8Z 4DR6B 5DN6G 3R66A 1EM1A 1VP7A 1QU7A 1H2GA 1GH6A 4X1IA 2A0LA 4PI0A 2YXYA 2WLJA 4DV7B 2D3OW 2WSSG 4PA7A 2EIKB 3SYAA 4JV5O 1H2MA 3T1YB 1I94B 1P4RA 4BAYA 2DQ3A 1AP5A 2IM9A 2KG7B 2V7QG 4J80A 4YJ3A 3QNEA 2N04A 5JH7B 4XDLA 1HR0O 2EIMC 3R65A 2R9AA 4HZ3A 2DQ0A 5DECA 1YZBA 3OUFA 2H8PC 2BSKA 1M57C 3L71H 1IBMB 1OCCC 2AW9A 5B1NA 1QCEA 3G80A 3RYHB 3EFFK 1FS0G 5KHHA 4F6RA 3X2QC 1SA0B 5DM6V 4NXNO 3SJBC 3UT5B 3A0BZ 3KDRA 1KECA 2JDIG 4X8AA 2GUZB 3QO7A 1BE3H 4DV7O 5JVDB 3P32A 1QVGU 4PA6A 5IDJA 4WFBV 1L8DA 1NTKH 3ZEDA 1XMQB 4Q20A 4J9ZB 1QLEC 3CPWU 1O9HA 1NJIW 4DV6O 3U0ZA 3C3SA 1P7BA 4G27B 3CXCU 2EIJC 3JD4A 2ZIOA 5JWPA 2UU9O 1M9NA 3CCVV 3ETQA 1UFIA 2IU3A 1JA8A
chains in the Genus database with same CATH topology
1AP6A 1ZTEA 1XREA 3AK1A 4BR6A 4YIPA 4X9QA 5AG2A 3C3TA 1GN6A 1XILA 1EM1A 4E4EA 4JZ2A 1D5NA 1VARA 1ZUQA 3RN4A 5A9GA 1PL4A 1AR4A 1GN2A 2QKAA 3IC9A 1AP5A 1N0NA 1KKCA 1XUQA 3KKYA 1IDSA 1IX9A 1VEWA 1XDCA 1LUWA 1JR9A 4FFKA 1IXBA 2ADQB 3AK2A 4JZGA 1EN5A 3QVNA 3LSUA 2AW9A 2P4KA 4JYYA 1MSDA 1MMMA 1GN4A 1QNMA 3DC6A 1ZLZA 1AVMA 3KDRA 1PM9A 1MNGA 2GDSA 1EN4A 1N0JA 1BS3A 2RCVA 3K9SA 1BSMA 3AK3A 1MA1A 1I08A 3OT7A 1EN6A 1SZXA 4GUNA 1Y67A 1WB8A 2QKCA 1WB7A 2CDYA 3EVKA 4YIOA 3TJTA 4F6EA 2ADPA 3BFRA 1ZSPA 1LUVA 3C3SA 1GN3A 1BT8A 1AR5A 3CEIA 3DC5A 1P7GA 1I0HA 2CE4A 3MDSA 4C7UA 1B06A 1JA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AP6 A;  1ZTE A;  1XRE A;  3AK1 A;  4BR6 A;  4YIP A;  4X9Q A;  5AG2 A;  3C3T A;  1GN6 A;  1XIL A;  1EM1 A;  4E4E A;  4JZ2 A;  1D5N A;  1VAR A;  1ZUQ A;  3RN4 A;  5A9G A;  1PL4 A;  1AR4 A;  1GN2 A;  2QKA A;  3IC9 A;  1AP5 A;  1N0N A;  1KKC A;  1XUQ A;  3KKY A;  1IDS A;  1IX9 A;  1VEW A;  1XDC A;  1LUW A;  1JR9 A;  4FFK A;  1IXB A;  2ADQ B;  3AK2 A;  4JZG A;  1EN5 A;  3QVN A;  3LSU A;  2AW9 A;  2P4K A;  4JYY A;  1MSD A;  1MMM A;  1GN4 A;  1QNM A;  3DC6 A;  1ZLZ A;  1AVM A;  1PM9 A;  1MNG A;  2GDS A;  1EN4 A;  1N0J A;  1BS3 A;  2RCV A;  3K9S A;  1BSM A;  3AK3 A;  1MA1 A;  1I08 A;  3OT7 A;  1EN6 A;  1SZX A;  4GUN A;  1Y67 A;  1WB8 A;  2QKC A;  1WB7 A;  2CDY A;  3EVK A;  4YIO A;  3TJT A;  4F6E A;  2ADP A;  3BFR A;  1ZSP A;  1LUV A;  3C3S A;  1GN3 A;  1BT8 A;  1AR5 A;  3CEI A;  3DC5 A;  1P7G A;  1I0H A;  2CE4 A;  3MDS A;  4C7U A;  1B06 A;  1JA8 A; 
#chains in the Genus database with same CATH topology
 1EZV H;  3IJ4 A;  4GT1 A;  5LHH A;  3LUT B;  1PNK A;  3JSL A;  2XAJ A;  4X1Y A;  4ASU G;  1K8A W;  4O4L B;  1AI7 A;  2YC0 A;  2YI8 A;  3QO8 A;  1FKA O;  1SF9 A;  2Q73 A;  1ZL8 A;  4MVM A;  2K1E A;  1XMQ O;  1H5W A;  3HKC B;  4PDV A;  1OCZ C;  5IJ0 B;  1N4C A;  4FFB A;  2ITD C;  4JI8 B;  1H8E G;  4OGQ B;  1S77 D;  3UCS C;  3QF7 A;  2Y48 A;  4O2B A;  1LUW A;  2CH7 B;  4KHP O;  2G38 A;  1ORQ C;  5LA6 B;  1RFY A;  1NTM H;  4JYB A;  1IXM A;  4BW9 A;  4R7C A;  1MMM A;  3VOU A;  1DK1 A;  4D7S A;  5JJN B;  1XNQ B;  5TIS Z;  1P49 A;  1QNM A;  1TVK B;  1WP8 A;  2ZXW B;  5KHK A;  2LGW A;  4JPR A;  3CWB H;  5J9P C;  2JS5 A;  2UXB O;  1BHB A;  5IY5 C;  2QKC A;  3UO3 A;  4JI6 O;  2EZP A;  3FAV A;  2ZNJ A;  1JVM A;  3ZHT A;  3SYO A;  3TXS A;  4FZ0 A;  3MDS A;  4UCT A;  1R6T A;  3GWK C;  1HP8 A;  2CGN A;  1KP2 A;  5KAF Z;  1JFF A;  3THO A;  4WFE A;  1BHA A;  4UFZ A;  2LGQ A;  2Q6A A;  3RYI B;  4WFF A;  5CA3 A;  2QWQ B;  4GZR B;  4LF4 B;  1NI8 A;  2Q8V A;  2A9H A;  1Y4M A;  4QGP A;  5H2F Z;  3K5N A;  3SJC C;  2QR4 A;  4DR7 O;  1AB3 A;  4LF7 B;  1WA8 B;  2DWE C;  3KKY A;  1E79 G;  1W0J G;  3QG5 A;  2WA4 A;  1Q90 D;  3T1H O;  1JR9 A;  4TV9 A;  3SJQ C;  3JAR A;  2GSM B;  1SET A;  3CCL V;  3OTO B;  3ZHV A;  2C2A A;  1H2N A;  1L0L H;  5E79 Z;  1Y74 B;  4X88 A;  3CCM V;  3LDD A;  4DR1 B;  1N36 O;  4FLT A;  1THZ A;  2PYL A;  4K0K O;  4PA3 A;  5BXZ A;  2E75 B;  2P4V A;  4AHC A;  3W7W A;  1ZAU A;  4LF4 O;  4DV3 B;  2DYS C;  4RO2 A;  4GUN A;  5IYD O;  3DSQ A;  1K9M W;  2WLI B;  1QQC A;  4F6E A;  4P9P A;  1LR1 A;  3BFR A;  3KCY A;  1VQ7 V;  4IL6 Z;  1BT8 A;  3ABL B;  5DED A;  4X20 B;  5K1X A;  5CA1 A;  5KA6 A;  1YJW V;  2BE3 A;  3RGB A;  3M99 B;  3TET A;  3OTO O;  1BCC H;  4DR3 B;  4I55 A;  4QE9 A;  3SPG A;  4JTC B;  2YEV A;  2N05 A;  4XDJ A;  4X65 O;  2XAF A;  1GM8 A;  1Q5O A;  3BRC A;  4RWU A;  4A5U B;  4FJC C;  4E4E A;  1F4N A;  2X6C A;  2QWP B;  3SPJ A;  4UUJ C;  5LGT A;  4LNU B;  4H37 A;  5KX5 B;  1K33 A;  1ARO P;  1RPR A;  2QM7 A;  4ICG A;  4YHH B;  2F4V O;  2DOS A;  1JOY A;  4GX1 A;  3IC9 A;  2P7T C;  3H1H H;  5IYZ B;  4CH3 A;  2EIK C;  4IHJ B;  4UCO A;  1K73 W;  1RP3 B;  1P84 F;  2XOK G;  3LSU A;  3ABM B;  1OCR B;  2A06 H;  4H44 B;  5B5E Z;  2IH3 C;  2KSD A;  1X4T A;  1I5Y A;  1FAF A;  3STL C;  5EZY A;  3W7S A;  3F7V C;  2WLL B;  3GWO A;  3H01 A;  1FXV A;  1IVS A;  4PDR A;  5HFL A;  5C8Y B;  3CCS V;  3L73 H;  4B3T B;  1R3K C;  3TK1 A;  1KYO F;  4GX2 A;  1HW7 A;  1DTO A;  3FB7 C;  5CA0 B;  1GK9 A;  1YSC A;  1WNS A;  1UPG A;  3CEI A;  3CYO A;  4JI1 B;  4LF8 O;  1YI2 V;  4XDK A;  3KZI Z;  3ICX A;  3ABK B;  3ZN0 A;  4Q6G A;  1AJN A;  3G71 V;  1GRJ A;  3AK1 A;  2PUS A;  5KHJ A;  4PDL A;  5LGN A;  3A0H Z;  3OGC C;  2Y69 B;  1KUQ A;  1IZ3 A;  4FLW A;  4YJ2 B;  3ETD A;  1DGS A;  2UUA B;  4PD4 F;  1AIL A;  4J7K A;  2QWN B;  1AJP A;  1ROP A;  2KG7 A;  1V9P A;  3ZBH A;  1BL8 A;  4ZBM A;  1JX9 A;  5JH7 A;  3HKD B;  2UUB B;  3AG3 B;  2KKW A;  3BA9 A;  3K59 A;  3CRQ A;  3ZMV A;  3BCC H;  2R9I A;  2F93 B;  4LF5 B;  2OT5 A;  2HJF C;  2ITC C;  2ZE5 A;  4U3J B;  1XMO O;  3RYH A;  1I5X A;  1K34 A;  5B3S B;  1KBH A;  3B40 A;  1WPB A;  3ASO B;  5LHG A;  3UT5 A;  2CGO A;  2QWR B;  4DV1 B;  4X1K B;  2GUZ A;  1TUB B;  2PY5 A;  3EXA A;  1W0K G;  2DN9 A;  5A2Q N;  1AR1 B;  4OX9 O;  4W4L A;  3JD0 A;  5EBM C;  4DV5 B;  1S3J A;  3E89 A;  2VRZ A;  4LWS B;  3KCX A;  1H2K A;  3K79 A;  2UUA O;  4QNH B;  5BR8 B;  1VF6 A;  1BSM A;  5IE9 A;  3BHP A;  3A0R A;  1OV9 A;  1SQX H;  1Y67 A;  4JYC A;  5KMG B;  3L72 H;  1VQ5 V;  2B9Z A;  4MVU A;  1WB7 A;  2F95 B;  1VQ6 V;  5JQG B;  4TUY B;  2ADP A;  1PPJ H;  1ENV A;  1VQN V;  2ZKO A;  2ZXW C;  4TWK A;  4MVO A;  3ZHR A;  4DK0 A;  1N34 B;  1J5E O;  3B8M A;  5H5N A;  5LYJ B;  4JGS A;  5LGU A;  2F1M A;  2CE4 A;  2DWD C;  3CP1 A;  2FYU H;  1IBL O;  4GKJ B;  2RN9 A;  1NQT A;  2AZ2 A;  2Y4T A;  4WFA V;  3I56 V;  1V55 B;  1EZJ A;  1F4M A;  4LFA O;  4D6T H;  3H9V A;  1SRY A;  2MK3 A;  3HKC A;  4BIU A;  5KAI Z;  4O4J B;  1XOU A;  5IJ0 A;  3P3P A;  3B77 A;  2WLN A;  3JAL B;  4FVM A;  3OEH G;  4QJF B;  1E1R G;  1JCH A;  1OCO B;  2BTO A;  1F23 A;  1HNZ O;  2CH7 A;  4AQY O;  1L1F A;  3ZRS A;  1XL6 A;  5D5Q A;  2GTA A;  5CN0 A;  1SQG A;  5LA6 A;  4X66 O;  3PN1 A;  5BZB A;  5BMV B;  1FOU A;  1JMK C;  2LP7 A;  1PNM A;  1VEW A;  1N33 B;  5IJ9 A;  1TVK A;  4DV2 O;  2QJ1 A;  4B3S B;  1VQL V;  2Q5Z A;  4JI4 B;  1YTF B;  5EYP A;  5CB4 B;  4DV4 B;  1RSO B;  2CAZ C;  2JIZ G;  1WJZ A;  4KFM A;  1VQ9 V;  1NVP D;  1MAB G;  4BIZ A;  1SKV A;  1J95 A;  3DC6 A;  3CRA A;  2FTK A;  5J2U A;  1NT2 B;  4X89 A;  4MW3 A;  3CC4 V;  2KQX A;  3QO5 A;  2E3C A;  3DTU B;  3N2G B;  5LXT B;  4DUZ B;  4FLZ A;  4DR5 B;  4O2A A;  1GMG A;  1VF5 B;  2Q0A A;  3CE2 A;  4DR6 O;  3JAW B;  3PJS K;  1E1Q G;  1Q6I A;  4IIJ A;  4RQE A;  3J80 N;  4J7J A;  2PZS A;  4NTW A;  4DR4 B;  4FIP C;  3K0D A;  3RYI A;  2X7R B;  4BR6 A;  2UXD B;  3STZ C;  2P5O A;  3T1Y O;  1I94 O;  2XAQ A;  3CD6 V;  3EHB B;  1G1X B;  3WG7 B;  2X6A A;  3ABL C;  2XAH A;  2A79 B;  1QBZ A;  1Y66 A;  4TOI A;  4J9Y B;  2VQF B;  3ZS8 C;  3OE7 G;  1VAR A;  4CZZ A;  1M1K W;  1WA8 A;  1Q3E A;  2OWO A;  1IBM O;  4LFB B;  4I5S A;  1AR4 A;  3AEI A;  4X62 B;  4CH4 A;  2JVD A;  1N0N A;  5FPR A;  3K08 A;  1Z5W A;  1L0N H;  2UXC B;  1Y74 A;  1UJW B;  3LNN A;  1XDC A;  3BEH A;  4O4I B;  3JAM N;  1PD3 A;  3OW2 U;  3OEE G;  3J81 N;  4NXM B;  5C93 A;  1MSD A;  1N32 B;  3BVO A;  3ZMU A;  3JAT B;  5FLX N;  3N27 A;  1PM9 A;  1MNG A;  2WLI A;  4ZKI A;  4ABM A;  3TXQ A;  1NH2 D;  2R70 A;  3ABM C;  1OCR C;  2JK5 C;  3BAA A;  3CJH B;  1Y76 B;  2R9R B;  4X20 A;  2RMK B;  1VQP V;  4I0X B;  3OD4 A;  4L8J A;  2E5L B;  4PV1 B;  2ZE7 A;  3CRM A;  1M90 W;  1SQB H;  2VWK A;  4OPA A;  1Z5V A;  5LP6 B;  1I0H A;  4I9W A;  2Y0I A;  5LOV B;  3SDL A;  4LF6 B;  3K9A A;  2Y4U A;  3HKB B;  4OXS A;  1B3Q A;  1S76 D;  4JTD B;  3O65 A;  2Q0O C;  1YEW A;  1OJH A;  4LNU A;  4YY3 B;  1K4D C;  3QTC A;  4XBF A;  3E8H A;  4I4T B;  2RDC A;  4JI8 O;  1CP9 A;  3K06 A;  1PL0 A;  4FLU A;  1F7Y A;  3WB1 A;  2Q9L A;  4JZ2 A;  4NVP A;  4Z1V A;  2YS8 A;  3ABK C;  1G6U A;  1SQV H;  2F23 A;  5IYZ A;  4YJ3 B;  2YIB A;  3CME V;  2YID A;  4X64 B;  4IHJ A;  2Y69 C;  4I50 B;  3WU2 Z;  3E22 B;  2HKO A;  1HNW B;  2RJZ A;  3DXR A;  3MHH C;  2DJV A;  1XNQ O;  1JJO A;  2BSK B;  2A7W A;  4CH6 A;  2HHH B;  4UVA A;  3BA8 A;  3AG4 B;  4MW8 A;  4CH5 A;  1H8H G;  3AG3 C;  3SPH A;  1XHX A;  3FYI B;  2M7W A;  1R73 A;  5LHI A;  4YY3 O;  4FPP A;  2WLL A;  2XTA A;  4JI3 B;  5L3D A;  3CCQ V;  3BAB A;  5B3S C;  5IT9 N;  4DW1 A;  3W7U A;  3ASO C;  5C8Y A;  1EN4 A;  3E8B A;  1V54 B;  5CA0 A;  4JYA B;  3DGE A;  3GVM A;  2M6Y A;  3JD1 A;  2E76 B;  1VF7 A;  1SZT A;  3G67 A;  4JI2 B;  3K5O A;  1S72 V;  1GAX A;  3VQV A;  4QE7 A;  1LNQ A;  2AZ0 A;  3B2E E;  4KUM A;  5LBQ A;  2ZE6 A;  4YJ2 A;  2RQ6 A;  3H1L H;  3OR7 C;  1XRE A;  3SJA C;  3MAQ A;  4DRX B;  1D5A A;  2OCC B;  4B3R B;  5AG2 A;  4UVC A;  4B7K A;  1PKX A;  1MSW D;  1SQQ H;  1FJG B;  4DO2 A;  1ZL8 B;  3FFQ A;  3JAS B;  3HKD A;  3E83 A;  4LF7 O;  2PI5 A;  2V1D A;  3K03 A;  2PGG A;  2DYR B;  3OAA G;  1MZF A;  5A9G A;  2ILM A;  2QM4 A;  4JF3 A;  4JYA O;  4QPK A;  1PL4 A;  1V55 C;  4JTA B;  1CXZ B;  4U3J A;  3HR0 A;  4PI2 A;  1FYJ A;  2NN4 A;  3LDE A;  4BW5 A;  3VQX A;  3ZIA G;  4JI7 B;  2EUL A;  3OUS A;  3RYC B;  4CS3 A;  2ZM6 B;  4WBN A;  3D3I A;  5GON B;  3B8N A;  4EB6 B;  3CSX A;  1M5I A;  1TUB A;  4DR1 O;  1TUE B;  3IC7 A;  2MW2 B;  4GCZ A;  4G28 B;  2PI4 A;  2HVJ C;  3BY6 A;  5JJJ B;  4B3M B;  2JJ1 G;  3UKM A;  1OCO C;  4UXN A;  2ADQ B;  4JZG A;  5B66 Z;  3UO2 A;  2LQT A;  4DV3 O;  2KB1 A;  3G6E V;  1H38 A;  2CTW A;  2PYJ A;  2PF4 E;  5H6Q A;  4JYY A;  4F4L A;  2AGA A;  1VQK V;  1FJG O;  1FXK B;  4DK1 A;  3ZHS A;  4UB6 Z;  3OR6 C;  5KMG A;  1AI4 A;  1KQS U;  5B1A B;  1AI6 A;  3FD9 A;  1VQ8 V;  4TUY A;  1NU1 H;  5L3C A;  1GKF A;  3SGI A;  4I7Z B;  1JQ0 A;  3HKE B;  2EJR A;  3JAK B;  5ITZ A;  1YHQ V;  2E74 B;  2YUA A;  4JI5 B;  2F43 G;  5LYJ A;  4DR3 O;  3FB6 C;  4GKK B;  2V4D A;  4IGG A;  1T5E A;  1K7D A;  5JCO C;  1GM7 A;  4FM1 A;  5EIB C;  3P30 A;  4J41 A;  4B3M O;  3F5W C;  3ZHQ A;  1JFF B;  3ZJZ A;  4O4J A;  1WLE A;  1AP6 A;  4YHH O;  1NR1 A;  5L3F A;  2WLM A;  2LFS A;  3CB2 A;  3G4S V;  3JAL A;  3L74 H;  1XI1 A;  1URF A;  2QA4 V;  2GHY A;  3ZMZ A;  1XIL A;  4JAV A;  2Z5U A;  5EC2 C;  3RVY A;  2NNU A;  2Q7G A;  2QGN A;  1SER A;  3WFV A;  1YXB A;  1DF4 A;  2VQE B;  2XHB A;  3FKS G;  4RUE A;  5BMV A;  1KC8 W;  3SYC A;  4OPH A;  4RUF A;  5JJE B;  3WG7 C;  2P67 A;  5H9C A;  1GN2 A;  2WPD G;  5E1A C;  4TV8 B;  2JRI A;  1U97 A;  4CC5 A;  4MVQ A;  1MG1 A;  3RFR A;  2GBO A;  5CB4 A;  1RSO A;  5EBL C;  3ZN1 A;  4FZ1 A;  5LMU B;  3IAY A;  4J42 A;  2Q4P A;  1FFX B;  2ZIM A;  5F2V O;  3AG1 B;  1YVW A;  2IBZ H;  3IGA C;  4P9O A;  2XUM A;  2OCH A;  2ZIN A;  2HG5 C;  1GO3 F;  2IH1 C;  1KP3 A;  3SYP A;  2AHY A;  1GTO A;  1AI5 A;  2HFE C;  2OIG A;  4D7T A;  4LP8 A;  5JCO A;  4B3T O;  2CTR A;  2JS3 A;  5LXT A;  2P6J A;  3T2M A;  5D5P A;  3FX7 A;  4WF9 V;  5L3B A;  3CHX A;  3RBZ A;  4LF9 B;  3U11 A;  3WB0 A;  1Q6H A;  3JAW A;  4U7O A;  1SA0 A;  3AK3 A;  4JI1 O;  4DR2 B;  1R1B A;  3CMA V;  1XEQ A;  3E86 A;  4PHZ A;  4R50 A;  3LNM B;  3D8C A;  3OMN B;  4YIO A;  3NR7 A;  1XNR B;  5CA1 B;  5JVD A;  2W6I G;  2PTM A;  2L35 A;  4FK5 C;  1IJG A;  4R6Z A;  3P3N A;  4LFC B;  2WLH A;  5L3E A;  2EIL B;  5IWA B;  1DF5 A;  1NZ6 A;  4DV0 B;  3L75 H;  3O9O A;  1ZTE A;  2UUB O;  1VQO V;  3G6B A;  2AXT Z;  3CCJ V;  3ZMS A;  3CS5 A;  2YDE A;  3APO A;  4WFG A;  5BY1 A;  4LF5 O;  2UXN A;  4LR3 A;  4ZHQ B;  1XHZ A;  2P22 C;  2ZE8 A;  3ZX6 A;  5LP6 C;  2B1I A;  1N8R W;  3LSS A;  4GX0 A;  4DUY B;  3F5T A;  4K8Z A;  4JI0 B;  4J7Z A;  3H1I H;  4DR2 O;  5FNV B;  4DV1 O;  4LC1 A;  4J10 A;  4O4L A;  2OTL V;  3RWR D;  4NTY A;  1IBK B;  5LMN B;  1Z2G A;  1DLB A;  4LH7 A;  4DV5 O;  1IX9 A;  3ETE A;  1JPX A;  1VMG A;  3RW0 A;  5BR8 O;  1H2S B;  3OM3 B;  5IWA O;  4FFK A;  1F51 A;  3JAT A;  4JV5 B;  4DV0 O;  1SC5 B;  2DW4 A;  2W0F C;  2YXH A;  2EBO A;  3TGU H;  1EBO A;  2BTQ B;  3ZCC A;  2N74 A;  1K4C C;  4HBN A;  3CXH F;  1AVM A;  1Y76 A;  4ZOL B;  3AG4 C;  4UCV A;  1HR0 B;  1N34 O;  4IYH A;  4I0X A;  1BS3 A;  1TGO A;  2CUG A;  2NR5 A;  1S5H C;  2NLJ C;  3JD2 A;  2X0L A;  3T1C A;  5KLV H;  3FB8 C;  4UVB A;  3N2K B;  4DXW A;  4GKJ O;  2YIB D;  2FB5 A;  5LP6 A;  2IJK A;  3L70 H;  2JGU A;  5LOV A;  3M7M X;  1IBK O;  5LMN O;  4NXN B;  1SES A;  4G2K A;  3Q4H B;  3HKB A;  4NTX A;  4HYO A;  3RYF B;  1V54 C;  4ZIB A;  2ZR3 A;  2ZQM A;  1HWY A;  1KU9 A;  4MVZ A;  4O4H B;  2YSU B;  4I4T A;  2QE7 G;  1US6 A;  1QVF U;  2ATK C;  4C7U A;  2Q68 A;  2QEX V;  1S0V A;  2ZDI C;  1CEZ A;  1R3I C;  4DV6 B;  4NR1 A;  5J2T B;  4I50 A;  2LJ2 A;  3K57 A;  2YIA A;  3E22 A;  4K35 A;  1N33 O;  2UU9 B;  5B1B B;  1Q7Y W;  1K92 A;  1Y6X A;  2OCC C;  2LW7 A;  4B3S O;  4TT3 G;  4JI4 O;  3VQY A;  1X59 A;  3S3W A;  4BWA A;  5LL6 Y;  3WB2 A;  4DV4 O;  3J7A U;  3CRR A;  2DYR C;  2Z0A A;  2Q69 A;  1KMI Z;  3ZRX A;  4N23 A;  2LO1 A;  2W6J G;  4H0L B;  2QDO A;  4BIO A;  3AK2 A;  3M8A A;  1O9G A;  4DUZ O;  4FM0 A;  3OTF A;  4DR5 O;  3B09 A;  2JJ2 G;  2ARH A;  4MVR A;  1BMF G;  1K5Q A;  1OZ0 A;  1YF2 A;  4DW0 A;  1COW G;  4Z2W A;  3CRC A;  3K04 A;  4PJ0 Z;  4P30 A;  3JCU Z;  2B5U A;  3ASN B;  4KHP B;  2ZDI A;  1R3J C;  2YI9 A;  1I08 A;  4DR4 O;  2H3O A;  4J11 A;  3S3X A;  4QPJ A;  1SZX A;  3K3W A;  4IT5 A;  3HPL C;  5EBW C;  2UXD O;  1FXK C;  3ZRW B;  3D36 C;  4ZI7 B;  1WAZ A;  2LFR A;  5B1A C;  5GTI Z;  4MTF A;  1GN3 A;  4DRX A;  1FPO A;  2VQF O;  2OTJ V;  2JGD B;  3K5L A;  2K9P A;  5FPO A;  3SPC A;  3JAS A;  4Z1M G;  2BOC C;  2UXB B;  4NKG B;  3T4D A;  1QLN A;  1B06 A;  4KXR A;  2QTS A;  4JI6 B;  4LFB O;  3I5D A;  2QWO B;  2CTP A;  4X62 O;  3JSN A;  3CC2 V;  4H13 B;  1EFR G;  1G4Y B;  1RPO A;  1W59 A;  4NYK A;  2O57 A;  4LCU C;  3RYC A;  2UXC O;  4HNA B;  5GON A;  4EB6 A;  1QR8 A;  2Y0P A;  1KD1 W;  2P06 A;  4CBC A;  4NXM O;  4JAA A;  2EIN B;  4X1I B;  5IJ9 B;  2BCC H;  5KX5 A;  3TCU A;  1N32 O;  4UV9 A;  3BPZ A;  1IDS A;  3E8F A;  5H6R A;  1Q43 A;  5EYP B;  4EFB A;  1Q81 W;  1K97 A;  1VQM V;  3ABU A;  5IYB O;  1FXK A;  3D36 A;  1EN5 A;  4N21 A;  4FLY A;  1I7F A;  5J2U B;  2Q7E A;  5EC1 C;  1M56 B;  2QSA A;  3GB7 C;  2IU0 A;  1GN4 A;  4PA4 A;  3HKE A;  4DR7 B;  3JAK A;  1NTZ H;  2XAG A;  3AG2 B;  3AG1 C;  1XBL A;  3APQ A;  5KHI A;  2E5L O;  2GDS A;  4O2A B;  3T1H B;  4F6R B;  1FXH A;  1MA1 A;  2HLD G;  1PV0 A;  4LF6 O;  3ZMT A;  1FD9 A;  1WN7 A;  2WWW A;  3ETG A;  1RM1 B;  4IIJ B;  1BZK A;  2QTO A;  1S5L Z;  2ETN A;  1S5J A;  2OIE A;  1IUR A;  4FLV A;  1YTF D;  2L6L A;  4TQD A;  4LH6 A;  1N36 B;  2HJD A;  4MSW C;  4EEQ A;  4K0K B;  1NKD A;  4UCR A;  4AIL C;  4H33 A;  3HB3 B;  1SQP H;  2DE0 X;  3E8G A;  3K0G A;  4YIP A;  4X64 O;  1HDJ A;  2ZT9 B;  5EIB D;  2VS0 A;  3K5M A;  2XT9 A;  1HNW O;  1GN6 A;  3ABT A;  4YXW G;  4CS2 A;  4FM2 A;  2EIL C;  3A8T A;  1YJ9 V;  4R8C A;  3FYE B;  2HHH O;  4TV8 A;  1ZUQ A;  3RN4 A;  2EIM B;  4CS4 A;  2UUC B;  5K1P A;  1CPY A;  5HFM A;  4WFH A;  5KA5 A;  1FFX A;  2CTQ A;  1HNX B;  2QKA A;  1G8M A;  1M57 B;  1OCC B;  4X1Y B;  4X65 B;  1VIB A;  2ODM A;  1XUQ A;  4JI3 O;  5CBF A;  3X2Q B;  4GX5 A;  3W7T A;  1YCI A;  3SR2 C;  3U10 A;  4FFB B;  2ZD9 A;  1BGY H;  4JAU A;  4MTO A;  3SPI A;  1YIJ V;  2P4K A;  2HR3 A;  2F4V B;  4K3A A;  4JI2 O;  4O2B B;  2ZCE A;  2FKX A;  1OHH G;  2FML A;  1Q82 W;  1ZLZ A;  5KUK A;  1K3E A;  3LDC A;  1QLE B;  2Q7H A;  4X1K A;  2HEP A;  2ZR2 A;  2BOB C;  1N0J A;  2YXL A;  2RCV A;  2P90 A;  4GLX A;  2EIJ B;  2UUC O;  1EN6 A;  4LWS A;  3CCE V;  4DYL A;  2H94 A;  1BQZ A;  3NXS A;  4E2L A;  1HNX O;  3TJT A;  4B3R O;  4B08 A;  4LBE C;  1A32 A;  2QM8 A;  1ZSP A;  1LUV A;  4K8X A;  1AR5 A;  2Q67 A;  3CCR V;  2A3Q A;  1WPX A;  4L87 A;  5JQG A;  1U96 A;  2OYQ A;  3I55 V;  4ZHQ A;  3FAV B;  1JJ2 U;  3ZRV A;  4QIW F;  2FL4 A;  2IJI A;  2UXX A;  2D2C B;  4JI7 O;  4EKW A;  2ZM6 O;  1D2D A;  1OCZ B;  3E35 A;  3C3T A;  5FNV A;  1WP7 A;  3JD3 A;  4KL1 A;  3CCU V;  4U7N A;  4RQF A;  1W2B U;  4LF8 B;  3A2F A;  4EFE A;  2W0X A;  3DXR B;  1NVP B;  3LSQ A;  1XQ8 A;  3OMA B;  3T4Z A;  3MHS C;  2GTS A;  1ZX3 A;  4MVS A;  4KP4 A;  3JCZ A;  3W7X A;  5B1B C;  2EX3 A;  2BTQ A;  2YIC A;  3KG2 A;  1VQ4 V;  3QVN A;  4TSF G;  4UV8 A;  4ZOL A;  1XL4 A;  2X6B A;  4TQF A;  4JI5 O;  4PA9 A;  2XND G;  1NBM G;  5IY5 B;  3CC7 V;  4WCE V;  2EJ7 A;  3OFN G;  4TV9 B;  3N2K A;  4GKK O;  3JAR B;  1XMO B;  5L3G A;  3JYC A;  4PEL A;  4MTG A;  4NB5 A;  4MTX A;  1QR9 A;  2IJJ A;  2IJH A;  3K9S A;  3Q4H A;  4IYI A;  1GM9 A;  3RYF A;  2GV9 A;  2WLK A;  3IFX A;  1VF6 C;  2IW5 A;  1AJQ A;  1B6Q A;  2CK3 G;  2CDY A;  3EVK A;  4O4H A;  3CX5 F;  5B1O A;  1YDX A;  4OX9 B;  2B1G A;  5FL7 G;  2XAS A;  4I9Q A;  3SYQ A;  3UQ8 A;  1R6K A;  3N2G A;  1MZE A;  2AHZ A;  1MOF A;  2Z3Y A;  3ASN C;  3DC5 A;  1P7G A;  1Q8I A;  2WAM A;  4FLX A;  2VQE O;  4GYC B;  5J2T A;  2VWJ A;  3B4S A;  1YJN V;  2JEU A;  4UCS A;  2R72 A;  4MT8 A;  5EK0 A;  1ZWI C;  1Q86 W;  3FB5 C;  5CBG A;  1J5E B;  3VBB A;  1D5N A;  5LMU O;  4I55 B;  1TA8 A;  2JEX A;  5CMU A;  1M4U A;  4FMT A;  1Q6U A;  1QHT A;  2YEV B;  4WBN B;  1IBL B;  3VQW A;  2DMX A;  1PNL A;  1BQ0 A;  4B7E A;  4U3F H;  4AI8 A;  2HP8 A;  1H2L A;  1R6N A;  2RNB A;  4LFA B;  1M93 A;  4HAM A;  5GTH Z;  1NH2 B;  4CC6 A;  1NR7 A;  1SQF A;  1KKC A;  4RAI A;  5GW7 A;  4P2Z A;  2QKS A;  4UCU A;  3ZHU A;  3C90 A;  5CBH A;  4LF9 O;  3RT3 C;  4JAS A;  2WA3 A;  1IXB A;  1R3L C;  5IYC O;  2EIN C;  3UM7 A;  1HNZ B;  2DYS B;  2LW1 A;  4AQY B;  4O4I A;  2EZO A;  1XNR O;  4X66 B;  5ITZ B;  4LFC O;  3ZRW A;  4ZI7 A;  1NS1 A;  1PP9 H;  1YIT V;  3AG7 A;  4DV2 B;  3MD0 A;  1KKD A;  1M56 C;  3OMI B;  3OT7 A;  3H1K H;  5KUM A;  1K5S A;  1WB8 A;  1JNB A;  2JGD A;  3L9D A;  1TAE A;  3AG2 C;  5EZY B;  3RVZ A;  1B04 A;  4PDM A;  2HVK C;  2ZNI A;  3CJH A;  4W4K A;  3OGI B;  2F66 C;  1SS3 A;  5KHG A;  4DUY O;  4MS2 A;  3F7Y C;  1FFT B;  1RM1 C;  4JI0 O;  3K58 A;  4X9Q A;  4HNA A;  3ML0 A;  3H1J H;  1KB9 F;  3D3Q A;  3E2E A;  4UB8 Z;  4DR6 B;  5DN6 G;  3R66 A;  1EM1 A;  1VP7 A;  1QU7 A;  1H2G A;  1GH6 A;  4X1I A;  2A0L A;  4PI0 A;  2YXY A;  2WLJ A;  4DV7 B;  2D3O W;  2WSS G;  4PA7 A;  2EIK B;  3SYA A;  4JV5 O;  1H2M A;  3T1Y B;  1I94 B;  1P4R A;  4BAY A;  2DQ3 A;  1AP5 A;  2IM9 A;  2KG7 B;  2V7Q G;  4J80 A;  4YJ3 A;  3QNE A;  2N04 A;  5JH7 B;  4XDL A;  1HR0 O;  2EIM C;  3R65 A;  2R9A A;  4HZ3 A;  2DQ0 A;  5DEC A;  1YZB A;  3OUF A;  2H8P C;  2BSK A;  1M57 C;  3L71 H;  1IBM B;  1OCC C;  2AW9 A;  5B1N A;  1QCE A;  3G80 A;  3RYH B;  3EFF K;  1FS0 G;  5KHH A;  4F6R A;  3X2Q C;  1SA0 B;  5DM6 V;  4NXN O;  3SJB C;  3UT5 B;  3A0B Z;  3KDR A;  1KEC A;  2JDI G;  4X8A A;  2GUZ B;  3QO7 A;  1BE3 H;  4DV7 O;  5JVD B;  3P32 A;  1QVG U;  4PA6 A;  5IDJ A;  4WFB V;  1L8D A;  1NTK H;  3ZED A;  1XMQ B;  4Q20 A;  4J9Z B;  1QLE C;  3CPW U;  1O9H A;  1NJI W;  4DV6 O;  3U0Z A;  3C3S A;  1P7B A;  4G27 B;  3CXC U;  2EIJ C;  3JD4 A;  2ZIO A;  5JWP A;  2UU9 O;  1M9N A;  3CCV V;  3ETQ A;  1UFI A;  2IU3 A;  1JA8 A; 
#chains in the Genus database with same CATH homology
 1AP6 A;  1ZTE A;  1XRE A;  3AK1 A;  4BR6 A;  4YIP A;  4X9Q A;  5AG2 A;  3C3T A;  1GN6 A;  1XIL A;  1EM1 A;  4E4E A;  4JZ2 A;  1D5N A;  1VAR A;  1ZUQ A;  3RN4 A;  5A9G A;  1PL4 A;  1AR4 A;  1GN2 A;  2QKA A;  3IC9 A;  1AP5 A;  1N0N A;  1KKC A;  1XUQ A;  3KKY A;  1IDS A;  1IX9 A;  1VEW A;  1XDC A;  1LUW A;  1JR9 A;  4FFK A;  1IXB A;  2ADQ B;  3AK2 A;  4JZG A;  1EN5 A;  3QVN A;  3LSU A;  2AW9 A;  2P4K A;  4JYY A;  1MSD A;  1MMM A;  1GN4 A;  1QNM A;  3DC6 A;  1ZLZ A;  1AVM A;  3KDR A;  1PM9 A;  1MNG A;  2GDS A;  1EN4 A;  1N0J A;  1BS3 A;  2RCV A;  3K9S A;  1BSM A;  3AK3 A;  1MA1 A;  1I08 A;  3OT7 A;  1EN6 A;  1SZX A;  4GUN A;  1Y67 A;  1WB8 A;  2QKC A;  1WB7 A;  2CDY A;  3EVK A;  4YIO A;  3TJT A;  4F6E A;  2ADP A;  3BFR A;  1ZSP A;  1LUV A;  3C3S A;  1GN3 A;  1BT8 A;  1AR5 A;  3CEI A;  3DC5 A;  1P7G A;  1I0H A;  2CE4 A;  3MDS A;  4C7U A;  1B06 A;  1JA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...