4JZGA

Crystal structure of a single cambialistic sod2 occupied by manganese ion from clostridium difficile
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
202
structure length
202
Chain Sequence
b'NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Crystal structure of a single cambialistic SOD2 occupied by Manganese ion from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Oxidoreductase
total genus 72
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4jzgA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4jzgA02
4BR6A 1LUWA 4C7UA 1AP6A 1I08A 2QKCA 1MNGA 1MMMA 4FFKA 1EN5A 2ADPA 1JA8A 1AVMA 1MA1A 1ZLZA 1EN4A 5AG2A 1IXBA 1XILA 2GDSA 3LSUA 1N0JA 1AR4A 1JR9A 2QKAA 1LUVA 1D5NA 1KKCA 4JZGA 4YIOA 2CE4A 1I0HA 1BT8A 3AK3A 1WB8A 4JYYA 2ADQB 1PL4A 1QNMA 4JZ2A 1ZUQA 1AP5A 3RN4A 4X9QA 1PM9A 1GN6A 2RCVA 1AR5A 4E4EA 3TJTA 3QVNA 3C3TA 3OT7A 4F6EA 1XDCA 1EM1A 3K9SA 1WB7A 1VEWA 3IC9A 3C3SA 2CDYA 1GN2A 4YIPA 1P7GA 1EN6A 1BSMA 1SZXA 1XREA 3DC6A 1BS3A 3DC5A 3EVKA 1VARA 3AK2A 4GUNA 2AW9A 5A9GA 3CEIA 1MSDA 1XUQA 2P4KA 1B06A 3AK1A 3KKYA 1IX9A 3BFRA 1GN4A 3MDSA 1GN3A 1Y67A 1ZSPA 1ZTEA 1N0NA 1IDSA
chains in the Genus database with same CATH superfamily
3E86A 3TXQA 1LUWA 2NN4A 3SPHA 5LMNO 1GTOA 2QKCA 4CC5A 4BW5A 1VQMV 1WNSA 1I94B 4HNAA 2VQEO 3CRRA 1S5LZ 1SC5B 2Q0OC 5B5EZ 1VQ8V 4J80A 2ZIOA 2X0LA 5L3EA 4B3MB 1R6KA 1TUBA 4DR7B 1KU9A 2FL4A 4UVCA 2OCHA 2JEXA 2F23A 4LF8O 4GX2A 2K1EA 1TGOA 4GX1A 2ADQB 1QNMA 2YIBD 5DEDA 1BHBA 3RN4A 3JAWA 4GCZA 2E3CA 3JASA 1Y74A 4DRXA 3E89A 4B7EA 2OCCB 1NTKH 4O4IA 4E4EA 4H33A 1RM1B 1SQVH 2FYUH 1KECA 2EZPA 2ARHA 1N33B 1PKXA 1FS0G 5L3BA 4FLZA 4WCEV 3CX5F 4EFEA 4YJ3A 1BE3H 3W7UA 3OUSA 3TCUA 2CDYA 1K5QA 2DW4A 3UM7A 3PN1A 3K57A 1KC8W 3IFXA 2R9IA 3K5MA 4GUNA 4KP4A 4UCUA 5FNVB 2QM7A 2EJ7A 3ZJZA 1M4UA 1W2BU 2CGOA 4WBNA 3RT3C 3CYOA 1IBMO 1M5IA 2PYJA 3JATB 2H3OA 2XASA 4MT8A 1VQ5V 2K9PA 4TSFG 3D3IA 3L74H 5BR8O 1EFRG 4XDJA 3UT5A 4ZHQA 1Z5VA 3FKSG 3HKBA 2HEPA 2X6CA 2Q0AA 4NTYA 5H6RA 1YEWA 2OTLV 4DV5B 5A2QN 2P5OA 1EN5A 3K06A 4YY3O 1AVMA 3SJCC 5JQGB 1MZFA 4ASUG 5AG2A 4X62O 1XNRB 1IXBA 3RYCA 2UXXA 3ICXA 4MS2A 1S76D 1S3JA 1IZ3A 3H1KH 3N2GB 2QKAA 2X6AA 1P84F 5KX5B 2MK3A 5LP6B 4U3FH 1BL8A 2G38A 3JD4A 4DW1A 1GMGA 4FZ1A 2Q7EA 4DR6B 2YXYA 5KHGA 3W7SA 4O4JB 1FAFA 1SZTA 5EZYA 2HVJC 4Z1VA 1VQNV 2Q67A 1F4MA 2FTKA 3ABKC 4X66B 3F7YC 3T1HO 1HNZB 3DTUB 5KA6A 4RWUA 4OPHA 4IIJA 4LWSB 1W0KG 1FFTB 1YF2A 3OR6C 2CH7B 2GBOA 4BW9A 1Q86W 4ZI7A 1SESA 1YHQV 1K5SA 4QPJA 1ZWIC 4U3JB 1FPOA 3ZMZA 3K9AA 3VQVA 4I55A 3LDDA 2LW7A 2A79B 1H2LA 1SQPH 1XUQA 5C8YB 4LCUC 4QE7A 5EC2C 2WLIA 1M1KW 3ZRSA 5LMNB 5IJ0A 4CS4A 4OPAA 1H2MA 2VQEB 1ORQC 4JI4O 3N2KA 5H2FZ 1K33A 1EZVH 2NNUA 4I7ZB 2Y4UA 3SYCA 1QHTA 1NBMG 2EIJC 3FAVA 4U7OA 3CRAA 3FX7A 1NR1A 4G28B 4LF8B 2CGNA 5LGNA 1OCOB 3UO3A 3L73H 2UXDO 1O9HA 1AI7A 5LA6A 2LGQA 2JRIA 4O2BA 2UUAO 1FXKB 3RVYA 4RQEA 5B1OA 4KUMA 3D36C 4DO2A 3OR7C 4DK1A 1BT8A 1Q3EA 5GTIZ 5KMGA 2PF4E 3NXSA 1JNBA 4LH7A 2UXCO 1YI2V 4CS2A 1NVPB 3GWKC 3JAKB 2YICA 1NTZH 1HNWO 1BQZA 3AG1C 1R3JC 1DF5A 2P67A 4UV9A 1FXHA 5B1NA 1QLNA 4DV2O 3SR2C 2ZIMA 2LW1A 5L3GA 4JI7O 1IBMB 4P30A 1VMGA 2IJIA 1I5YA 2A0LA 3RYIB 2DYSB 1FXVA 3RYFB 1Z2GA 1V55B 4DV0O 5BR8B 4PI2A 4LFCO 2QE7G 4FPPA 2HG5C 1OCCB 1R1BA 2AGAA 3VOUA 4I5SA 2ODMA 5IYZB 4O4HB 2WLJA 1SQFA 4YY3B 3SYAA 1IXMA 3WG7C 3ZS8C 5LXTB 5FLXN 2OYQA 3SPGA 2GSMB 3CCJV 2QTOA 1TA8A 4X62B 1S0VA 1N36O 3AG2C 1VQ4V 1K9MW 4O2AA 4O4LB 2UXNA 3JD0A 4R6ZA 4JAUA 1SRYA 5EYPB 5KHHA 2DE0X 1OCZB 3HKEA 3CD6V 4TV9A 4PELA 2QEXV 1EZJA 3W7WA 5L3DA 2XAQA 1N0JA 1K73W 5BMVA 2QWQB 2EILC 3UCSC 2IW5A 2YUAA 4NR1A 1V9PA 4JAVA 1XL6A 3CRMA 1RFYA 3SYOA 4X20A 3T1HB 1NVPD 5LHHA 1PL0A 2VRZA 4KHPO 1QLEB 4JZ2A 1K3EA 1KP3A 3B77A 1CPYA 4LC1A 1NH2D 1G6UA 3A8TA 3VQXA 4RO2A 1V54B 3TJTA 3BY6A 3TXSA 5IJ9B 4F6EA 2CTPA 2Y0IA 5IY5B 4AHCA 1JCHA 1K4DC 4LFBO 1VEWA 3E22A 2LGWA 1J5EO 5IWAB 3MHHC 4UCRA 1P7GA 3CCQV 1SZXA 3B40A 4I50A 3JD3A 3EVKA 3U0ZA 3B4SA 3JSLA 4GLXA 2RQ6A 1MOFA 3CS5A 4JI4B 1YVWA 4GYCB 5KAIZ 2QGNA 4DUYO 4FZ0A 3AEIA 4DV7O 2UUBO 2OIGA 4PDRA 2CAZC 3OEEG 5D5PA 4HAMA 3ABUA 3QO8A 3RBZA 4FFBA 2IU0A 2Q69A 4I4TB 4PHZA 1M56B 3TK1A 2HLDG 4FM2A 4IL6Z 4CBCA 2UXDB 1ZL8A 3OFNG 1BZKA 1WA8A 1XQ8A 4JI2O 4FLVA 2Q4PA 3K5NA 1M57B 3AG3B 1JA8A 1TAEA 3L75H 4CH5A 1SA0B 1W59A 4UXNA 1AI5A 1XILA 1GM8A 3BABA 2JVDA 2XT9A 3ZRWA 4U7NA 1AR1B 2AHZA 3CCRV 2CTWA 4I0XA 3OW2U 2GTAA 2UXCB 5JCOA 3HKDB 3DSQA 3DXRB 4UCOA 1FJGO 2FKXA 4H37A 3JCUZ 2WLLA 2JIZG 4EB6B 1YZBA 2XAHA 4DV2B 1YITV 5CB4A 2ZXWB 5IYDO 4W4KA 1AROP 4JI7B 3WB0A 4WFGA 4MTXA 3M7MX 1Q6HA 3ZMVA 4N23A 1XDCA 1MSWD 4MTGA 2E5LO 1UJWB 4DV0B 4NYKA 5H5NA 3QNEA 4LFCB 2CK3G 1F4NA 4TWKA 2HFEC 3C3SA 3CXCU 4ZOLA 4YIPA 2GTSA 1BSMA 4TV8A 4KXRA 2D2CB 4NXMO 3K5LA 1MSDA 1Q5OA 1GM7A 5B1AB 3APOA 3BAAA 3P30A 4WFFA 1GK9A 1K7DA 3T1YO 5JH7B 2WA3A 4DR2O 4CH3A 3CCLV 1RPOA 2BSKB 3O9OA 4Q6GA 2ZCEA 1DLBA 4GKKO 2EBOA 2GUZA 2Y48A 4PI0A 3JCZA 1MMMA 3U10A 4DXWA 3ZMUA 4PA9A 4DYLA 2Q8VA 3GVMA 2YEVA 4F4LA 4DV1O 2JS3A 4JI3O 4YJ2A 1MA1A 3LSUA 5JJNB 4KHPB 5LMUO 3ETQA 4R8CA 4JI1O 3MHSC 3G4SV 1JX9A 4X1IB 4BIOA 1ROPA 1R3IC 4LF4O 2YIDA 4NB5A 1WLEA 4NTWA 3K0DA 2Y69C 3G67A 3RW0A 2BTQB 5KHKA 1J5EB 2IBZH 4JASA 2KB1A 1EM1A 1NI8A 2JEUA 1N4CA 1MG1A 1PPJH 4QGPA 4QE9A 3K08A 4K0KO 4DUYB 5CA1A 4DV7B 2UUBB 3ASNB 2A06H 1GH6A 4PDLA 1P49A 2BE3A 3KCYA 4J9ZB 4X1KB 1OHHG 5FPRA 2PZSA 4K8ZA 4YHHO 2ZINA 3WU2Z 3ABMC 1Q82W 1OCRC 3T4DA 3BA8A 3K5OA 3QO5A 4JI2B 2DYSC 1B04A 3CCUV 1FYJA 2CTRA 3CRCA 3L71H 3GWOA 3OEHG 3ASOC 4B3TO 1S5JA 5HFMA 1N0NA 3CC4V 4DR5O 1H38A 3OTOO 1JMKC 1H2GA 2YI8A 3ZBHA 5LL6Y 4JYCA 2F93B 3OGIB 2DYRB 4J11A 2R72A 2ETNA 2D3OW 1FJGB 1JR9A 1U96A 5FPOA 1URFA 1FFXB 3EXAA 2JGDB 4EEQA 5LOVB 3BPZA 1OCZC 2CE4A 3F5TA 3CCVV 4NKGB 4BIZA 1BQ0A 1VQOV 4PJ0Z 1WB8A 4JYYA 3LNMB 4H13B 1PL4A 2BOCC 2WLHA 4LF7O 1ZUQA 2E5LB 5CBGA 3BRCA 3CWBH 2RDCA 1VQ6V 1QVFU 2AZ0A 3R66A 5FNVA 2Y0PA 3FYEB 3ZRVA 3SYQA 3ML0A 3ZMTA 3JATA 4D7SA 2HHHO 4NXMB 3H01A 4I9WA 1XMOO 5B3SC 1QCEA 1IBKO 1BMFG 1ZAUA 1F51A 5KA5A 1DTOA 3OMIB 1PNKA 1NTMH 2ZE7A 4JGSA 1S72V 5JJJB 2EIKC 3OE7G 1R6TA 5H6QA 5ITZB 3LSSA 3T1YB 4HBNA 4DR2B 2V7QG 5FL7G 5A9GA 1BHAA 3D3QA 5JVDB 2UXBO 2P4KA 4GKKB 4FK5C 1N34O 1H5WA 1Z5WA 4PA4A 5CN0A 4HYOA 1YJNV 2C2AA 3N2GA 3E8HA 2F95B 3MDSA 4DV1B 1ENVA 5EBWC 1WP7A 1UFIA 4JI3B 2JJ1G 1KP2A 3RVZA 3CJHB 2OTJV 4MW3A 5KX5A 2N04A 4WFAV 5LP6A 5JCOC 1JPXA 3HKCB 5CA3A 5J9PC 1FKAO 1HNXO 4JI1B 4W4LA 4LNUB 4O4JA 4LFAO 2IU3A 1NKDA 2W6JG 3C90A 1EN4A 1M56C 4JI0O 4LF4B 3THOA 2XAJA 2VQFO 5LYJB 3E8BA 3CSXA 4Z1MG 3ZHTA 4LWSA 4LR3A 1HW7A 2YI9A 4K35A 1PD3A 3AG3C 2ZQMA 2CH7A 1J95A 1I0HA 4PDMA 3DGEA 1L1FA 2LQTA 4U3JA 4X65O 5B1BB 3S3WA 3P3PA 1KKDA 4TQFA 2WWWA 2KG7B 2W0XA 1GN6A 5E1AC 1OZ0A 4ZKIA 4DUZO 3JALB 4K0KB 5C8YA 4PD4F 2B9ZA 4P9OA 3K0GA 1I5XA 2F4VO 1QVGU 1CP9A 4YHHB 2RJZA 4GX5A 1R3LC 2WLMA 2ZXWC 2WAMA 2QTSA 4X64O 1VQKV 1XOUA 2QM4A 4X1YB 2F43G 3ABLB 5HFLA 3W7XA 4JI5O 1BS3A 3X2QB 3T2MA 3L9DA 5BXZA 4JYAO 2RNBA 4MSWC 4DV3O 4B3TB 1Q43A 4J7JA 4TUYB 4DR5B 4L87A 3OTOB 4CH6A 1SQGA 1HDJA 1JOYA 5EC1C 3ETGA 3K59A 3CCSV 1L0LH 3LNNA 3R65A 4UCVA 2EJRA 1YTFB 1U97A 2XHBA 3CCMV 1TVKB 2Z3YA 2P4VA 1I08A 3ABTA 1GM9A 5BZBA 4MVSA 2QA4V 3ZHUA 4NTXA 1Y76B 3JAKA 3HKEB 4ABMA 3H1LH 1PV0A 3W7TA 4J7KA 3Q4HB 3B8NA 1VQPV 4LF7B 1JJ2U 1FOUA 3P32A 1JFFB 4TOIA 2A9HA 3JSNA 1F7YA 4QNHB 2Y4TA 5LGTA 3STLC 1YCIA 3ZHQA 2GV9A 1GRJA 3AK3A 3RYIA 2HHHB 3BEHA 3RYFA 1XMOB 4LF6O 3AG4B 2EIMC 2AHYA 1IBKB 4AQYO 2CTQA 3CC7V 3I55V 3UO2A 2ZNJA 2V4DA 2P6JA 1AJPA 1CXZB 2JK5C 2RN9A 1VF5B 5IYZA 5E79Z 1DF4A 2VS0A 2UXBB 1WN7A 5LXTA 1N34B 4IGGA 1SERA 3KCXA 3ZN0A 4DR3O 4O4LA 2A3QA 5EYPA 3N27A 1K92A 2DWDC 1VF7A 3G71V 1VP7A 5H9CA 4PDVA 3BFRA 1HNXB 2HR3A 1IJGA 2OCCC 4PA3A 4LFAB 3JAMN 1RM1C 3RGBA 3S3XA 4KFMA 1N8RW 1LNQA 3G6BA 3ABKB 4JI0B 1RSOB 4PA6A 3BVOA 4C7UA 2VQFB 3JARB 1Q90D 3TETA 3OM3B 4UVAA 2EINB 3OGCC 1CEZA 3ZX6A 3QF7A 3ZN1A 2EZOA 2DN9A 3L72H 5IJ9A 4X65B 3LDEA 1YXBA 2UUCO 4F6RB 3CP1A 5J2UB 3CRQA 1P4RA 2P7TC 4DUZB 5CA0B 3FFQA 1S77D 2UUAB 2QWOB 2PUSA 2P06A 2F4VB 2QKSA 3TGUH 1PM9A 3A0BZ 2WLNA 1SQQH 4Z2WA 1AR5A 1JQ0A 1HWYA 1QR9A 4X64B 3QVNA 1PP9H 1N32O 4G27B 2KKWA 3ZRXA 3ZCCA 3K9SA 4JI5B 1E1QG 3RYHB 1XHZA 3H1IH 1HNWB 4JYAB 5J2TB 5K1XA 1NT2B 2EIJB 4I4TA 3CMAV 2LFRA 1QQCA 4OXSA 2DOSA 3ETEA 1F23A 1XREA 1AJQA 1DGSA 4K3AA 4J10A 2PYLA 1KB9F 2AW9A 3IC7A 3LUTB 2IJKA 2WA4A 4DV4O 4CH4A 1EBOA 5LP6C 4WFEA 2ITDC 1SA0A 3OMNB 3FD9A 3AK1A 5GONB 4ZBMA 2RMKB 1YSCA 4FM0A 2ZR3A 4DR1O 4D6TH 2B1IA 2YIAA 2B5UA 3ZMSA 3CPWU 1D5AA 3HKDA 4IHJB 2X7RB 4JV5O 4LF5O 3KZIZ 1THZA 2HP8A 2XOKG 4JI8O 1IBLO 3DXRA 4XDKA 4MVRA 4BR6A 2XNDG 4RUFA 2GUZB 3F7VC 2R9AA 3FB8C 1XNRO 4DW0A 3I5DA 4OX9O 4EB6A 2ADPA 1KQSU 1N36B 1JJOA 3EHBB 4X88A 1HP8A 2LP7A 3B2EE 4WF9V 2ZKOA 4LF6B 2FMLA 2IJJA 2Z5UA 1Y6XA 4AQYB 1GO3F 1XMQO 2N05A 5D5QA 2H94A 1KKCA 1HR0O 1L8DA 4P9PA 1FD9A 1XHXA 3EFFK 1H2KA 4HNAB 2F1MA 3QG5A 5IDJA 1AI6A 2QM8A 1Q6IA 4JAAA 4BWAA 5DN6G 3C3TA 1TUBB 2ZE6A 3AG2B 4DR3B 5JH7A 4J41A 1Q81W 1WB7A 2BSKA 1R3KC 1OCOC 4MVQA 4CC6A 4LFBB 3UQ8A 1EN6A 1FXKC 4DK0A 2LFSA 3JAWB 3FB6C 3JASB 1Y74B 2QWPB 4DRXB 5LGUA 3BCCH 2EILB 3G80A 4O4IB 2M6YA 3E8FA 4LBEC 3CXHF 4OGQB 1TUEB 4FLWA 1Q6UA 1YJ9V 4YJ3B 2DQ0A 4PA7A 4UB6Z 2AZ2A 3ABLC 4D7TA 3X2QC 2NLJC 5KLVH 3IJ4A 5EBMC 1Y67A 2GHYA 4DV6O 2OWOA 5EK0A 2QR4A 5C93A 4X1IA 1AP6A 2UUCB 4RAIA 2ITCC 3GB7C 4WBNB 4FLYA 2JDIG 3BA9A 4X89A 2N74A 2BTQA 4IYIA 4B3RO 3K58A 1V55C 5EIBD 3OMAB 3UT5B 4ZHQB 1US6A 3HKBB 4ICGA 1YDXA 1OCCC 3E8GA 4J42A 2EULA 1N32B 5DECA 4R7CA 2ZM6O 2M7WA 1QBZA 2QDOA 3SPIA 4X1KA 4PV1B 2RCVA 5IT9N 3RYCB 3RWRD 4KL1A 1NR7A 2PTMA 2E74B 3ZHRA 2LO1A 3MD0A 4DR4O 1KYOF 3U11A 3AG4C 4UV8A 4DV4B 3IC9A 5GW7A 5CMUA 1QU7A 2XTAA 3I56V 1L0NH 3K04A 5KAFZ 1AB3A 5EZYB 1H2NA 4DR1B 2R9RB 1S5HC 3ZHVA 3QO7A 4X8AA 1XBLA 3CHXA 4RQFA 4JV5B 4LF5B 1QLEC 4JTCB 3IAYA 4JI8B 1IBLB 4IIJB 4FM1A 4TQDA 1QR8A 1SKVA 2YXHA 3LSQA 4GT1A 2Q73A 4OX9B 2Q5ZA 4LF9O 4AI8A 5KUKA 3IGAC 1FFXA 3M8AA 4ZI7B 1VQ9V 2JGDA 1V54C 1Y4MA 3QTCA 2JS5A 1VF6A 5LOVA 1M90W 2ZNIA 4TT3G 5IY5C 2ZD9A 4I55B 2DQ3A 2W0FC 2ATKC 3SJBC 4E2LA 3SGIA 2ZT9B 1PNLA 1KD1W 3CC2V 5JQGA 1XMQB 1HR0B 4P2ZA 1NQTA 1XEQA 2Q9LA 2WLIB 1ZLZA 2VWKA 1SQBH 1UPGA 1AILA 5IJ0B 2XUMA 4MVUA 3WB2A 1BCCH 2ZDIA 1G1XB 3B8MA 3N2KB 4JZGA 5LMUB 4YIOA 5CBHA 3J81N 4LP8A 2EINC 2ILMA 3SJQC 1OV9A 3JD2A 4JYBA 2PI5A 1GAXA 1E1RG 5ITZA 1MABG 3FAVB 2O57A 1D2DA 4X9QA 4UVBA 5LHIA 5CBFA 3ZEDA 5JVDA 1W0JG 1VIBA 1R73A 1SETA 5LA6B 1K34A 4YXWG 4O2BB 3VQWA 1I7FA 4FLXA 1M57C 5IWAO 2BCCH 3JYCA 3HPLC 1WAZA 4FVMA 2HVKC 3JD1A 4Q20A 3CJHA 3HR0A 3H9VA 2FB5A 5KMGB 3DC6A 1SQXH 1GKFA 3KDRA 3DC5A 2Q7HA 3HKCA 3PJSK 4B3SO 4LNUA 3FB5C 2JGUA 4DV6B 3VBBA 3K03A 1RPRA 1KMIZ 2YDEA 4RUEA 3K3WA 5IE9A 4NXNO 5LYJA 1K8AW 2UU9O 3BHPA 1GN4A 1E79G 2KSDA 3A0HZ 4XDLA 5B66Z 1ZSPA 2Y69B 4K8XA 1WJZA 4B3RB 5L3FA 2KQXA 4CZZA 3T4ZA 3HB3B 1G4YB 2WLKA 1AJNA 2DJVA 2KG7A 1NS1A 4LH6A 2YSUB 4JF3A 4JTAB 2GDSA 3B09A 2V1DA 3JALA 1FXKA 4JPRA 2QWRB 3AG7A 1WP8A 2ZM6B 2ZR2A 4JI6O 2Q6AA 4G2KA 5B1AC 1LUVA 4GKJO 1D5NA 5BY1A 4UCSA 2X6BA 3SYPA 1NH2B 2PI4A 1VQ7V 3STZC 4O2AB 3ABMB 1OCRB 1AP5A 4X1YA 4DR4B 1DK1A 1BGYH 2R70A 4R50A 4TV9B 4FMTA 4HZ3A 4NVPA 5BMVB 3O65A 4FJCC 1PNMA 3ASOB 4H44B 4QJFB 4TUYA 4I9QA 1K97A 5EIBC 4X20B 2PGGA 5LBQA 1Q7YW 1IURA 3SDLA 1GN2A 1SS3A 1TVKA 2QWNB 2BOBC 3H1JH 4BAYA 1VARA 4LF9B 3F5WC 3D8CA 3CCEV 4IYHA 1VQLV 5KUMA 3FYIB 2P90A 1Y76A 5LHGA 4O4HA 4CS3A 1IVSA 3G6EV 1AI4A 5IYBO 1M9NA 3Q4HA 4QIWF 3VQYA 1XNQO 5L3CA 3SPJA 1JFFA 3E22B 1YJWV 3RFRA 3OUFA 4ZIBA 2IM9A 5K1PA 4FIPC 1IDSA 2HJDA 2IH1C 3LDCA 4I50B 1A32A 2HJFC 4A5UB 1MNGA 4FFKA 2MW2B 2Q68A 5B3SB 1P7BA 1ZX3A 1YTFD 1COWG 3ASNC 1O9GA 1NJIW 1AR4A 2EIKB 3L70H 2F66C 4FFBB 3K79A 1I94O 4UFZA 4BIUA 1X59A 2LJ2A 1JVMA 1ZL8B 3J80N 2VWJA 1WA8B 3A0RA 4B3MO 1WPXA 5JWPA 3ZHSA 4GZRB 4MVZA 3OTFA 4DR7O 4UUJC 3M99B 4MTOA 2XAGA 2ZE5A 3ZRWB 4H0LB 2QSAA 4B7KA 4I0XB 2Q7GA 2EX3A 2OIEA 4B3SB 1R6NA 2DYRC 2JJ2G 2E75B 4QPKA 2L35A 3E83A 3MAQA 4MVMA 1N33O 2WLLB 4NXNB 4J9YB 1RSOA 2XAFA 2AXTZ 3KG2A 2DMXA 3JARA 2UU9B 5CB4B 5DM6V 1VF6C 3A2FA 1B6QA 1SF9A 2BTOA 3CEIA 2DWEC 3WB1A 4EKWA 3OD4A 3APQA 1B06A 2Z0AA 4L8JA 3KKYA 4GX0A 1IX9A 3J7AU 4DV3B 5KHJA 4WFBV 3CMEV 4F6RA 4IT5A 5J2UA 2A7WA 1GN3A 5KHIA 2HKOA 3E35A 1H8EG 4ZOLB 5CA0A 3ETDA 1H8HG 4TV8B 2ZDIC 4WFHA 3CB2A 3UKMA 4JI6B 4AILC 2B1GA 2WPDG 5JJEB 1MZEA 1OJHA 2YXLA 2CUGA 3SJAC 1YIJV 4GKJB 5EBLC 4EFBA 5GTHZ 1KBHA 1T5EA 4B08A 2IH3C 4DV5O 3RYHA 3T1CA 3SPCA 4MVOA 5J2TA 1NZ6A 3AG1B 2P22C 3E2EA 2PY5A 3NR7A 4N21A 3CE2A 4FLUA 1B3QA 2YC0A 1LR1A 2YEVB 4YJ2B 2W6IG 1H2SB 5F2VO 1WPBA 4MTFA 1NU1H 1M93A 3OT7A 3D36A 5GONA 1XL4A 4DR6O 1Y66A 2E76B 3OAAG 3ZIAG 1XI1A 2IJHA 2H8PC 2QJ1A 4JTDB 4X66O 2ZE8A 1Q8IA 4IHJA 5IYCO 1HNZO 1RP3B 4UCTA 4FLTA 2WSSG 3H1HH 1XNQB 2YS8A 4MW8A 3AK2A 3WG7B 2NR5A 2OT5A 4J7ZA 1KUQA 1X4TA 5B1BC 1K4CC 5TISZ 4UB8Z 3WFVA 1G8MA 4XBFA 2EIMB 2YIBA 1ZTEA 5CA1B 3FB7C 2L6LA 3P3NA
chains in the Genus database with same CATH topology
4BR6A 1LUWA 4C7UA 1AP6A 1I08A 2QKCA 1MNGA 1MMMA 4FFKA 1EN5A 2ADPA 1JA8A 1AVMA 1MA1A 1ZLZA 1EN4A 5AG2A 1IXBA 1XILA 2GDSA 3LSUA 1N0JA 1AR4A 1JR9A 2QKAA 1LUVA 1D5NA 1KKCA 4JZGA 4YIOA 2CE4A 1I0HA 1BT8A 3AK3A 1WB8A 4JYYA 2ADQB 1PL4A 1QNMA 4JZ2A 1ZUQA 1AP5A 3RN4A 4X9QA 1PM9A 1GN6A 2RCVA 1AR5A 4E4EA 3TJTA 3QVNA 3C3TA 3OT7A 4F6EA 1XDCA 1EM1A 3K9SA 1WB7A 1VEWA 3IC9A 3C3SA 2CDYA 1GN2A 4YIPA 1P7GA 1EN6A 1BSMA 1SZXA 1XREA 3DC6A 1BS3A 3DC5A 3KDRA 3EVKA 1VARA 3AK2A 4GUNA 2AW9A 5A9GA 3CEIA 1MSDA 1XUQA 2P4KA 1B06A 3AK1A 3KKYA 1IX9A 3BFRA 1GN4A 3MDSA 1GN3A 1Y67A 1ZSPA 1ZTEA 1N0NA 1IDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BR6 A;  1LUW A;  4C7U A;  1AP6 A;  1I08 A;  2QKC A;  1MNG A;  1MMM A;  4FFK A;  1EN5 A;  2ADP A;  1JA8 A;  1AVM A;  1MA1 A;  1ZLZ A;  1EN4 A;  5AG2 A;  1IXB A;  1XIL A;  2GDS A;  3LSU A;  1N0J A;  1AR4 A;  1JR9 A;  2QKA A;  1LUV A;  1D5N A;  1KKC A;  4JZG A;  4YIO A;  2CE4 A;  1I0H A;  1BT8 A;  3AK3 A;  1WB8 A;  4JYY A;  2ADQ B;  1PL4 A;  1QNM A;  4JZ2 A;  1ZUQ A;  1AP5 A;  3RN4 A;  4X9Q A;  1PM9 A;  1GN6 A;  2RCV A;  1AR5 A;  4E4E A;  3TJT A;  3QVN A;  3C3T A;  3OT7 A;  4F6E A;  1XDC A;  1EM1 A;  3K9S A;  1WB7 A;  1VEW A;  3IC9 A;  3C3S A;  2CDY A;  1GN2 A;  4YIP A;  1P7G A;  1EN6 A;  1BSM A;  1SZX A;  1XRE A;  3DC6 A;  1BS3 A;  3DC5 A;  3EVK A;  1VAR A;  3AK2 A;  4GUN A;  2AW9 A;  5A9G A;  3CEI A;  1MSD A;  1XUQ A;  2P4K A;  1B06 A;  3AK1 A;  3KKY A;  1IX9 A;  3BFR A;  1GN4 A;  3MDS A;  1GN3 A;  1Y67 A;  1ZSP A;  1ZTE A;  1N0N A;  1IDS A; 
#chains in the Genus database with same CATH topology
 3E86 A;  3TXQ A;  1LUW A;  2NN4 A;  3SPH A;  5LMN O;  1GTO A;  2QKC A;  4CC5 A;  4BW5 A;  1VQM V;  1WNS A;  1I94 B;  4HNA A;  2VQE O;  3CRR A;  1S5L Z;  1SC5 B;  2Q0O C;  5B5E Z;  1VQ8 V;  4J80 A;  2ZIO A;  2X0L A;  5L3E A;  4B3M B;  1R6K A;  1TUB A;  4DR7 B;  1KU9 A;  2FL4 A;  4UVC A;  2OCH A;  2JEX A;  2F23 A;  4LF8 O;  4GX2 A;  2K1E A;  1TGO A;  4GX1 A;  2ADQ B;  1QNM A;  2YIB D;  5DED A;  1BHB A;  3RN4 A;  3JAW A;  4GCZ A;  2E3C A;  3JAS A;  1Y74 A;  4DRX A;  3E89 A;  4B7E A;  2OCC B;  1NTK H;  4O4I A;  4E4E A;  4H33 A;  1RM1 B;  1SQV H;  2FYU H;  1KEC A;  2EZP A;  2ARH A;  1N33 B;  1PKX A;  1FS0 G;  5L3B A;  4FLZ A;  4WCE V;  3CX5 F;  4EFE A;  4YJ3 A;  1BE3 H;  3W7U A;  3OUS A;  3TCU A;  2CDY A;  1K5Q A;  2DW4 A;  3UM7 A;  3PN1 A;  3K57 A;  1KC8 W;  3IFX A;  2R9I A;  3K5M A;  4GUN A;  4KP4 A;  4UCU A;  5FNV B;  2QM7 A;  2EJ7 A;  3ZJZ A;  1M4U A;  1W2B U;  2CGO A;  4WBN A;  3RT3 C;  3CYO A;  1IBM O;  1M5I A;  2PYJ A;  3JAT B;  2H3O A;  2XAS A;  4MT8 A;  1VQ5 V;  2K9P A;  4TSF G;  3D3I A;  3L74 H;  5BR8 O;  1EFR G;  4XDJ A;  3UT5 A;  4ZHQ A;  1Z5V A;  3FKS G;  3HKB A;  2HEP A;  2X6C A;  2Q0A A;  4NTY A;  5H6R A;  1YEW A;  2OTL V;  4DV5 B;  5A2Q N;  2P5O A;  1EN5 A;  3K06 A;  4YY3 O;  1AVM A;  3SJC C;  5JQG B;  1MZF A;  4ASU G;  5AG2 A;  4X62 O;  1XNR B;  1IXB A;  3RYC A;  2UXX A;  3ICX A;  4MS2 A;  1S76 D;  1S3J A;  1IZ3 A;  3H1K H;  3N2G B;  2QKA A;  2X6A A;  1P84 F;  5KX5 B;  2MK3 A;  5LP6 B;  4U3F H;  1BL8 A;  2G38 A;  3JD4 A;  4DW1 A;  1GMG A;  4FZ1 A;  2Q7E A;  4DR6 B;  2YXY A;  5KHG A;  3W7S A;  4O4J B;  1FAF A;  1SZT A;  5EZY A;  2HVJ C;  4Z1V A;  1VQN V;  2Q67 A;  1F4M A;  2FTK A;  3ABK C;  4X66 B;  3F7Y C;  3T1H O;  1HNZ B;  3DTU B;  5KA6 A;  4RWU A;  4OPH A;  4IIJ A;  4LWS B;  1W0K G;  1FFT B;  1YF2 A;  3OR6 C;  2CH7 B;  2GBO A;  4BW9 A;  1Q86 W;  4ZI7 A;  1SES A;  1YHQ V;  1K5S A;  4QPJ A;  1ZWI C;  4U3J B;  1FPO A;  3ZMZ A;  3K9A A;  3VQV A;  4I55 A;  3LDD A;  2LW7 A;  2A79 B;  1H2L A;  1SQP H;  1XUQ A;  5C8Y B;  4LCU C;  4QE7 A;  5EC2 C;  2WLI A;  1M1K W;  3ZRS A;  5LMN B;  5IJ0 A;  4CS4 A;  4OPA A;  1H2M A;  2VQE B;  1ORQ C;  4JI4 O;  3N2K A;  5H2F Z;  1K33 A;  1EZV H;  2NNU A;  4I7Z B;  2Y4U A;  3SYC A;  1QHT A;  1NBM G;  2EIJ C;  3FAV A;  4U7O A;  3CRA A;  3FX7 A;  1NR1 A;  4G28 B;  4LF8 B;  2CGN A;  5LGN A;  1OCO B;  3UO3 A;  3L73 H;  2UXD O;  1O9H A;  1AI7 A;  5LA6 A;  2LGQ A;  2JRI A;  4O2B A;  2UUA O;  1FXK B;  3RVY A;  4RQE A;  5B1O A;  4KUM A;  3D36 C;  4DO2 A;  3OR7 C;  4DK1 A;  1BT8 A;  1Q3E A;  5GTI Z;  5KMG A;  2PF4 E;  3NXS A;  1JNB A;  4LH7 A;  2UXC O;  1YI2 V;  4CS2 A;  1NVP B;  3GWK C;  3JAK B;  2YIC A;  1NTZ H;  1HNW O;  1BQZ A;  3AG1 C;  1R3J C;  1DF5 A;  2P67 A;  4UV9 A;  1FXH A;  5B1N A;  1QLN A;  4DV2 O;  3SR2 C;  2ZIM A;  2LW1 A;  5L3G A;  4JI7 O;  1IBM B;  4P30 A;  1VMG A;  2IJI A;  1I5Y A;  2A0L A;  3RYI B;  2DYS B;  1FXV A;  3RYF B;  1Z2G A;  1V55 B;  4DV0 O;  5BR8 B;  4PI2 A;  4LFC O;  2QE7 G;  4FPP A;  2HG5 C;  1OCC B;  1R1B A;  2AGA A;  3VOU A;  4I5S A;  2ODM A;  5IYZ B;  4O4H B;  2WLJ A;  1SQF A;  4YY3 B;  3SYA A;  1IXM A;  3WG7 C;  3ZS8 C;  5LXT B;  5FLX N;  2OYQ A;  3SPG A;  2GSM B;  3CCJ V;  2QTO A;  1TA8 A;  4X62 B;  1S0V A;  1N36 O;  3AG2 C;  1VQ4 V;  1K9M W;  4O2A A;  4O4L B;  2UXN A;  3JD0 A;  4R6Z A;  4JAU A;  1SRY A;  5EYP B;  5KHH A;  2DE0 X;  1OCZ B;  3HKE A;  3CD6 V;  4TV9 A;  4PEL A;  2QEX V;  1EZJ A;  3W7W A;  5L3D A;  2XAQ A;  1N0J A;  1K73 W;  5BMV A;  2QWQ B;  2EIL C;  3UCS C;  2IW5 A;  2YUA A;  4NR1 A;  1V9P A;  4JAV A;  1XL6 A;  3CRM A;  1RFY A;  3SYO A;  4X20 A;  3T1H B;  1NVP D;  5LHH A;  1PL0 A;  2VRZ A;  4KHP O;  1QLE B;  4JZ2 A;  1K3E A;  1KP3 A;  3B77 A;  1CPY A;  4LC1 A;  1NH2 D;  1G6U A;  3A8T A;  3VQX A;  4RO2 A;  1V54 B;  3TJT A;  3BY6 A;  3TXS A;  5IJ9 B;  4F6E A;  2CTP A;  2Y0I A;  5IY5 B;  4AHC A;  1JCH A;  1K4D C;  4LFB O;  1VEW A;  3E22 A;  2LGW A;  1J5E O;  5IWA B;  3MHH C;  4UCR A;  1P7G A;  3CCQ V;  1SZX A;  3B40 A;  4I50 A;  3JD3 A;  3EVK A;  3U0Z A;  3B4S A;  3JSL A;  4GLX A;  2RQ6 A;  1MOF A;  3CS5 A;  4JI4 B;  1YVW A;  4GYC B;  5KAI Z;  2QGN A;  4DUY O;  4FZ0 A;  3AEI A;  4DV7 O;  2UUB O;  2OIG A;  4PDR A;  2CAZ C;  3OEE G;  5D5P A;  4HAM A;  3ABU A;  3QO8 A;  3RBZ A;  4FFB A;  2IU0 A;  2Q69 A;  4I4T B;  4PHZ A;  1M56 B;  3TK1 A;  2HLD G;  4FM2 A;  4IL6 Z;  4CBC A;  2UXD B;  1ZL8 A;  3OFN G;  1BZK A;  1WA8 A;  1XQ8 A;  4JI2 O;  4FLV A;  2Q4P A;  3K5N A;  1M57 B;  3AG3 B;  1JA8 A;  1TAE A;  3L75 H;  4CH5 A;  1SA0 B;  1W59 A;  4UXN A;  1AI5 A;  1XIL A;  1GM8 A;  3BAB A;  2JVD A;  2XT9 A;  3ZRW A;  4U7N A;  1AR1 B;  2AHZ A;  3CCR V;  2CTW A;  4I0X A;  3OW2 U;  2GTA A;  2UXC B;  5JCO A;  3HKD B;  3DSQ A;  3DXR B;  4UCO A;  1FJG O;  2FKX A;  4H37 A;  3JCU Z;  2WLL A;  2JIZ G;  4EB6 B;  1YZB A;  2XAH A;  4DV2 B;  1YIT V;  5CB4 A;  2ZXW B;  5IYD O;  4W4K A;  1ARO P;  4JI7 B;  3WB0 A;  4WFG A;  4MTX A;  3M7M X;  1Q6H A;  3ZMV A;  4N23 A;  1XDC A;  1MSW D;  4MTG A;  2E5L O;  1UJW B;  4DV0 B;  4NYK A;  5H5N A;  3QNE A;  4LFC B;  2CK3 G;  1F4N A;  4TWK A;  2HFE C;  3C3S A;  3CXC U;  4ZOL A;  4YIP A;  2GTS A;  1BSM A;  4TV8 A;  4KXR A;  2D2C B;  4NXM O;  3K5L A;  1MSD A;  1Q5O A;  1GM7 A;  5B1A B;  3APO A;  3BAA A;  3P30 A;  4WFF A;  1GK9 A;  1K7D A;  3T1Y O;  5JH7 B;  2WA3 A;  4DR2 O;  4CH3 A;  3CCL V;  1RPO A;  2BSK B;  3O9O A;  4Q6G A;  2ZCE A;  1DLB A;  4GKK O;  2EBO A;  2GUZ A;  2Y48 A;  4PI0 A;  3JCZ A;  1MMM A;  3U10 A;  4DXW A;  3ZMU A;  4PA9 A;  4DYL A;  2Q8V A;  3GVM A;  2YEV A;  4F4L A;  4DV1 O;  2JS3 A;  4JI3 O;  4YJ2 A;  1MA1 A;  3LSU A;  5JJN B;  4KHP B;  5LMU O;  3ETQ A;  4R8C A;  4JI1 O;  3MHS C;  3G4S V;  1JX9 A;  4X1I B;  4BIO A;  1ROP A;  1R3I C;  4LF4 O;  2YID A;  4NB5 A;  1WLE A;  4NTW A;  3K0D A;  2Y69 C;  3G67 A;  3RW0 A;  2BTQ B;  5KHK A;  1J5E B;  2IBZ H;  4JAS A;  2KB1 A;  1EM1 A;  1NI8 A;  2JEU A;  1N4C A;  1MG1 A;  1PPJ H;  4QGP A;  4QE9 A;  3K08 A;  4K0K O;  4DUY B;  5CA1 A;  4DV7 B;  2UUB B;  3ASN B;  2A06 H;  1GH6 A;  4PDL A;  1P49 A;  2BE3 A;  3KCY A;  4J9Z B;  4X1K B;  1OHH G;  5FPR A;  2PZS A;  4K8Z A;  4YHH O;  2ZIN A;  3WU2 Z;  3ABM C;  1Q82 W;  1OCR C;  3T4D A;  3BA8 A;  3K5O A;  3QO5 A;  4JI2 B;  2DYS C;  1B04 A;  3CCU V;  1FYJ A;  2CTR A;  3CRC A;  3L71 H;  3GWO A;  3OEH G;  3ASO C;  4B3T O;  1S5J A;  5HFM A;  1N0N A;  3CC4 V;  4DR5 O;  1H38 A;  3OTO O;  1JMK C;  1H2G A;  2YI8 A;  3ZBH A;  5LL6 Y;  4JYC A;  2F93 B;  3OGI B;  2DYR B;  4J11 A;  2R72 A;  2ETN A;  2D3O W;  1FJG B;  1JR9 A;  1U96 A;  5FPO A;  1URF A;  1FFX B;  3EXA A;  2JGD B;  4EEQ A;  5LOV B;  3BPZ A;  1OCZ C;  2CE4 A;  3F5T A;  3CCV V;  4NKG B;  4BIZ A;  1BQ0 A;  1VQO V;  4PJ0 Z;  1WB8 A;  4JYY A;  3LNM B;  4H13 B;  1PL4 A;  2BOC C;  2WLH A;  4LF7 O;  1ZUQ A;  2E5L B;  5CBG A;  3BRC A;  3CWB H;  2RDC A;  1VQ6 V;  1QVF U;  2AZ0 A;  3R66 A;  5FNV A;  2Y0P A;  3FYE B;  3ZRV A;  3SYQ A;  3ML0 A;  3ZMT A;  3JAT A;  4D7S A;  2HHH O;  4NXM B;  3H01 A;  4I9W A;  1XMO O;  5B3S C;  1QCE A;  1IBK O;  1BMF G;  1ZAU A;  1F51 A;  5KA5 A;  1DTO A;  3OMI B;  1PNK A;  1NTM H;  2ZE7 A;  4JGS A;  1S72 V;  5JJJ B;  2EIK C;  3OE7 G;  1R6T A;  5H6Q A;  5ITZ B;  3LSS A;  3T1Y B;  4HBN A;  4DR2 B;  2V7Q G;  5FL7 G;  5A9G A;  1BHA A;  3D3Q A;  5JVD B;  2UXB O;  2P4K A;  4GKK B;  4FK5 C;  1N34 O;  1H5W A;  1Z5W A;  4PA4 A;  5CN0 A;  4HYO A;  1YJN V;  2C2A A;  3N2G A;  3E8H A;  2F95 B;  3MDS A;  4DV1 B;  1ENV A;  5EBW C;  1WP7 A;  1UFI A;  4JI3 B;  2JJ1 G;  1KP2 A;  3RVZ A;  3CJH B;  2OTJ V;  4MW3 A;  5KX5 A;  2N04 A;  4WFA V;  5LP6 A;  5JCO C;  1JPX A;  3HKC B;  5CA3 A;  5J9P C;  1FKA O;  1HNX O;  4JI1 B;  4W4L A;  4LNU B;  4O4J A;  4LFA O;  2IU3 A;  1NKD A;  2W6J G;  3C90 A;  1EN4 A;  1M56 C;  4JI0 O;  4LF4 B;  3THO A;  2XAJ A;  2VQF O;  5LYJ B;  3E8B A;  3CSX A;  4Z1M G;  3ZHT A;  4LWS A;  4LR3 A;  1HW7 A;  2YI9 A;  4K35 A;  1PD3 A;  3AG3 C;  2ZQM A;  2CH7 A;  1J95 A;  1I0H A;  4PDM A;  3DGE A;  1L1F A;  2LQT A;  4U3J A;  4X65 O;  5B1B B;  3S3W A;  3P3P A;  1KKD A;  4TQF A;  2WWW A;  2KG7 B;  2W0X A;  1GN6 A;  5E1A C;  1OZ0 A;  4ZKI A;  4DUZ O;  3JAL B;  4K0K B;  5C8Y A;  4PD4 F;  2B9Z A;  4P9O A;  3K0G A;  1I5X A;  2F4V O;  1QVG U;  1CP9 A;  4YHH B;  2RJZ A;  4GX5 A;  1R3L C;  2WLM A;  2ZXW C;  2WAM A;  2QTS A;  4X64 O;  1VQK V;  1XOU A;  2QM4 A;  4X1Y B;  2F43 G;  3ABL B;  5HFL A;  3W7X A;  4JI5 O;  1BS3 A;  3X2Q B;  3T2M A;  3L9D A;  5BXZ A;  4JYA O;  2RNB A;  4MSW C;  4DV3 O;  4B3T B;  1Q43 A;  4J7J A;  4TUY B;  4DR5 B;  4L87 A;  3OTO B;  4CH6 A;  1SQG A;  1HDJ A;  1JOY A;  5EC1 C;  3ETG A;  3K59 A;  3CCS V;  1L0L H;  3LNN A;  3R65 A;  4UCV A;  2EJR A;  1YTF B;  1U97 A;  2XHB A;  3CCM V;  1TVK B;  2Z3Y A;  2P4V A;  1I08 A;  3ABT A;  1GM9 A;  5BZB A;  4MVS A;  2QA4 V;  3ZHU A;  4NTX A;  1Y76 B;  3JAK A;  3HKE B;  4ABM A;  3H1L H;  1PV0 A;  3W7T A;  4J7K A;  3Q4H B;  3B8N A;  1VQP V;  4LF7 B;  1JJ2 U;  1FOU A;  3P32 A;  1JFF B;  4TOI A;  2A9H A;  3JSN A;  1F7Y A;  4QNH B;  2Y4T A;  5LGT A;  3STL C;  1YCI A;  3ZHQ A;  2GV9 A;  1GRJ A;  3AK3 A;  3RYI A;  2HHH B;  3BEH A;  3RYF A;  1XMO B;  4LF6 O;  3AG4 B;  2EIM C;  2AHY A;  1IBK B;  4AQY O;  2CTQ A;  3CC7 V;  3I55 V;  3UO2 A;  2ZNJ A;  2V4D A;  2P6J A;  1AJP A;  1CXZ B;  2JK5 C;  2RN9 A;  1VF5 B;  5IYZ A;  5E79 Z;  1DF4 A;  2VS0 A;  2UXB B;  1WN7 A;  5LXT A;  1N34 B;  4IGG A;  1SER A;  3KCX A;  3ZN0 A;  4DR3 O;  4O4L A;  2A3Q A;  5EYP A;  3N27 A;  1K92 A;  2DWD C;  1VF7 A;  3G71 V;  1VP7 A;  5H9C A;  4PDV A;  3BFR A;  1HNX B;  2HR3 A;  1IJG A;  2OCC C;  4PA3 A;  4LFA B;  3JAM N;  1RM1 C;  3RGB A;  3S3X A;  4KFM A;  1N8R W;  1LNQ A;  3G6B A;  3ABK B;  4JI0 B;  1RSO B;  4PA6 A;  3BVO A;  4C7U A;  2VQF B;  3JAR B;  1Q90 D;  3TET A;  3OM3 B;  4UVA A;  2EIN B;  3OGC C;  1CEZ A;  3ZX6 A;  3QF7 A;  3ZN1 A;  2EZO A;  2DN9 A;  3L72 H;  5IJ9 A;  4X65 B;  3LDE A;  1YXB A;  2UUC O;  4F6R B;  3CP1 A;  5J2U B;  3CRQ A;  1P4R A;  2P7T C;  4DUZ B;  5CA0 B;  3FFQ A;  1S77 D;  2UUA B;  2QWO B;  2PUS A;  2P06 A;  2F4V B;  2QKS A;  3TGU H;  1PM9 A;  3A0B Z;  2WLN A;  1SQQ H;  4Z2W A;  1AR5 A;  1JQ0 A;  1HWY A;  1QR9 A;  4X64 B;  3QVN A;  1PP9 H;  1N32 O;  4G27 B;  2KKW A;  3ZRX A;  3ZCC A;  3K9S A;  4JI5 B;  1E1Q G;  3RYH B;  1XHZ A;  3H1I H;  1HNW B;  4JYA B;  5J2T B;  5K1X A;  1NT2 B;  2EIJ B;  4I4T A;  3CMA V;  2LFR A;  1QQC A;  4OXS A;  2DOS A;  3ETE A;  1F23 A;  1XRE A;  1AJQ A;  1DGS A;  4K3A A;  4J10 A;  2PYL A;  1KB9 F;  2AW9 A;  3IC7 A;  3LUT B;  2IJK A;  2WA4 A;  4DV4 O;  4CH4 A;  1EBO A;  5LP6 C;  4WFE A;  2ITD C;  1SA0 A;  3OMN B;  3FD9 A;  3AK1 A;  5GON B;  4ZBM A;  2RMK B;  1YSC A;  4FM0 A;  2ZR3 A;  4DR1 O;  4D6T H;  2B1I A;  2YIA A;  2B5U A;  3ZMS A;  3CPW U;  1D5A A;  3HKD A;  4IHJ B;  2X7R B;  4JV5 O;  4LF5 O;  3KZI Z;  1THZ A;  2HP8 A;  2XOK G;  4JI8 O;  1IBL O;  3DXR A;  4XDK A;  4MVR A;  4BR6 A;  2XND G;  4RUF A;  2GUZ B;  3F7V C;  2R9A A;  3FB8 C;  1XNR O;  4DW0 A;  3I5D A;  4OX9 O;  4EB6 A;  2ADP A;  1KQS U;  1N36 B;  1JJO A;  3EHB B;  4X88 A;  1HP8 A;  2LP7 A;  3B2E E;  4WF9 V;  2ZKO A;  4LF6 B;  2FML A;  2IJJ A;  2Z5U A;  1Y6X A;  4AQY B;  1GO3 F;  1XMQ O;  2N05 A;  5D5Q A;  2H94 A;  1KKC A;  1HR0 O;  1L8D A;  4P9P A;  1FD9 A;  1XHX A;  3EFF K;  1H2K A;  4HNA B;  2F1M A;  3QG5 A;  5IDJ A;  1AI6 A;  2QM8 A;  1Q6I A;  4JAA A;  4BWA A;  5DN6 G;  3C3T A;  1TUB B;  2ZE6 A;  3AG2 B;  4DR3 B;  5JH7 A;  4J41 A;  1Q81 W;  1WB7 A;  2BSK A;  1R3K C;  1OCO C;  4MVQ A;  4CC6 A;  4LFB B;  3UQ8 A;  1EN6 A;  1FXK C;  4DK0 A;  2LFS A;  3JAW B;  3FB6 C;  3JAS B;  1Y74 B;  2QWP B;  4DRX B;  5LGU A;  3BCC H;  2EIL B;  3G80 A;  4O4I B;  2M6Y A;  3E8F A;  4LBE C;  3CXH F;  4OGQ B;  1TUE B;  4FLW A;  1Q6U A;  1YJ9 V;  4YJ3 B;  2DQ0 A;  4PA7 A;  4UB6 Z;  2AZ2 A;  3ABL C;  4D7T A;  3X2Q C;  2NLJ C;  5KLV H;  3IJ4 A;  5EBM C;  1Y67 A;  2GHY A;  4DV6 O;  2OWO A;  5EK0 A;  2QR4 A;  5C93 A;  4X1I A;  1AP6 A;  2UUC B;  4RAI A;  2ITC C;  3GB7 C;  4WBN B;  4FLY A;  2JDI G;  3BA9 A;  4X89 A;  2N74 A;  2BTQ A;  4IYI A;  4B3R O;  3K58 A;  1V55 C;  5EIB D;  3OMA B;  3UT5 B;  4ZHQ B;  1US6 A;  3HKB B;  4ICG A;  1YDX A;  1OCC C;  3E8G A;  4J42 A;  2EUL A;  1N32 B;  5DEC A;  4R7C A;  2ZM6 O;  2M7W A;  1QBZ A;  2QDO A;  3SPI A;  4X1K A;  4PV1 B;  2RCV A;  5IT9 N;  3RYC B;  3RWR D;  4KL1 A;  1NR7 A;  2PTM A;  2E74 B;  3ZHR A;  2LO1 A;  3MD0 A;  4DR4 O;  1KYO F;  3U11 A;  3AG4 C;  4UV8 A;  4DV4 B;  3IC9 A;  5GW7 A;  5CMU A;  1QU7 A;  2XTA A;  3I56 V;  1L0N H;  3K04 A;  5KAF Z;  1AB3 A;  5EZY B;  1H2N A;  4DR1 B;  2R9R B;  1S5H C;  3ZHV A;  3QO7 A;  4X8A A;  1XBL A;  3CHX A;  4RQF A;  4JV5 B;  4LF5 B;  1QLE C;  4JTC B;  3IAY A;  4JI8 B;  1IBL B;  4IIJ B;  4FM1 A;  4TQD A;  1QR8 A;  1SKV A;  2YXH A;  3LSQ A;  4GT1 A;  2Q73 A;  4OX9 B;  2Q5Z A;  4LF9 O;  4AI8 A;  5KUK A;  3IGA C;  1FFX A;  3M8A A;  4ZI7 B;  1VQ9 V;  2JGD A;  1V54 C;  1Y4M A;  3QTC A;  2JS5 A;  1VF6 A;  5LOV A;  1M90 W;  2ZNI A;  4TT3 G;  5IY5 C;  2ZD9 A;  4I55 B;  2DQ3 A;  2W0F C;  2ATK C;  3SJB C;  4E2L A;  3SGI A;  2ZT9 B;  1PNL A;  1KD1 W;  3CC2 V;  5JQG A;  1XMQ B;  1HR0 B;  4P2Z A;  1NQT A;  1XEQ A;  2Q9L A;  2WLI B;  1ZLZ A;  2VWK A;  1SQB H;  1UPG A;  1AIL A;  5IJ0 B;  2XUM A;  4MVU A;  3WB2 A;  1BCC H;  2ZDI A;  1G1X B;  3B8M A;  3N2K B;  4JZG A;  5LMU B;  4YIO A;  5CBH A;  3J81 N;  4LP8 A;  2EIN C;  2ILM A;  3SJQ C;  1OV9 A;  3JD2 A;  4JYB A;  2PI5 A;  1GAX A;  1E1R G;  5ITZ A;  1MAB G;  3FAV B;  2O57 A;  1D2D A;  4X9Q A;  4UVB A;  5LHI A;  5CBF A;  3ZED A;  5JVD A;  1W0J G;  1VIB A;  1R73 A;  1SET A;  5LA6 B;  1K34 A;  4YXW G;  4O2B B;  3VQW A;  1I7F A;  4FLX A;  1M57 C;  5IWA O;  2BCC H;  3JYC A;  3HPL C;  1WAZ A;  4FVM A;  2HVK C;  3JD1 A;  4Q20 A;  3CJH A;  3HR0 A;  3H9V A;  2FB5 A;  5KMG B;  3DC6 A;  1SQX H;  1GKF A;  3KDR A;  3DC5 A;  2Q7H A;  3HKC A;  3PJS K;  4B3S O;  4LNU A;  3FB5 C;  2JGU A;  4DV6 B;  3VBB A;  3K03 A;  1RPR A;  1KMI Z;  2YDE A;  4RUE A;  3K3W A;  5IE9 A;  4NXN O;  5LYJ A;  1K8A W;  2UU9 O;  3BHP A;  1GN4 A;  1E79 G;  2KSD A;  3A0H Z;  4XDL A;  5B66 Z;  1ZSP A;  2Y69 B;  4K8X A;  1WJZ A;  4B3R B;  5L3F A;  2KQX A;  4CZZ A;  3T4Z A;  3HB3 B;  1G4Y B;  2WLK A;  1AJN A;  2DJV A;  2KG7 A;  1NS1 A;  4LH6 A;  2YSU B;  4JF3 A;  4JTA B;  2GDS A;  3B09 A;  2V1D A;  3JAL A;  1FXK A;  4JPR A;  2QWR B;  3AG7 A;  1WP8 A;  2ZM6 B;  2ZR2 A;  4JI6 O;  2Q6A A;  4G2K A;  5B1A C;  1LUV A;  4GKJ O;  1D5N A;  5BY1 A;  4UCS A;  2X6B A;  3SYP A;  1NH2 B;  2PI4 A;  1VQ7 V;  3STZ C;  4O2A B;  3ABM B;  1OCR B;  1AP5 A;  4X1Y A;  4DR4 B;  1DK1 A;  1BGY H;  2R70 A;  4R50 A;  4TV9 B;  4FMT A;  4HZ3 A;  4NVP A;  5BMV B;  3O65 A;  4FJC C;  1PNM A;  3ASO B;  4H44 B;  4QJF B;  4TUY A;  4I9Q A;  1K97 A;  5EIB C;  4X20 B;  2PGG A;  5LBQ A;  1Q7Y W;  1IUR A;  3SDL A;  1GN2 A;  1SS3 A;  1TVK A;  2QWN B;  2BOB C;  3H1J H;  4BAY A;  1VAR A;  4LF9 B;  3F5W C;  3D8C A;  3CCE V;  4IYH A;  1VQL V;  5KUM A;  3FYI B;  2P90 A;  1Y76 A;  5LHG A;  4O4H A;  4CS3 A;  1IVS A;  3G6E V;  1AI4 A;  5IYB O;  1M9N A;  3Q4H A;  4QIW F;  3VQY A;  1XNQ O;  5L3C A;  3SPJ A;  1JFF A;  3E22 B;  1YJW V;  3RFR A;  3OUF A;  4ZIB A;  2IM9 A;  5K1P A;  4FIP C;  1IDS A;  2HJD A;  2IH1 C;  3LDC A;  4I50 B;  1A32 A;  2HJF C;  4A5U B;  1MNG A;  4FFK A;  2MW2 B;  2Q68 A;  5B3S B;  1P7B A;  1ZX3 A;  1YTF D;  1COW G;  3ASN C;  1O9G A;  1NJI W;  1AR4 A;  2EIK B;  3L70 H;  2F66 C;  4FFB B;  3K79 A;  1I94 O;  4UFZ A;  4BIU A;  1X59 A;  2LJ2 A;  1JVM A;  1ZL8 B;  3J80 N;  2VWJ A;  1WA8 B;  3A0R A;  4B3M O;  1WPX A;  5JWP A;  3ZHS A;  4GZR B;  4MVZ A;  3OTF A;  4DR7 O;  4UUJ C;  3M99 B;  4MTO A;  2XAG A;  2ZE5 A;  3ZRW B;  4H0L B;  2QSA A;  4B7K A;  4I0X B;  2Q7G A;  2EX3 A;  2OIE A;  4B3S B;  1R6N A;  2DYR C;  2JJ2 G;  2E75 B;  4QPK A;  2L35 A;  3E83 A;  3MAQ A;  4MVM A;  1N33 O;  2WLL B;  4NXN B;  4J9Y B;  1RSO A;  2XAF A;  2AXT Z;  3KG2 A;  2DMX A;  3JAR A;  2UU9 B;  5CB4 B;  5DM6 V;  1VF6 C;  3A2F A;  1B6Q A;  1SF9 A;  2BTO A;  3CEI A;  2DWE C;  3WB1 A;  4EKW A;  3OD4 A;  3APQ A;  1B06 A;  2Z0A A;  4L8J A;  3KKY A;  4GX0 A;  1IX9 A;  3J7A U;  4DV3 B;  5KHJ A;  4WFB V;  3CME V;  4F6R A;  4IT5 A;  5J2U A;  2A7W A;  1GN3 A;  5KHI A;  2HKO A;  3E35 A;  1H8E G;  4ZOL B;  5CA0 A;  3ETD A;  1H8H G;  4TV8 B;  2ZDI C;  4WFH A;  3CB2 A;  3UKM A;  4JI6 B;  4AIL C;  2B1G A;  2WPD G;  5JJE B;  1MZE A;  1OJH A;  2YXL A;  2CUG A;  3SJA C;  1YIJ V;  4GKJ B;  5EBL C;  4EFB A;  5GTH Z;  1KBH A;  1T5E A;  4B08 A;  2IH3 C;  4DV5 O;  3RYH A;  3T1C A;  3SPC A;  4MVO A;  5J2T A;  1NZ6 A;  3AG1 B;  2P22 C;  3E2E A;  2PY5 A;  3NR7 A;  4N21 A;  3CE2 A;  4FLU A;  1B3Q A;  2YC0 A;  1LR1 A;  2YEV B;  4YJ2 B;  2W6I G;  1H2S B;  5F2V O;  1WPB A;  4MTF A;  1NU1 H;  1M93 A;  3OT7 A;  3D36 A;  5GON A;  1XL4 A;  4DR6 O;  1Y66 A;  2E76 B;  3OAA G;  3ZIA G;  1XI1 A;  2IJH A;  2H8P C;  2QJ1 A;  4JTD B;  4X66 O;  2ZE8 A;  1Q8I A;  4IHJ A;  5IYC O;  1HNZ O;  1RP3 B;  4UCT A;  4FLT A;  2WSS G;  3H1H H;  1XNQ B;  2YS8 A;  4MW8 A;  3AK2 A;  3WG7 B;  2NR5 A;  2OT5 A;  4J7Z A;  1KUQ A;  1X4T A;  5B1B C;  1K4C C;  5TIS Z;  4UB8 Z;  3WFV A;  1G8M A;  4XBF A;  2EIM B;  2YIB A;  1ZTE A;  5CA1 B;  3FB7 C;  2L6L A;  3P3N A; 
#chains in the Genus database with same CATH homology
 4BR6 A;  1LUW A;  4C7U A;  1AP6 A;  1I08 A;  2QKC A;  1MNG A;  1MMM A;  4FFK A;  1EN5 A;  2ADP A;  1JA8 A;  1AVM A;  1MA1 A;  1ZLZ A;  1EN4 A;  5AG2 A;  1IXB A;  1XIL A;  2GDS A;  3LSU A;  1N0J A;  1AR4 A;  1JR9 A;  2QKA A;  1LUV A;  1D5N A;  1KKC A;  4JZG A;  4YIO A;  2CE4 A;  1I0H A;  1BT8 A;  3AK3 A;  1WB8 A;  4JYY A;  2ADQ B;  1PL4 A;  1QNM A;  4JZ2 A;  1ZUQ A;  1AP5 A;  3RN4 A;  4X9Q A;  1PM9 A;  1GN6 A;  2RCV A;  1AR5 A;  4E4E A;  3TJT A;  3QVN A;  3C3T A;  3OT7 A;  4F6E A;  1XDC A;  1EM1 A;  3K9S A;  1WB7 A;  1VEW A;  3IC9 A;  3C3S A;  2CDY A;  1GN2 A;  4YIP A;  1P7G A;  1EN6 A;  1BSM A;  1SZX A;  1XRE A;  3DC6 A;  1BS3 A;  3DC5 A;  3KDR A;  3EVK A;  1VAR A;  3AK2 A;  4GUN A;  2AW9 A;  5A9G A;  3CEI A;  1MSD A;  1XUQ A;  2P4K A;  1B06 A;  3AK1 A;  3KKY A;  1IX9 A;  3BFR A;  1GN4 A;  3MDS A;  1GN3 A;  1Y67 A;  1ZSP A;  1ZTE A;  1N0N A;  1IDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...