4JZGA

Crystal structure of a single cambialistic sod2 occupied by manganese ion from clostridium difficile
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
202
structure length
202
Chain Sequence
NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Crystal structure of a single cambialistic SOD2 occupied by Manganese ion from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Oxidoreductase
total genus 72
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4jzgA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4jzgA02
2GDSA 3AK3A 1SZXA 1XDCA 1P7GA 1WB8A 1EN4A 2P4KA 1EN5A 2ADQB 1BSMA 1AVMA 2CE4A 3KKYA 1GN2A 1N0NA 1I08A 2QKAA 1AP6A 1GN6A 3C3TA 1GN4A 1Y67A 2QKCA 3BFRA 3QVNA 5A9GA 1VARA 3CEIA 1ZTEA 3DC5A 4X9QA 1ZLZA 1QNMA 1BT8A 1GN3A 4JZGA 1IXBA 1XUQA 1MA1A 3RN4A 3DC6A 3EVKA 1B06A 3TJTA 1WB7A 1I0HA 1AR4A 3MDSA 1VEWA 1LUVA 2AW9A 1JA8A 3LSUA 4BR6A 1JR9A 1N0JA 4F6EA 1KKCA 1IX9A 1MSDA 1PM9A 1ZUQA 1D5NA 2RCVA 4C7UA 1MMMA 3OT7A 5AG2A 4YIPA 1EM1A 1AP5A 3AK2A 3AK1A 2ADPA 1MNGA 3IC9A 1PL4A 1LUWA 1XILA 3C3SA 1BS3A 4FFKA 4YIOA 3K9SA 4JZ2A 4GUNA 2CDYA 1XREA 1AR5A 4JYYA 1EN6A 4E4EA 1IDSA 1ZSPA
chains in the Genus database with same CATH superfamily
2YEVB 5EBMC 4H44B 3SR2C 4LFAO 2WLIB 3H1JH 2EIMB 4CH6A 2EINB 3CRAA 1AI4A 3L73H 4KXRA 3GB7C 2B1IA 4XDJA 4CS2A 4EFBA 1QLEB 1DF4A 5H6RA 2BSKA 1Q8IA 1HR0B 5IJ9A 1FFTB 4QNHB 2OIGA 4J41A 4PHZA 1YCIA 3H1LH 2PI5A 3APOA 2BOBC 5JWPA 1NH2D 3ABLB 4KL1A 4DXWA 5ITZB 3LDDA 4X9QA 5IYBO 1ZLZA 1M9NA 1GN3A 2ZNIA 4K0KB 1HW7A 2BTOA 4ZHQB 3OUFA 3DXRA 1M93A 2EIJC 3CJHB 1FXKC 2WA4A 1L0NH 3CRMA 3WB1A 3I56V 1FJGO 4MW3A 1I94B 4FMTA 4LH7A 2WLJA 1BL8A 4NTYA 3CCEV 1K7DA 1OCZB 4UFZA 2QWNB 3ZHTA 5IWAO 3RYCB 4N21A 1MSDA 5CA1A 4JYAO 4JI2O 4DV5B 2WWWA 3JCUZ 1MMMA 3SPCA 3AG2B 4I50B 5H9CA 3SGIA 1G4YB 1WA8A 1NJIW 1G8MA 3ZN1A 5C8YB 2W6JG 4UCOA 3O65A 4IGGA 1BHBA 5JJNB 2CDYA 1AR5A 1WPBA 1THZA 3QTCA 1U97A 4IYIA 1WLEA 2FTKA 1UPGA 4MVQA 3R65A 1AILA 1RP3B 3G80A 1Y74B 3CRRA 2RMKB 3AG3B 3CPWU 1RM1B 2GDSA 4ZOLA 3RYFB 3K04A 2JVDA 4BIOA 2ZDIC 4QPKA 2YXLA 1TVKA 2PYJA 2YI8A 3SJCC 4D7SA 2JJ2G 4DV3B 3JALB 4X1KB 5DEDA 3JATA 3ZRXA 4JV5O 4G2KA 2Y4TA 1GAXA 1WJZA 5IYDO 4TUYA 3CMEV 3UM7A 1NQTA 5A9GA 2XNDG 4IL6Z 4JI8O 2QWRB 1QVGU 1V55B 4RQFA 1FXHA 1IURA 4DRXA 2JDIG 2Y0IA 4IIJA 1OCCB 3GVMA 3J80N 2Q4PA 1S5JA 4W4KA 1JCHA 3U10A 4R7CA 4RWUA 4U3JB 4Z1MG 1N34B 2RQ6A 2R9RB 1VF5B 1HNWO 3CC4V 3DSQA 2IJJA 2JRIA 2ITDC 3QO7A 4PELA 4DR4B 4WFEA 2N04A 2P22C 4KUMA 3HPLC 5EIBC 3T2MA 3CE2A 1PM9A 4QE7A 1L1FA 5B66Z 2R72A 4OX9B 1F4NA 3JSLA 2PF4E 5IE9A 3TXQA 3AK1A 3B8MA 4GLXA 3FX7A 3C3SA 1HR0O 5B1AB 2EINC 4MVRA 1P4RA 4KFMA 1I7FA 3CCSV 3A0BZ 3W7TA 1QU7A 2YS8A 1QLEC 5CN0A 1Q6IA 4O4JA 2VWJA 3N2GA 3R66A 5BMVA 1ZSPA 4LNUA 2P6JA 4WFFA 3GWKC 4K0KO 3BVOA 2NNUA 4MS2A 3O9OA 4LF4O 3ABLC 4PI2A 3I55V 1BSMA 4TV8A 2DYSB 1YDXA 4LF5B 4J9ZB 3AG7A 4O2BA 4PA3A 4XDLA 2F23A 3JD1A 1LR1A 1PV0A 3JAKB 2P5OA 3C3TA 3P3PA 4FLVA 1OV9A 1ZL8B 4X66O 2XAHA 2ZE6A 3T1CA 5CA1B 1RSOB 1Q7YW 1D2DA 4RO2A 3BA8A 2XTAA 4TQDA 1BT8A 1NVPB 3E22B 2UU9O 4J9YB 3G4SV 1IBMO 1DTOA 1AJQA 4UVBA 2GTAA 2MK3A 5JVDB 5F2VO 3TJTA 2OCCB 1NI8A 4FZ0A 1SQBH 4X65O 2IJIA 1H8HG 4NR1A 5KMGB 2VQEB 4UCVA 3K9AA 1EBOA 1H8EG 2EILC 1ZUQA 1US6A 2YIDA 2CK3G 3AG3C 3SYAA 3OT7A 4H13B 1RM1C 1OHHG 1WP8A 4U3FH 1X59A 3BA9A 4DK1A 5LGUA 5K1XA 1MNGA 2ATKC 2RDCA 4TV9B 1XMOO 5CBGA 2HHHO 4FFKA 4JI6O 1YJWV 4NYKA 4TWKA 3SDLA 4X20A 4X64B 1PPJH 5D5PA 3ZMUA 2V7QG 3CXHF 2P67A 2X7RB 2KG7A 4YY3O 3L72H 1F51A 2CTRA 3OR6C 1TUBA 4YJ2B 3VQWA 4DR5B 1HNZB 2PZSA 1M56B 1NU1H 1LNQA 3AEIA 2NR5A 3W7WA 5LA6B 1V55C 3QG5A 2FYUH 1YF2A 2YIAA 3K08A 4UVCA 4NXNB 3KKYA 1Q3EA 4HNAB 4LF6O 4FLYA 2PUSA 4JI5O 1OCCC 5FNVA 4DV2B 1B6QA 2Q73A 4UV9A 1PNKA 5LMNO 3CRQA 1Z5WA 1ZTEA 4ZI7B 5IYZA 3W7UA 1EZVH 5LOVB 4NB5A 5GW7A 4NVPA 4DR6O 2PY5A 2LGWA 2XAGA 3A0RA 4GZRB 2QTOA 1T5EA 5JCOC 4P2ZA 4JI0B 1W0JG 1GK9A 2K1EA 2OWOA 3T1HO 3Q4HA 3ZX6A 4B3SB 3ETEA 1JR9A 4ZBMA 5B1AC 2FKXA 3N2GB 4CS4A 1W2BU 4LFAB 4E2LA 1J5EO 4UB8Z 5L3BA 1QCEA 2Y48A 1D5NA 5E1AC 1K4DC 3H1IH 4TV8B 1JNBA 3FB8C 2QM7A 4FJCC 1X4TA 4RQEA 5H2FZ 2F4VO 4CC5A 4Z2WA 4F6RA 1LUWA 1W59A 4Q6GA 1Z5VA 3D8CA 4PDMA 1GTOA 3H01A 4I0XA 2G38A 2ZT9B 1I5XA 4I7ZB 2DYSC 2QM4A 5EBWC 1TA8A 1SETA 1NR7A 2F93B 4K8XA 1H2NA 3OGIB 4I4TA 3LDCA 2C2AA 1VF6A 2IJKA 3W7XA 3HR0A 1J95A 1PNMA 2EJRA 2Q0AA 4X1IB 1FXVA 3F5TA 4DV6O 4DR3B 3TGUH 2XUMA 1FJGB 4PA7A 2CE4A 1O9GA 5KHGA 3UCSC 1VQ8V 1R6NA 1AJNA 3ZRSA 2P06A 4G27B 2Q6AA 2H3OA 2EIKB 2OCCC 5IWAB 2LO1A 2CH7B 1E1QG 3IGAC 3RW0A 4JYAB 3WFVA 1AB3A 4FZ1A 1TUEB 4LWSB 1IBLB 1NH2B 3F5WC 2PGGA 2UUCO 2A7WA 2VQFO 3RN4A 2ZE5A 3ASNB 1BMFG 3JAWA 1BHAA 4B7EA 4PA9A 2LGQA 1JA8A 1Q6UA 2RN9A 1AI5A 2HVKC 1VQ6V 1N0JA 3ZHSA 1HNZO 1JOYA 2LQTA 2UUBO 5FPRA 1IX9A 3D36C 2ARHA 3ZRVA 5EZYA 5KA6A 1KKDA 1XNRO 5LXTA 4QE9A 5AG2A 4GX5A 1M56C 1AP5A 4JV5B 2VRZA 2DWDC 4JYBA 2V1DA 2QE7G 3TCUA 3VQXA 5FNVB 4TOIA 2A0LA 4DV2O 2UXNA 1G6UA 1SZTA 3H9VA 4DR1O 1SQVH 1YTFB 2M6YA 5HFMA 4JI8B 1H5WA 1NS1A 3TETA 3HKDA 4HAMA 3ZIAG 3ZHRA 3K5NA 2CGNA 3BAAA 3E8FA 1VQ7V 1P7GA 2HVJC 1Q43A 1NT2B 3CWBH 4FLZA 3RGBA 2E5LO 3W7SA 4UCTA 3CRCA 3CS5A 2ADQB 2ZM6B 3S3WA 2OTLV 2QKAA 4FLWA 3HKCA 1HNWB 3BHPA 4RUEA 4Z1VA 3VQVA 4ZKIA 2WLNA 4PD4F 5DM6V 2CUGA 1CEZA 2AZ0A 4JI7B 2WLLA 2ZR2A 1WP7A 4DV0O 1BGYH 3LSSA 1VQLV 1YEWA 3FFQA 4PI0A 5L3EA 2P90A 1XUQA 4YJ3B 3RFRA 2JS5A 2B1GA 3MHHC 2ILMA 1VF7A 2DW4A 1OCOC 4I0XB 5D5QA 3E86A 4GKJO 1QBZA 2IU3A 2IH1C 3A0HZ 1N36O 2XAFA 5LGNA 1JQ0A 4WFAV 1KC8W 4LF7O 1QR9A 4MTOA 1ZAUA 1D5AA 2IM9A 4BW5A 2YDEA 2YICA 1B04A 4C7UA 3FB6C 3SPGA 3CMAV 4LF4B 2DJVA 3CC7V 4UV8A 4DR3O 2JGUA 3QO8A 5IJ0A 2B9ZA 1PL4A 5CBFA 2UXDB 3PN1A 2QM8A 4FM2A 2Q9LA 2EULA 5FPOA 1JMKC 4X66B 3JARA 1XNQO 5GONB 1V54B 2QA4V 4E4EA 5LP6C 4IHJB 3HKBA 2OTJV 1SA0B 1K33A 1IBLO 2EBOA 2EIKC 3VQYA 4R6ZA 5EC2C 3T1YO 2UU9B 1IBMB 2YIBA 4DV4O 5FLXN 4O4HA 1Y6XA 3FAVB 2R9AA 5KHHA 1EN5A 2LW1A 3K58A 4X65B 4JASA 5IYCO 1YTFD 2JGDA 4CH4A 3FKSG 4DUZO 1M5IA 4X8AA 4EB6A 2X6BA 4R8CA 1JFFA 1XL4A 2JK5C 3FYEB 1XMQO 1BQZA 1N4CA 3ABMB 2UXBO 5CA3A 1YZBA 4CZZA 4JPRA 1XL6A 4DR2O 2ZXWB 3SJQC 4D7TA 2H8PC 1SF9A 2Z5UA 1IJGA 1RPOA 1CPYA 1MA1A 2HG5C 5JJEB 5CMUA 1XMOB 2HHHB 4JI6B 1WB7A 4O2AB 2YXYA 4I55A 5CA0A 1AI6A 2HEPA 3E8HA 4LFCO 4X62O 5B3SB 4RAIA 4JI3O 3OGCC 5KAFZ 4FLUA 5K1PA 4YY3B 4MVOA 3ZHVA 4B08A 2HFEC 4PDVA 5GTIZ 4GT1A 1M57C 1SERA 3HKEB 1S5LZ 4EEQA 1WNSA 4UUJC 5KAIZ 3ZHQA 4FFBA 4X1YB 3EHBB 2D2CB 4LF6B 3E89A 1N8RW 2N05A 2ZM6O 4JI5B 3FYIB 5BZBA 1FPOA 3L70H 2PI4A 5EK0A 3RYHB 1P84F 3BY6A 3L74H 3ZRWB 3K9SA 4GX0A 5J2TB 4B7KA 4H33A 1R73A 2WLKA 5LYJA 5KUKA 5LMNB 1IZ3A 4JI7O 2O57A 4OGQB 4DR6B 3CCLV 1BCCH 4JGSA 3LSQA 3OTOO 1WB8A 3IFXA 2BSKB 2H94A 4CH3A 5IJ9B 2EIMC 3BPZA 4DK0A 3T1HB 2ODMA 4DV1O 2ZE8A 4B3MO 1N0NA 4O4IA 1DF5A 3JASA 2PTMA 3KG2A 3RYIA 2X6CA 3J81N 1R6KA 1UFIA 1J5EB 2HR3A 3E83A 4HZ3A 1SQQH 1B3QA 5A2QN 1H2LA 3DXRB 4JZGA 3OM3B 2QR4A 5EYPA 1IXBA 2F4VB 3M99B 3SPIA 5IJ0B 4KHPO 2L35A 2UXDO 1M90W 3E8BA 3CB2A 1SESA 1SC5B 3P32A 2L6LA 4WCEV 4PA4A 1VMGA 2XAQA 1OCZC 1WN7A 2Q7HA 1H2MA 1WA8B 3OMIB 1Y76A 2FB5A 3N2KA 1QR8A 2GTSA 2W0XA 4DV6B 4H0LB 4DR7O 1N32O 2A06H 5KHIA 5KX5A 1R1BA 3NR7A 3LNMB 2VS0A 3UO2A 3RT3C 4J7KA 3AG2C 4U7NA 2QSAA 2B5UA 5J2UA 1M1KW 3JD0A 1FXKA 3E35A 2DMXA 3DTUB 4L87A 1UJWB 4GCZA 4ZOLB 4BIZA 4CBCA 1TVKB 1PL0A 1L0LH 3B4SA 2WPDG 2EX3A 3L71H 4TT3G 4PV1B 3OTFA 1SZXA 3JATB 2ZNJA 2UUCB 2VQFB 1V9PA 3CSXA 1EFRG 1EN4A 1QQCA 5B1BB 1K8AW 3K03A 2ZXWC 3K59A 3SJAC 4TUYB 2F43G 2QWOB 2XT9A 4X88A 1Q5OA 4BWAA 1I08A 4FK5C 4O4LA 1L8DA 1KU9A 4MW8A 5TISZ 2R70A 4PDLA 2WLHA 4GX1A 4PA6A 4DRXB 1VARA 2UUBB 4QPJA 4IIJB 5B3SC 3UT5A 1S5HC 1AROP 3TXSA 2IH3C 4LF8B 1XNRB 3L75H 2ZDIA 1H2KA 1XEQA 2E3CA 4FVMA 1YHQV 3NXSA 2KQXA 2GUZA 4WFGA 1G1XB 1BQ0A 1ENVA 3G6BA 5JQGA 2PYLA 5EC1C 1AR4A 4P30A 4DR1B 2OT5A 1VEWA 3C90A 3K5OA 4ICGA 1NTZH 2LFRA 3SYCA 2BTQA 3SYOA 5L3DA 1OZ0A 3RBZA 1YI2V 1COWG 4TQFA 3F7YC 3RWRD 2VWKA 5LHIA 3JCZA 2E5LB 2HKOA 4FLTA 3U0ZA 1K34A 5B1NA 2UXCO 1EM1A 3AK2A 1PKXA 1VP7A 2ADPA 3KCYA 1BZKA 3ZJZA 1K5QA 1BS3A 1SKVA 3ETGA 4O4JB 4WBNA 4NKGB 3G71V 1HWYA 5BMVB 4LNUB 1F7YA 5L3CA 3STLC 2QKSA 4DV0B 3MD0A 3J7AU 2YC0A 2YIBD 2WA3A 1K97A 4K3AA 1ZWIC 5KLVH 1KP3A 1KP2A 4G28B 2F66C 3JYCA 1IBKO 4O2BB 5DECA 2DQ3A 2YEVA 3ML0A 2A9HA 2WLIA 4GKJB 1GN2A 2AHZA 2ETNA 2A3QA 2DYRB 1N36B 4W4LA 1SQPH 3AG1B 3QF7A 3K79A 2Q68A 5CBHA 2ZIMA 4MVZA 4MTFA 3CEIA 1RFYA 4LF7B 4LFBO 4U7OA 1OCRB 2KB1A 1ZX3A 1YITV 3CD6V 5KX5B 2FL4A 5HFLA 3M8AA 3ZS8C 1SQXH 5J2UB 2EIJB 3D3QA 4J80A 5FL7G 4UCRA 2AXTZ 3WB0A 5ITZA 4DYLA 2XAJA 1R3JC 4NTXA 1LUVA 1ORQC 4ZHQA 1NTKH 1XNQB 2ITCC 1E1RG 2XOKG 3OEEG 3B09A 4MVUA 3CJHA 2OCHA 3OMNB 3X2QB 3THOA 3T1YB 1R3KC 5LHGA 3BRCA 2RCVA 4DV4B 2EZPA 1QLNA 2QDOA 4JI1O 4QJFB 4WFHA 3FD9A 4MT8A 1XI1A 2V4DA 3RYCA 4DUZB 3JD2A 1VQKV 3VOUA 4X20B 3IC9A 4UXNA 1MSWD 5C93A 3B40A 4EFEA 5B1BC 2KG7B 4I50A 3FB5C 4JTDB 5LGTA 4B3TO 1TUBB 1QVFU 1XMQB 2M7WA 3E8GA 5C8YA 4A5UB 3GWOA 3OD4A 2UXBB 3ABKB 4LF8O 4DR2B 2ZD9A 2BCCH 1Y74A 3OFNG 1Q86W 4DW0A 1KECA 2XHBA 1FKAO 2RNBA 3RYFA 5JQGB 4LFCB 3K06A 4BAYA 4X62B 2CTQA 4JI3B 1AJPA 5LBQA 2HJFC 4DV7O 3JALA 1BE3H 4AQYO 3OUSA 4LBEC 5IYZB 1GN6A 3OR7C 3IAYA 3OEHG 5KA5A 5LL6Y 3ABUA 1Q81W 1XBLA 1KUQA 4DUYO 1H2SB 1YSCA 5BR8O 2ZINA 3D3IA 1GO3F 4JAVA 3KZIZ 3Q4HB 3A8TA 4XDKA 2IJHA 1Q82W 3CYOA 1M4UA 1WPXA 3CCUV 2QWPB 1ROPA 3B77A 3ICXA 4FM1A 2DQ0A 1P49A 4YHHO 4DW1A 4U3JA 4J11A 1PNLA 4F6EA 2N74A 1KKCA 3OTOB 1O9HA 3OAAG 4F6RB 3CCMV 1YJNV 2EZOA 2HLDG 1KQSU 4H37A 5LMUO 4DV1B 3ZHUA 5B1OA 4I9WA 4R50A 4B3MB 5JCOA 4JI4B 1WAZA 2DN9A 4LH6A 4GUNA 1KYOF 2HJDA 1E79G 1VQ4V 4I4TB 1JVMA 1VQOV 1DLBA 4IYHA 5JH7A 3QO5A 4MVSA 1KBHA 3ASOB 4GKKO 2DYRC 2P4VA 3AG1C 5J9PC 3JAMN 1XDCA 1HDJA 4KHPB 4JAUA 2Y0PA 1OCRC 1YIJV 2Z0AA 1FD9A 1NBMG 4WFBV 1TGOA 4F4LA 1KMIZ 1Y67A 2DOSA 1CXZB 3BFRA 3LNNA 2GV9A 1GRJA 3CCVV 2Y69B 3JAKA 1I5YA 2LW7A 4DR7B 1N32B 3ZBHA 3DC5A 1ZL8A 2W6IG 4LF9O 1JJ2U 1MZFA 1F4MA 3G67A 3X2QC 3JAWB 1RSOA 1KB9F 1NR1A 3EVKA 1B06A 2F95B 3ASNC 3CC2V 3E22A 3OMAB 5H6QA 4BIUA 1XOUA 1TAEA 3ETQA 1F23A 1FFXA 3L9DA 5JVDA 3G6EV 5EZYB 5KMGA 1HNXO 2R9IA 2UXXA 5LXTB 1QHTA 2EILB 3B2EE 3M7MX 1K3EA 3JSNA 3ABKC 2UUAO 2MW2B 5E79Z 4CS3A 2NLJC 4UCUA 4BW9A 4EKWA 1PP9H 2GHYA 3HKDB 1GM9A 4X89A 3SYQA 2ZQMA 2QWQB 3EFFK 3SJBC 4FPPA 3IJ4A 3UO3A 5EIBD 4JYYA 1FAFA 2W0FC 3F7VC 4UVAA 4TV9A 3K57A 1MZEA 5IY5B 1VQ5V 1Q90D 4XBFA 2WSSG 3D36A 1YVWA 1K73W 3IC7A 3CCJV 5L3FA 2GSMB 2A79B 4YJ2A 4P9PA 3HKCB 1YJ9V 3ZMSA 5L3GA 3CXCU 2CTPA 4B3RO 2Z3YA 5LA6A 3RVZA 2WLLB 4HNAA 2YI9A 3UQ8A 4MTGA 3QVNA 3UKMA 2P7TC 4IT5A 2Q5ZA 1IXMA 1URFA 2UXCB 1K4CC 1IVSA 3KCXA 4ZI7A 1Y66A 4JI4O 5LOVA 1MABG 1NZ6A 2LJ2A 4CC6A 3MDSA 5JH7B 4HBNA 1S0VA 3AG4B 4J7JA 4BR6A 4L8JA 1FOUA 3RVYA 3MHSC 5BXZA 3LDEA 4I9QA 4NXMB 2X0LA 2D3OW 1PD3A 1N33B 1XHXA 3PJSK 1VF6C 4LR3A 1IBKB 3ASOC 1A32A 1VQ9V 4LP8A 2LP7A 4JYCA 2JEUA 3JARB 1S3JA 1R6TA 4I5SA 1H38A 5CB4A 4NTWA 3BCCH 4GX2A 4JZ2A 2E75B 3HKBB 5H5NA 3VBBA 1I94O 4LFBB 1V54C 4ZIBA 1W0KG 4O4HB 3AK3A 1JPXA 1H2GA 3ZMZA 5IT9N 2JGDB 3OE7G 4OPHA 1S72V 3WB2A 4EB6B 4DV5O 3A2FA 2Y69C 1JFFB 3E2EA 5KHJA 3WG7B 1SQGA 4X1IA 3APQA 1VQMV 1GM7A 1FFXB 5KHKA 1K9MW 3P3NA 1SS3A 3CHXA 2QKCA 3SPJA 2IW5A 2KSDA 4AI8A 5LP6A 3JD4A 1FS0G 2WAMA 3ABMC 3EXAA 4JI1B 2CH7A 4I55B 5CA0B 2JEXA 4FIPC 1XQ8A 3ETDA 4LWSA 4MVMA 4D6TH 4DV3O 2K9PA 5LHHA 2E76B 4B3TB 1NKDA 2FMLA 4KP4A 3K3WA 4FFBB 4J42A 1SRYA 2CAZC 3ZN0A 5JJJB 2OYQA 4FLXA 4JTCB 2Q7GA 4UCSA 3K5LA 3H1KH 4GYCB 2EJ7A 5IY5C 2X6AA 3T4DA 5LYJB 4DV7B 1GH6A 3WU2Z 4K8ZA 1FYJA 4AQYB 2F1MA 3FB7C 1XREA 2XASA 3K0GA 1VIBA 4MSWC 1N34O 1AR1B 1U96A 1JX9A 4DUYB 1IDSA 3ZCCA 4ABMA 5BR8B 5EBLC 3LUTB 4DR4O 4DO2A 4LCUC 1SQFA 3CCQV 3SYPA 1AI7A 4O4IB 2AGAA 3JASB 5KUMA 3RYIB 3CP1A 4OX9O 2Y4UA 1XHZA 4FM0A 2CGOA 1KD1W 4YHHB 1AP6A 3P30A 2GBOA 4YXWG 2HP8A 4QGPA 5IDJA 2Q7EA 4NXMO 5EYPB 4QIWF 1N33O 3SPHA 3AG4C 1DK1A 1MG1A 5BY1A 5LMUB 1NVPD 3K0DA 1Z2GA 2Q0OC 1R3IC 2YUAA 4K35A 3TK1A 3DC6A 5CB4B 1MOFA 1YXBA 1OCOB 2CTWA 1EZJA 4YJ3A 4LF5O 3CCRV 4CH5A 4J10A 2JIZG 2AW9A 2BOCC 3LSUA 1Y76B 3N2KB 4LC1A 2ZR3A 4GKKB 4OXSA 3K5MA 2QTSA 2AZ2A 1P7BA 1S76D 2ZIOA 3ZMVA 5B5EZ 1GMGA 1HP8A 3ABTA 1JJOA 1FXKB 3ZMTA 4YIPA 1RPRA 4ASUG 1Y4MA 3B8NA 2E74B 3OW2U 3WG7C 1Q6HA 3S3XA 2IBZH 1GM8A 5LP6B 2VQEO 2DE0X 4UB6Z 2JJ1G 3BABA 2WLMA 4LF9B 4P9OA 3T4ZA 2QJ1A 4J7ZA 5GONA 2QEXV 4JI2B 4IHJA 1SA0A 2P4KA 2YSUB 4MTXA 4O4LB 1AVMA 1VQPV 2ZKOA 1K5SA 2DWEC 4JF3A 3UT5B 3FAVA 2AHYA 1GN4A 1HNXB 4WF9V 3DGEA 3KDRA 4X64O 3JD3A 2UUAB 2GUZB 3QNEA 4HYOA 4DR5O 1DGSA 1QNMA 4JTAB 3MAQA 2BTQB 5GTHZ 4AILC 4RUFA 3BEHA 4X1KA 4PJ0Z 1VQNV 1I0HA 4NXNO 2JS3A 2LFSA 4O2AA 2ZCEA 3N27A 1M57B 1OJHA 3STZC 2OIEA 2RJZA 4Q20A 2YXHA 4TSFG 1K92A 1S77D 4JAAA 2IU0A 4PDRA 3H1HH 3HKEA 1GKFA 4WBNB 2QGNA 4B3RB 3I5DA 1XILA 1CP9A 4X1YA 4OPAA 4YIOA 4N23A 1NTMH 4JI0O 1R3LC 2Q67A 2ZE7A 2KKWA 5DN6G 2BE3A 1EN6A 3RYHA 4AHCA 2Q69A 4B3SO 2Q8VA 3CX5F 3ZRWA 5J2TA 3ZEDA 2NN4A 3HB3B 3U11A
chains in the Genus database with same CATH topology
2GDSA 3AK3A 1SZXA 1XDCA 1P7GA 1WB8A 1EN4A 2P4KA 1EN5A 2ADQB 1BSMA 1AVMA 2CE4A 3KKYA 1GN2A 1N0NA 1I08A 2QKAA 1AP6A 1GN6A 3C3TA 1GN4A 1Y67A 2QKCA 3BFRA 3QVNA 5A9GA 1VARA 3CEIA 3KDRA 1ZTEA 3DC5A 4X9QA 1ZLZA 1QNMA 1BT8A 1GN3A 4JZGA 1IXBA 1XUQA 1MA1A 3RN4A 3DC6A 3EVKA 1B06A 3TJTA 1WB7A 1I0HA 1AR4A 3MDSA 1VEWA 1LUVA 2AW9A 1JA8A 3LSUA 4BR6A 1JR9A 1N0JA 4F6EA 1KKCA 1IX9A 1MSDA 1PM9A 1ZUQA 1D5NA 2RCVA 4C7UA 1MMMA 3OT7A 5AG2A 4YIPA 1EM1A 1AP5A 3AK2A 3AK1A 2ADPA 1MNGA 3IC9A 1PL4A 1LUWA 1XILA 3C3SA 1BS3A 4FFKA 4YIOA 3K9SA 4JZ2A 4GUNA 2CDYA 1XREA 1AR5A 4JYYA 1EN6A 4E4EA 1IDSA 1ZSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDS A;  3AK3 A;  1SZX A;  1XDC A;  1P7G A;  1WB8 A;  1EN4 A;  2P4K A;  1EN5 A;  2ADQ B;  1BSM A;  1AVM A;  2CE4 A;  3KKY A;  1GN2 A;  1N0N A;  1I08 A;  2QKA A;  1AP6 A;  1GN6 A;  3C3T A;  1GN4 A;  1Y67 A;  2QKC A;  3BFR A;  3QVN A;  5A9G A;  1VAR A;  3CEI A;  1ZTE A;  3DC5 A;  4X9Q A;  1ZLZ A;  1QNM A;  1BT8 A;  1GN3 A;  4JZG A;  1IXB A;  1XUQ A;  1MA1 A;  3RN4 A;  3DC6 A;  3EVK A;  1B06 A;  3TJT A;  1WB7 A;  1I0H A;  1AR4 A;  3MDS A;  1VEW A;  1LUV A;  2AW9 A;  1JA8 A;  3LSU A;  4BR6 A;  1JR9 A;  1N0J A;  4F6E A;  1KKC A;  1IX9 A;  1MSD A;  1PM9 A;  1ZUQ A;  1D5N A;  2RCV A;  4C7U A;  1MMM A;  3OT7 A;  5AG2 A;  4YIP A;  1EM1 A;  1AP5 A;  3AK2 A;  3AK1 A;  2ADP A;  1MNG A;  3IC9 A;  1PL4 A;  1LUW A;  1XIL A;  3C3S A;  1BS3 A;  4FFK A;  4YIO A;  3K9S A;  4JZ2 A;  4GUN A;  2CDY A;  1XRE A;  1AR5 A;  4JYY A;  1EN6 A;  4E4E A;  1IDS A;  1ZSP A; 
#chains in the Genus database with same CATH topology
 2YEV B;  5EBM C;  4H44 B;  3SR2 C;  4LFA O;  2WLI B;  3H1J H;  2EIM B;  4CH6 A;  2EIN B;  3CRA A;  1AI4 A;  3L73 H;  4KXR A;  3GB7 C;  2B1I A;  4XDJ A;  4CS2 A;  4EFB A;  1QLE B;  1DF4 A;  5H6R A;  2BSK A;  1Q8I A;  1HR0 B;  5IJ9 A;  1FFT B;  4QNH B;  2OIG A;  4J41 A;  4PHZ A;  1YCI A;  3H1L H;  2PI5 A;  3APO A;  2BOB C;  5JWP A;  1NH2 D;  3ABL B;  4KL1 A;  4DXW A;  5ITZ B;  3LDD A;  4X9Q A;  5IYB O;  1ZLZ A;  1M9N A;  1GN3 A;  2ZNI A;  4K0K B;  1HW7 A;  2BTO A;  4ZHQ B;  3OUF A;  3DXR A;  1M93 A;  2EIJ C;  3CJH B;  1FXK C;  2WA4 A;  1L0N H;  3CRM A;  3WB1 A;  3I56 V;  1FJG O;  4MW3 A;  1I94 B;  4FMT A;  4LH7 A;  2WLJ A;  1BL8 A;  4NTY A;  3CCE V;  1K7D A;  1OCZ B;  4UFZ A;  2QWN B;  3ZHT A;  5IWA O;  3RYC B;  4N21 A;  1MSD A;  5CA1 A;  4JYA O;  4JI2 O;  4DV5 B;  2WWW A;  3JCU Z;  1MMM A;  3SPC A;  3AG2 B;  4I50 B;  5H9C A;  3SGI A;  1G4Y B;  1WA8 A;  1NJI W;  1G8M A;  3ZN1 A;  5C8Y B;  2W6J G;  4UCO A;  3O65 A;  4IGG A;  1BHB A;  5JJN B;  2CDY A;  1AR5 A;  1WPB A;  1THZ A;  3QTC A;  1U97 A;  4IYI A;  1WLE A;  2FTK A;  1UPG A;  4MVQ A;  3R65 A;  1AIL A;  1RP3 B;  3G80 A;  1Y74 B;  3CRR A;  2RMK B;  3AG3 B;  3CPW U;  1RM1 B;  2GDS A;  4ZOL A;  3RYF B;  3K04 A;  2JVD A;  4BIO A;  2ZDI C;  4QPK A;  2YXL A;  1TVK A;  2PYJ A;  2YI8 A;  3SJC C;  4D7S A;  2JJ2 G;  4DV3 B;  3JAL B;  4X1K B;  5DED A;  3JAT A;  3ZRX A;  4JV5 O;  4G2K A;  2Y4T A;  1GAX A;  1WJZ A;  5IYD O;  4TUY A;  3CME V;  3UM7 A;  1NQT A;  5A9G A;  2XND G;  4IL6 Z;  4JI8 O;  2QWR B;  1QVG U;  1V55 B;  4RQF A;  1FXH A;  1IUR A;  4DRX A;  2JDI G;  2Y0I A;  4IIJ A;  1OCC B;  3GVM A;  3J80 N;  2Q4P A;  1S5J A;  4W4K A;  1JCH A;  3U10 A;  4R7C A;  4RWU A;  4U3J B;  4Z1M G;  1N34 B;  2RQ6 A;  2R9R B;  1VF5 B;  1HNW O;  3CC4 V;  3DSQ A;  2IJJ A;  2JRI A;  2ITD C;  3QO7 A;  4PEL A;  4DR4 B;  4WFE A;  2N04 A;  2P22 C;  4KUM A;  3HPL C;  5EIB C;  3T2M A;  3CE2 A;  1PM9 A;  4QE7 A;  1L1F A;  5B66 Z;  2R72 A;  4OX9 B;  1F4N A;  3JSL A;  2PF4 E;  5IE9 A;  3TXQ A;  3AK1 A;  3B8M A;  4GLX A;  3FX7 A;  3C3S A;  1HR0 O;  5B1A B;  2EIN C;  4MVR A;  1P4R A;  4KFM A;  1I7F A;  3CCS V;  3A0B Z;  3W7T A;  1QU7 A;  2YS8 A;  1QLE C;  5CN0 A;  1Q6I A;  4O4J A;  2VWJ A;  3N2G A;  3R66 A;  5BMV A;  1ZSP A;  4LNU A;  2P6J A;  4WFF A;  3GWK C;  4K0K O;  3BVO A;  2NNU A;  4MS2 A;  3O9O A;  4LF4 O;  3ABL C;  4PI2 A;  3I55 V;  1BSM A;  4TV8 A;  2DYS B;  1YDX A;  4LF5 B;  4J9Z B;  3AG7 A;  4O2B A;  4PA3 A;  4XDL A;  2F23 A;  3JD1 A;  1LR1 A;  1PV0 A;  3JAK B;  2P5O A;  3C3T A;  3P3P A;  4FLV A;  1OV9 A;  1ZL8 B;  4X66 O;  2XAH A;  2ZE6 A;  3T1C A;  5CA1 B;  1RSO B;  1Q7Y W;  1D2D A;  4RO2 A;  3BA8 A;  2XTA A;  4TQD A;  1BT8 A;  1NVP B;  3E22 B;  2UU9 O;  4J9Y B;  3G4S V;  1IBM O;  1DTO A;  1AJQ A;  4UVB A;  2GTA A;  2MK3 A;  5JVD B;  5F2V O;  3TJT A;  2OCC B;  1NI8 A;  4FZ0 A;  1SQB H;  4X65 O;  2IJI A;  1H8H G;  4NR1 A;  5KMG B;  2VQE B;  4UCV A;  3K9A A;  1EBO A;  1H8E G;  2EIL C;  1ZUQ A;  1US6 A;  2YID A;  2CK3 G;  3AG3 C;  3SYA A;  3OT7 A;  4H13 B;  1RM1 C;  1OHH G;  1WP8 A;  4U3F H;  1X59 A;  3BA9 A;  4DK1 A;  5LGU A;  5K1X A;  1MNG A;  2ATK C;  2RDC A;  4TV9 B;  1XMO O;  5CBG A;  2HHH O;  4FFK A;  4JI6 O;  1YJW V;  4NYK A;  4TWK A;  3SDL A;  4X20 A;  4X64 B;  1PPJ H;  5D5P A;  3ZMU A;  2V7Q G;  3CXH F;  2P67 A;  2X7R B;  2KG7 A;  4YY3 O;  3L72 H;  1F51 A;  2CTR A;  3OR6 C;  1TUB A;  4YJ2 B;  3VQW A;  4DR5 B;  1HNZ B;  2PZS A;  1M56 B;  1NU1 H;  1LNQ A;  3AEI A;  2NR5 A;  3W7W A;  5LA6 B;  1V55 C;  3QG5 A;  2FYU H;  1YF2 A;  2YIA A;  3K08 A;  4UVC A;  4NXN B;  3KKY A;  1Q3E A;  4HNA B;  4LF6 O;  4FLY A;  2PUS A;  4JI5 O;  1OCC C;  5FNV A;  4DV2 B;  1B6Q A;  2Q73 A;  4UV9 A;  1PNK A;  5LMN O;  3CRQ A;  1Z5W A;  1ZTE A;  4ZI7 B;  5IYZ A;  3W7U A;  1EZV H;  5LOV B;  4NB5 A;  5GW7 A;  4NVP A;  4DR6 O;  2PY5 A;  2LGW A;  2XAG A;  3A0R A;  4GZR B;  2QTO A;  1T5E A;  5JCO C;  4P2Z A;  4JI0 B;  1W0J G;  1GK9 A;  2K1E A;  2OWO A;  3T1H O;  3Q4H A;  3ZX6 A;  4B3S B;  3ETE A;  1JR9 A;  4ZBM A;  5B1A C;  2FKX A;  3N2G B;  4CS4 A;  1W2B U;  4LFA B;  4E2L A;  1J5E O;  4UB8 Z;  5L3B A;  1QCE A;  2Y48 A;  1D5N A;  5E1A C;  1K4D C;  3H1I H;  4TV8 B;  1JNB A;  3FB8 C;  2QM7 A;  4FJC C;  1X4T A;  4RQE A;  5H2F Z;  2F4V O;  4CC5 A;  4Z2W A;  4F6R A;  1LUW A;  1W59 A;  4Q6G A;  1Z5V A;  3D8C A;  4PDM A;  1GTO A;  3H01 A;  4I0X A;  2G38 A;  2ZT9 B;  1I5X A;  4I7Z B;  2DYS C;  2QM4 A;  5EBW C;  1TA8 A;  1SET A;  1NR7 A;  2F93 B;  4K8X A;  1H2N A;  3OGI B;  4I4T A;  3LDC A;  2C2A A;  1VF6 A;  2IJK A;  3W7X A;  3HR0 A;  1J95 A;  1PNM A;  2EJR A;  2Q0A A;  4X1I B;  1FXV A;  3F5T A;  4DV6 O;  4DR3 B;  3TGU H;  2XUM A;  1FJG B;  4PA7 A;  2CE4 A;  1O9G A;  5KHG A;  3UCS C;  1VQ8 V;  1R6N A;  1AJN A;  3ZRS A;  2P06 A;  4G27 B;  2Q6A A;  2H3O A;  2EIK B;  2OCC C;  5IWA B;  2LO1 A;  2CH7 B;  1E1Q G;  3IGA C;  3RW0 A;  4JYA B;  3WFV A;  1AB3 A;  4FZ1 A;  1TUE B;  4LWS B;  1IBL B;  1NH2 B;  3F5W C;  2PGG A;  2UUC O;  2A7W A;  2VQF O;  3RN4 A;  2ZE5 A;  3ASN B;  1BMF G;  3JAW A;  1BHA A;  4B7E A;  4PA9 A;  2LGQ A;  1JA8 A;  1Q6U A;  2RN9 A;  1AI5 A;  2HVK C;  1VQ6 V;  1N0J A;  3ZHS A;  1HNZ O;  1JOY A;  2LQT A;  2UUB O;  5FPR A;  1IX9 A;  3D36 C;  2ARH A;  3ZRV A;  5EZY A;  5KA6 A;  1KKD A;  1XNR O;  5LXT A;  4QE9 A;  5AG2 A;  4GX5 A;  1M56 C;  1AP5 A;  4JV5 B;  2VRZ A;  2DWD C;  4JYB A;  2V1D A;  2QE7 G;  3TCU A;  3VQX A;  5FNV B;  4TOI A;  2A0L A;  4DV2 O;  2UXN A;  1G6U A;  1SZT A;  3H9V A;  4DR1 O;  1SQV H;  1YTF B;  2M6Y A;  5HFM A;  4JI8 B;  1H5W A;  1NS1 A;  3TET A;  3HKD A;  4HAM A;  3ZIA G;  3ZHR A;  3K5N A;  2CGN A;  3BAA A;  3E8F A;  1VQ7 V;  1P7G A;  2HVJ C;  1Q43 A;  1NT2 B;  3CWB H;  4FLZ A;  3RGB A;  2E5L O;  3W7S A;  4UCT A;  3CRC A;  3CS5 A;  2ADQ B;  2ZM6 B;  3S3W A;  2OTL V;  2QKA A;  4FLW A;  3HKC A;  1HNW B;  3BHP A;  4RUE A;  4Z1V A;  3VQV A;  4ZKI A;  2WLN A;  4PD4 F;  5DM6 V;  2CUG A;  1CEZ A;  2AZ0 A;  4JI7 B;  2WLL A;  2ZR2 A;  1WP7 A;  4DV0 O;  1BGY H;  3LSS A;  1VQL V;  1YEW A;  3FFQ A;  4PI0 A;  5L3E A;  2P90 A;  1XUQ A;  4YJ3 B;  3RFR A;  2JS5 A;  2B1G A;  3MHH C;  2ILM A;  1VF7 A;  2DW4 A;  1OCO C;  4I0X B;  5D5Q A;  3E86 A;  4GKJ O;  1QBZ A;  2IU3 A;  2IH1 C;  3A0H Z;  1N36 O;  2XAF A;  5LGN A;  1JQ0 A;  4WFA V;  1KC8 W;  4LF7 O;  1QR9 A;  4MTO A;  1ZAU A;  1D5A A;  2IM9 A;  4BW5 A;  2YDE A;  2YIC A;  1B04 A;  4C7U A;  3FB6 C;  3SPG A;  3CMA V;  4LF4 B;  2DJV A;  3CC7 V;  4UV8 A;  4DR3 O;  2JGU A;  3QO8 A;  5IJ0 A;  2B9Z A;  1PL4 A;  5CBF A;  2UXD B;  3PN1 A;  2QM8 A;  4FM2 A;  2Q9L A;  2EUL A;  5FPO A;  1JMK C;  4X66 B;  3JAR A;  1XNQ O;  5GON B;  1V54 B;  2QA4 V;  4E4E A;  5LP6 C;  4IHJ B;  3HKB A;  2OTJ V;  1SA0 B;  1K33 A;  1IBL O;  2EBO A;  2EIK C;  3VQY A;  4R6Z A;  5EC2 C;  3T1Y O;  2UU9 B;  1IBM B;  2YIB A;  4DV4 O;  5FLX N;  4O4H A;  1Y6X A;  3FAV B;  2R9A A;  5KHH A;  1EN5 A;  2LW1 A;  3K58 A;  4X65 B;  4JAS A;  5IYC O;  1YTF D;  2JGD A;  4CH4 A;  3FKS G;  4DUZ O;  1M5I A;  4X8A A;  4EB6 A;  2X6B A;  4R8C A;  1JFF A;  1XL4 A;  2JK5 C;  3FYE B;  1XMQ O;  1BQZ A;  1N4C A;  3ABM B;  2UXB O;  5CA3 A;  1YZB A;  4CZZ A;  4JPR A;  1XL6 A;  4DR2 O;  2ZXW B;  3SJQ C;  4D7T A;  2H8P C;  1SF9 A;  2Z5U A;  1IJG A;  1RPO A;  1CPY A;  1MA1 A;  2HG5 C;  5JJE B;  5CMU A;  1XMO B;  2HHH B;  4JI6 B;  1WB7 A;  4O2A B;  2YXY A;  4I55 A;  5CA0 A;  1AI6 A;  2HEP A;  3E8H A;  4LFC O;  4X62 O;  5B3S B;  4RAI A;  4JI3 O;  3OGC C;  5KAF Z;  4FLU A;  5K1P A;  4YY3 B;  4MVO A;  3ZHV A;  4B08 A;  2HFE C;  4PDV A;  5GTI Z;  4GT1 A;  1M57 C;  1SER A;  3HKE B;  1S5L Z;  4EEQ A;  1WNS A;  4UUJ C;  5KAI Z;  3ZHQ A;  4FFB A;  4X1Y B;  3EHB B;  2D2C B;  4LF6 B;  3E89 A;  1N8R W;  2N05 A;  2ZM6 O;  4JI5 B;  3FYI B;  5BZB A;  1FPO A;  3L70 H;  2PI4 A;  5EK0 A;  3RYH B;  1P84 F;  3BY6 A;  3L74 H;  3ZRW B;  3K9S A;  4GX0 A;  5J2T B;  4B7K A;  4H33 A;  1R73 A;  2WLK A;  5LYJ A;  5KUK A;  5LMN B;  1IZ3 A;  4JI7 O;  2O57 A;  4OGQ B;  4DR6 B;  3CCL V;  1BCC H;  4JGS A;  3LSQ A;  3OTO O;  1WB8 A;  3IFX A;  2BSK B;  2H94 A;  4CH3 A;  5IJ9 B;  2EIM C;  3BPZ A;  4DK0 A;  3T1H B;  2ODM A;  4DV1 O;  2ZE8 A;  4B3M O;  1N0N A;  4O4I A;  1DF5 A;  3JAS A;  2PTM A;  3KG2 A;  3RYI A;  2X6C A;  3J81 N;  1R6K A;  1UFI A;  1J5E B;  2HR3 A;  3E83 A;  4HZ3 A;  1SQQ H;  1B3Q A;  5A2Q N;  1H2L A;  3DXR B;  4JZG A;  3OM3 B;  2QR4 A;  5EYP A;  1IXB A;  2F4V B;  3M99 B;  3SPI A;  5IJ0 B;  4KHP O;  2L35 A;  2UXD O;  1M90 W;  3E8B A;  3CB2 A;  1SES A;  1SC5 B;  3P32 A;  2L6L A;  4WCE V;  4PA4 A;  1VMG A;  2XAQ A;  1OCZ C;  1WN7 A;  2Q7H A;  1H2M A;  1WA8 B;  3OMI B;  1Y76 A;  2FB5 A;  3N2K A;  1QR8 A;  2GTS A;  2W0X A;  4DV6 B;  4H0L B;  4DR7 O;  1N32 O;  2A06 H;  5KHI A;  5KX5 A;  1R1B A;  3NR7 A;  3LNM B;  2VS0 A;  3UO2 A;  3RT3 C;  4J7K A;  3AG2 C;  4U7N A;  2QSA A;  2B5U A;  5J2U A;  1M1K W;  3JD0 A;  1FXK A;  3E35 A;  2DMX A;  3DTU B;  4L87 A;  1UJW B;  4GCZ A;  4ZOL B;  4BIZ A;  4CBC A;  1TVK B;  1PL0 A;  1L0L H;  3B4S A;  2WPD G;  2EX3 A;  3L71 H;  4TT3 G;  4PV1 B;  3OTF A;  1SZX A;  3JAT B;  2ZNJ A;  2UUC B;  2VQF B;  1V9P A;  3CSX A;  1EFR G;  1EN4 A;  1QQC A;  5B1B B;  1K8A W;  3K03 A;  2ZXW C;  3K59 A;  3SJA C;  4TUY B;  2F43 G;  2QWO B;  2XT9 A;  4X88 A;  1Q5O A;  4BWA A;  1I08 A;  4FK5 C;  4O4L A;  1L8D A;  1KU9 A;  4MW8 A;  5TIS Z;  2R70 A;  4PDL A;  2WLH A;  4GX1 A;  4PA6 A;  4DRX B;  1VAR A;  2UUB B;  4QPJ A;  4IIJ B;  5B3S C;  3UT5 A;  1S5H C;  1ARO P;  3TXS A;  2IH3 C;  4LF8 B;  1XNR B;  3L75 H;  2ZDI A;  1H2K A;  1XEQ A;  2E3C A;  4FVM A;  1YHQ V;  3NXS A;  2KQX A;  2GUZ A;  4WFG A;  1G1X B;  1BQ0 A;  1ENV A;  3G6B A;  5JQG A;  2PYL A;  5EC1 C;  1AR4 A;  4P30 A;  4DR1 B;  2OT5 A;  1VEW A;  3C90 A;  3K5O A;  4ICG A;  1NTZ H;  2LFR A;  3SYC A;  2BTQ A;  3SYO A;  5L3D A;  1OZ0 A;  3RBZ A;  1YI2 V;  1COW G;  4TQF A;  3F7Y C;  3RWR D;  2VWK A;  5LHI A;  3JCZ A;  2E5L B;  2HKO A;  4FLT A;  3U0Z A;  1K34 A;  5B1N A;  2UXC O;  1EM1 A;  3AK2 A;  1PKX A;  1VP7 A;  2ADP A;  3KCY A;  1BZK A;  3ZJZ A;  1K5Q A;  1BS3 A;  1SKV A;  3ETG A;  4O4J B;  4WBN A;  4NKG B;  3G71 V;  1HWY A;  5BMV B;  4LNU B;  1F7Y A;  5L3C A;  3STL C;  2QKS A;  4DV0 B;  3MD0 A;  3J7A U;  2YC0 A;  2YIB D;  2WA3 A;  1K97 A;  4K3A A;  1ZWI C;  5KLV H;  1KP3 A;  1KP2 A;  4G28 B;  2F66 C;  3JYC A;  1IBK O;  4O2B B;  5DEC A;  2DQ3 A;  2YEV A;  3ML0 A;  2A9H A;  2WLI A;  4GKJ B;  1GN2 A;  2AHZ A;  2ETN A;  2A3Q A;  2DYR B;  1N36 B;  4W4L A;  1SQP H;  3AG1 B;  3QF7 A;  3K79 A;  2Q68 A;  5CBH A;  2ZIM A;  4MVZ A;  4MTF A;  3CEI A;  1RFY A;  4LF7 B;  4LFB O;  4U7O A;  1OCR B;  2KB1 A;  1ZX3 A;  1YIT V;  3CD6 V;  5KX5 B;  2FL4 A;  5HFL A;  3M8A A;  3ZS8 C;  1SQX H;  5J2U B;  2EIJ B;  3D3Q A;  4J80 A;  5FL7 G;  4UCR A;  2AXT Z;  3WB0 A;  5ITZ A;  4DYL A;  2XAJ A;  1R3J C;  4NTX A;  1LUV A;  1ORQ C;  4ZHQ A;  1NTK H;  1XNQ B;  2ITC C;  1E1R G;  2XOK G;  3OEE G;  3B09 A;  4MVU A;  3CJH A;  2OCH A;  3OMN B;  3X2Q B;  3THO A;  3T1Y B;  1R3K C;  5LHG A;  3BRC A;  2RCV A;  4DV4 B;  2EZP A;  1QLN A;  2QDO A;  4JI1 O;  4QJF B;  4WFH A;  3FD9 A;  4MT8 A;  1XI1 A;  2V4D A;  3RYC A;  4DUZ B;  3JD2 A;  1VQK V;  3VOU A;  4X20 B;  3IC9 A;  4UXN A;  1MSW D;  5C93 A;  3B40 A;  4EFE A;  5B1B C;  2KG7 B;  4I50 A;  3FB5 C;  4JTD B;  5LGT A;  4B3T O;  1TUB B;  1QVF U;  1XMQ B;  2M7W A;  3E8G A;  5C8Y A;  4A5U B;  3GWO A;  3OD4 A;  2UXB B;  3ABK B;  4LF8 O;  4DR2 B;  2ZD9 A;  2BCC H;  1Y74 A;  3OFN G;  1Q86 W;  4DW0 A;  1KEC A;  2XHB A;  1FKA O;  2RNB A;  3RYF A;  5JQG B;  4LFC B;  3K06 A;  4BAY A;  4X62 B;  2CTQ A;  4JI3 B;  1AJP A;  5LBQ A;  2HJF C;  4DV7 O;  3JAL A;  1BE3 H;  4AQY O;  3OUS A;  4LBE C;  5IYZ B;  1GN6 A;  3OR7 C;  3IAY A;  3OEH G;  5KA5 A;  5LL6 Y;  3ABU A;  1Q81 W;  1XBL A;  1KUQ A;  4DUY O;  1H2S B;  1YSC A;  5BR8 O;  2ZIN A;  3D3I A;  1GO3 F;  4JAV A;  3KZI Z;  3Q4H B;  3A8T A;  4XDK A;  2IJH A;  1Q82 W;  3CYO A;  1M4U A;  1WPX A;  3CCU V;  2QWP B;  1ROP A;  3B77 A;  3ICX A;  4FM1 A;  2DQ0 A;  1P49 A;  4YHH O;  4DW1 A;  4U3J A;  4J11 A;  1PNL A;  4F6E A;  2N74 A;  1KKC A;  3OTO B;  1O9H A;  3OAA G;  4F6R B;  3CCM V;  1YJN V;  2EZO A;  2HLD G;  1KQS U;  4H37 A;  5LMU O;  4DV1 B;  3ZHU A;  5B1O A;  4I9W A;  4R50 A;  4B3M B;  5JCO A;  4JI4 B;  1WAZ A;  2DN9 A;  4LH6 A;  4GUN A;  1KYO F;  2HJD A;  1E79 G;  1VQ4 V;  4I4T B;  1JVM A;  1VQO V;  1DLB A;  4IYH A;  5JH7 A;  3QO5 A;  4MVS A;  1KBH A;  3ASO B;  4GKK O;  2DYR C;  2P4V A;  3AG1 C;  5J9P C;  3JAM N;  1XDC A;  1HDJ A;  4KHP B;  4JAU A;  2Y0P A;  1OCR C;  1YIJ V;  2Z0A A;  1FD9 A;  1NBM G;  4WFB V;  1TGO A;  4F4L A;  1KMI Z;  1Y67 A;  2DOS A;  1CXZ B;  3BFR A;  3LNN A;  2GV9 A;  1GRJ A;  3CCV V;  2Y69 B;  3JAK A;  1I5Y A;  2LW7 A;  4DR7 B;  1N32 B;  3ZBH A;  3DC5 A;  1ZL8 A;  2W6I G;  4LF9 O;  1JJ2 U;  1MZF A;  1F4M A;  3G67 A;  3X2Q C;  3JAW B;  1RSO A;  1KB9 F;  1NR1 A;  3EVK A;  1B06 A;  2F95 B;  3ASN C;  3CC2 V;  3E22 A;  3OMA B;  5H6Q A;  4BIU A;  1XOU A;  1TAE A;  3ETQ A;  1F23 A;  1FFX A;  3L9D A;  5JVD A;  3G6E V;  5EZY B;  5KMG A;  1HNX O;  2R9I A;  2UXX A;  5LXT B;  1QHT A;  2EIL B;  3B2E E;  3M7M X;  1K3E A;  3JSN A;  3ABK C;  2UUA O;  2MW2 B;  5E79 Z;  4CS3 A;  2NLJ C;  4UCU A;  4BW9 A;  4EKW A;  1PP9 H;  2GHY A;  3HKD B;  1GM9 A;  4X89 A;  3SYQ A;  2ZQM A;  2QWQ B;  3EFF K;  3SJB C;  4FPP A;  3IJ4 A;  3UO3 A;  5EIB D;  4JYY A;  1FAF A;  2W0F C;  3F7V C;  4UVA A;  4TV9 A;  3K57 A;  1MZE A;  5IY5 B;  1VQ5 V;  1Q90 D;  4XBF A;  2WSS G;  3D36 A;  1YVW A;  1K73 W;  3IC7 A;  3CCJ V;  5L3F A;  2GSM B;  2A79 B;  4YJ2 A;  4P9P A;  3HKC B;  1YJ9 V;  3ZMS A;  5L3G A;  3CXC U;  2CTP A;  4B3R O;  2Z3Y A;  5LA6 A;  3RVZ A;  2WLL B;  4HNA A;  2YI9 A;  3UQ8 A;  4MTG A;  3QVN A;  3UKM A;  2P7T C;  4IT5 A;  2Q5Z A;  1IXM A;  1URF A;  2UXC B;  1K4C C;  1IVS A;  3KCX A;  4ZI7 A;  1Y66 A;  4JI4 O;  5LOV A;  1MAB G;  1NZ6 A;  2LJ2 A;  4CC6 A;  3MDS A;  5JH7 B;  4HBN A;  1S0V A;  3AG4 B;  4J7J A;  4BR6 A;  4L8J A;  1FOU A;  3RVY A;  3MHS C;  5BXZ A;  3LDE A;  4I9Q A;  4NXM B;  2X0L A;  2D3O W;  1PD3 A;  1N33 B;  1XHX A;  3PJS K;  1VF6 C;  4LR3 A;  1IBK B;  3ASO C;  1A32 A;  1VQ9 V;  4LP8 A;  2LP7 A;  4JYC A;  2JEU A;  3JAR B;  1S3J A;  1R6T A;  4I5S A;  1H38 A;  5CB4 A;  4NTW A;  3BCC H;  4GX2 A;  4JZ2 A;  2E75 B;  3HKB B;  5H5N A;  3VBB A;  1I94 O;  4LFB B;  1V54 C;  4ZIB A;  1W0K G;  4O4H B;  3AK3 A;  1JPX A;  1H2G A;  3ZMZ A;  5IT9 N;  2JGD B;  3OE7 G;  4OPH A;  1S72 V;  3WB2 A;  4EB6 B;  4DV5 O;  3A2F A;  2Y69 C;  1JFF B;  3E2E A;  5KHJ A;  3WG7 B;  1SQG A;  4X1I A;  3APQ A;  1VQM V;  1GM7 A;  1FFX B;  5KHK A;  1K9M W;  3P3N A;  1SS3 A;  3CHX A;  2QKC A;  3SPJ A;  2IW5 A;  2KSD A;  4AI8 A;  5LP6 A;  3JD4 A;  1FS0 G;  2WAM A;  3ABM C;  3EXA A;  4JI1 B;  2CH7 A;  4I55 B;  5CA0 B;  2JEX A;  4FIP C;  1XQ8 A;  3ETD A;  4LWS A;  4MVM A;  4D6T H;  4DV3 O;  2K9P A;  5LHH A;  2E76 B;  4B3T B;  1NKD A;  2FML A;  4KP4 A;  3K3W A;  4FFB B;  4J42 A;  1SRY A;  2CAZ C;  3ZN0 A;  5JJJ B;  2OYQ A;  4FLX A;  4JTC B;  2Q7G A;  4UCS A;  3K5L A;  3H1K H;  4GYC B;  2EJ7 A;  5IY5 C;  2X6A A;  3T4D A;  5LYJ B;  4DV7 B;  1GH6 A;  3WU2 Z;  4K8Z A;  1FYJ A;  4AQY B;  2F1M A;  3FB7 C;  1XRE A;  2XAS A;  3K0G A;  1VIB A;  4MSW C;  1N34 O;  1AR1 B;  1U96 A;  1JX9 A;  4DUY B;  1IDS A;  3ZCC A;  4ABM A;  5BR8 B;  5EBL C;  3LUT B;  4DR4 O;  4DO2 A;  4LCU C;  1SQF A;  3CCQ V;  3SYP A;  1AI7 A;  4O4I B;  2AGA A;  3JAS B;  5KUM A;  3RYI B;  3CP1 A;  4OX9 O;  2Y4U A;  1XHZ A;  4FM0 A;  2CGO A;  1KD1 W;  4YHH B;  1AP6 A;  3P30 A;  2GBO A;  4YXW G;  2HP8 A;  4QGP A;  5IDJ A;  2Q7E A;  4NXM O;  5EYP B;  4QIW F;  1N33 O;  3SPH A;  3AG4 C;  1DK1 A;  1MG1 A;  5BY1 A;  5LMU B;  1NVP D;  3K0D A;  1Z2G A;  2Q0O C;  1R3I C;  2YUA A;  4K35 A;  3TK1 A;  3DC6 A;  5CB4 B;  1MOF A;  1YXB A;  1OCO B;  2CTW A;  1EZJ A;  4YJ3 A;  4LF5 O;  3CCR V;  4CH5 A;  4J10 A;  2JIZ G;  2AW9 A;  2BOC C;  3LSU A;  1Y76 B;  3N2K B;  4LC1 A;  2ZR3 A;  4GKK B;  4OXS A;  3K5M A;  2QTS A;  2AZ2 A;  1P7B A;  1S76 D;  2ZIO A;  3ZMV A;  5B5E Z;  1GMG A;  1HP8 A;  3ABT A;  1JJO A;  1FXK B;  3ZMT A;  4YIP A;  1RPR A;  4ASU G;  1Y4M A;  3B8N A;  2E74 B;  3OW2 U;  3WG7 C;  1Q6H A;  3S3X A;  2IBZ H;  1GM8 A;  5LP6 B;  2VQE O;  2DE0 X;  4UB6 Z;  2JJ1 G;  3BAB A;  2WLM A;  4LF9 B;  4P9O A;  3T4Z A;  2QJ1 A;  4J7Z A;  5GON A;  2QEX V;  4JI2 B;  4IHJ A;  1SA0 A;  2P4K A;  2YSU B;  4MTX A;  4O4L B;  1AVM A;  1VQP V;  2ZKO A;  1K5S A;  2DWE C;  4JF3 A;  3UT5 B;  3FAV A;  2AHY A;  1GN4 A;  1HNX B;  4WF9 V;  3DGE A;  3KDR A;  4X64 O;  3JD3 A;  2UUA B;  2GUZ B;  3QNE A;  4HYO A;  4DR5 O;  1DGS A;  1QNM A;  4JTA B;  3MAQ A;  2BTQ B;  5GTH Z;  4AIL C;  4RUF A;  3BEH A;  4X1K A;  4PJ0 Z;  1VQN V;  1I0H A;  4NXN O;  2JS3 A;  2LFS A;  4O2A A;  2ZCE A;  3N27 A;  1M57 B;  1OJH A;  3STZ C;  2OIE A;  2RJZ A;  4Q20 A;  2YXH A;  4TSF G;  1K92 A;  1S77 D;  4JAA A;  2IU0 A;  4PDR A;  3H1H H;  3HKE A;  1GKF A;  4WBN B;  2QGN A;  4B3R B;  3I5D A;  1XIL A;  1CP9 A;  4X1Y A;  4OPA A;  4YIO A;  4N23 A;  1NTM H;  4JI0 O;  1R3L C;  2Q67 A;  2ZE7 A;  2KKW A;  5DN6 G;  2BE3 A;  1EN6 A;  3RYH A;  4AHC A;  2Q69 A;  4B3S O;  2Q8V A;  3CX5 F;  3ZRW A;  5J2T A;  3ZED A;  2NN4 A;  3HB3 B;  3U11 A; 
#chains in the Genus database with same CATH homology
 2GDS A;  3AK3 A;  1SZX A;  1XDC A;  1P7G A;  1WB8 A;  1EN4 A;  2P4K A;  1EN5 A;  2ADQ B;  1BSM A;  1AVM A;  2CE4 A;  3KKY A;  1GN2 A;  1N0N A;  1I08 A;  2QKA A;  1AP6 A;  1GN6 A;  3C3T A;  1GN4 A;  1Y67 A;  2QKC A;  3BFR A;  3QVN A;  5A9G A;  1VAR A;  3CEI A;  3KDR A;  1ZTE A;  3DC5 A;  4X9Q A;  1ZLZ A;  1QNM A;  1BT8 A;  1GN3 A;  4JZG A;  1IXB A;  1XUQ A;  1MA1 A;  3RN4 A;  3DC6 A;  3EVK A;  1B06 A;  3TJT A;  1WB7 A;  1I0H A;  1AR4 A;  3MDS A;  1VEW A;  1LUV A;  2AW9 A;  1JA8 A;  3LSU A;  4BR6 A;  1JR9 A;  1N0J A;  4F6E A;  1KKC A;  1IX9 A;  1MSD A;  1PM9 A;  1ZUQ A;  1D5N A;  2RCV A;  4C7U A;  1MMM A;  3OT7 A;  5AG2 A;  4YIP A;  1EM1 A;  1AP5 A;  3AK2 A;  3AK1 A;  2ADP A;  1MNG A;  3IC9 A;  1PL4 A;  1LUW A;  1XIL A;  3C3S A;  1BS3 A;  4FFK A;  4YIO A;  3K9S A;  4JZ2 A;  4GUN A;  2CDY A;  1XRE A;  1AR5 A;  4JYY A;  1EN6 A;  4E4E A;  1IDS A;  1ZSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...