1LUWA

Catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKQHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Catalytic and structural effects of amino acid substitution at histidine 30 in human manganese superoxide dismutase: insertion of valine C gamma into the substrate access channel
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1luwA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1luwA02
4JZ2A 1D5NA 1BT8A 1EN5A 1AP6A 1SZXA 2CDYA 3AK1A 1QNMA 3BFRA 1N0JA 4JZGA 3RN4A 4GUNA 3AK3A 1WB7A 1MMMA 2AW9A 1ZLZA 2ADPA 3KKYA 1JR9A 1IDSA 3DC5A 1IXBA 2QKCA 3EVKA 1ZSPA 2QKAA 1PM9A 1GN3A 1AVMA 1EN6A 4BR6A 5A9GA 1PL4A 1AP5A 4C7UA 1I08A 1AR4A 3CEIA 1IX9A 1GN4A 1ZTEA 1XUQA 3MDSA 1BSMA 5AG2A 1AR5A 4JYYA 1VARA 1EN4A 1LUVA 1WB8A 3OT7A 1VEWA 1P7GA 2P4KA 3TJTA 1XDCA 1N0NA 1LUWA 2RCVA 4E4EA 3C3TA 2GDSA 3LSUA 3K9SA 1KKCA 2ADQB 2CE4A 1I0HA 4FFKA 3IC9A 1ZUQA 4YIOA 1JA8A 1XREA 1Y67A 3C3SA 1B06A 1XILA 4F6EA 1MNGA 1BS3A 3QVNA 4X9QA 1GN6A 1MA1A 1EM1A 1MSDA 3DC6A 3AK2A 4YIPA 1GN2A
chains in the Genus database with same CATH superfamily
1FXKB 4GKKO 5FPRA 3N2GA 2GTAA 3A2FA 1YIJV 4MTGA 4Q20A 1T5EA 2UXDO 4JZGA 3CWBH 1Q82W 1JOYA 2QSAA 2CTRA 1QCEA 3G80A 4R7CA 3QO7A 3JYCA 4DYLA 1NBMG 4EB6A 3SDLA 5KLVH 1YTFD 3CRQA 1R1BA 4I0XB 4P2ZA 1SF9A 3BPZA 2XNDG 4LFAO 4O4HB 4ZHQA 4ZBMA 4I9WA 5CMUA 5LYJB 4JI8B 2HVKC 4J9ZB 3TXQA 4MW3A 1XOUA 4NR1A 5EBWC 2XT9A 5DEDA 3AG3C 4DR4B 1WP7A 1NU1H 2V1DA 5J9PC 5LOVA 1HNZO 4ICGA 4E4EA 1AJNA 1ROPA 4JI6O 2LGWA 4MVMA 5H5NA 5CB4A 5BXZA 1I0HA 3W7TA 2OT5A 3ASOC 3NXSA 2F1MA 1KC8W 4JF3A 2EX3A 4K0KO 1Y67A 1BHBA 2QWOB 5LP6C 3CC2V 3H1HH 3G6EV 3SYAA 3BAAA 2AZ0A 1GN6A 1Q7YW 1MSDA 5B5EZ 2VQFO 3BABA 1PL0A 3VBBA 4WFFA 4PD4F 4GYCB 5HFMA 2P7TC 4TSFG 1JFFA 1H8HG 2EIKC 1P7BA 2WWWA 3E89A 2HFEC 3PN1A 3ASNC 3HKCA 3CPWU 2E3CA 4KFMA 3U0ZA 1QU7A 4DXWA 3RYFA 2M7WA 4JI6B 4I50A 4JI0B 4JI1B 5L3GA 1IDSA 4NYKA 1IXBA 1K34A 2WLIB 2YIDA 4FM2A 1WPXA 2XAHA 2B1GA 1LR1A 3I5DA 1H2KA 2Z3YA 2Q7EA 5FL7G 2CTPA 3UT5A 1WLEA 4XDJA 5KA5A 2BTOA 4DV1O 5B3SB 3GWKC 4I5SA 4DV5B 1EN4A 1K5QA 2CGOA 5EIBD 4JAAA 2ZNIA 2V7QG 1L1FA 3JSLA 2DWDC 1K3EA 1L0LH 3R65A 2ODMA 2P22C 1QBZA 2PYJA 4QPKA 4NVPA 5JCOC 1MABG 2LQTA 2DE0X 2WSSG 3OUFA 5LXTA 2YUAA 4LF7B 3FB5C 1RSOB 4X64O 1M1KW 3ABTA 1ZUQA 1JA8A 3N2GB 3SPCA 3ZMZA 5FNVB 4AHCA 4KHPO 1I5XA 1YXBA 4E2LA 5GTHZ 4PV1B 4QNHB 4X1KA 1AILA 1Q86W 4O2AB 3QG5A 2M6YA 2F4VB 1HNWO 4WBNA 2QEXV 4EB6B 3CCJV 1GN2A 3CMAV 4DW0A 2Y69C 3RGBA 1NR1A 5C93A 4RUFA 2UXBO 3AG4B 3QF7A 4LP8A 3RBZA 1P84F 3EXAA 4BIZA 3X2QC 1S77D 3H1LH 1U96A 1E79G 4NXMO 5J2UB 2ADPA 1QHTA 2QWNB 1TGOA 5EBLC 1QR9A 4FFBA 3UCSC 4L8JA 3DTUB 1BHAA 4X64B 1S3JA 2R9IA 4D7SA 3G71V 3F5WC 2A9HA 4CH3A 4BR6A 2PF4E 3ML0A 3ZN1A 4CH4A 4PDVA 1WPBA 5JCOA 3LSQA 1F51A 1BSMA 2QTOA 5CB4B 5HFLA 4DR6O 4JYCA 1VQLV 1YJNV 1XMOB 4B7EA 3H9VA 4X1IB 2RQ6A 3JAKA 4DUZO 2W0FC 1BQZA 2LFRA 1SZTA 4EFBA 1KBHA 2K1EA 5J2TA 3C3TA 2UXNA 1VQOV 4DW1A 1MG1A 3UQ8A 1COWG 5L3DA 4JASA 3WG7C 3IJ4A 3IC9A 5FLXN 3JAWB 1JFFB 1AI7A 3ZHVA 3LDEA 2GUZB 3BEHA 4WFBV 4MTXA 4B7KA 1VP7A 5KX5B 2X7RB 2QWQB 4DR7O 3E8GA 5KHIA 1VQNV 1WP8A 1K4CC 2ZIMA 1NJIW 3GB7C 3DSQA 1ZX3A 3AG3B 3CMEV 3RYIB 1VF5B 4NXNB 1VF6A 3ZHQA 1PPJH 1R73A 4KXRA 2CDYA 4CS4A 1THZA 3JD0A 5FPOA 1VQMV 4LF6B 2IJKA 2QM8A 5C8YA 5CA1A 3SPGA 3P30A 2ZR2A 1H2MA 3E22B 2KG7B 3E8FA 2FL4A 4FM0A 4AILC 3CCLV 1HNXB 2BE3A 3ASOB 3GWOA 1GN3A 3FAVA 4DV4B 2EULA 3CD6V 5LP6B 1XMQB 1GKFA 2YEVA 2PI4A 3CJHB 1GN4A 2Q0AA 3J81N 4FLUA 3ZRWB 3N27A 3CCVV 3JASB 3OEHG 2JS3A 1ORQC 3T2MA 3THOA 3APOA 2QWRB 1FXKA 5GW7A 1DF4A 1P49A 3K5OA 3OTOB 4JAVA 4DR3B 3T4DA 2GV9A 2Q67A 1Q6UA 3ABKC 4FVMA 2EIKB 3CC7V 3KCXA 4X1KB 2RCVA 1K97A 1R6TA 1VQ6V 3ASNB 2DYSC 3CXCU 2Y0IA 2GDSA 2IU0A 2F23A 1YF2A 2DN9A 2PTMA 5LHGA 3QO5A 3G6BA 2ITDC 5JVDA 2HHHO 4FFKA 4JI4B 2Q9LA 3OAAG 2L6LA 1NS1A 2YXHA 2AHYA 1F7YA 1Q8IA 2LFSA 2WLJA 4I0XA 2GSMB 1K73W 4B3RB 1K4DC 2XAFA 3MAQA 4O4LA 4X89A 4O4HA 1FFTB 1XEQA 2Q7HA 4GCZA 1WNSA 4Q6GA 5H6QA 1GTOA 1F23A 2FB5A 4ASUG 5LYJA 4UB6Z 4EFEA 2ARHA 4PA4A 4BIOA 1H38A 1N33O 1BZKA 4JI3O 4B3SB 4H13B 4KUMA 1H2GA 2B5UA 1I94B 5DN6G 3H01A 2OIEA 1V55C 2NR5A 3K5NA 1FYJA 4X88A 1X59A 4B3TO 2HKOA 2XAQA 3JARB 3K0GA 4JI5O 3ZN0A 4J10A 3IGAC 3JAMN 4ZI7B 2XHBA 1JR9A 3AG1C 5BR8O 4JTDB 4IL6Z 2YC0A 4J42A 5L3CA 3D8CA 2HHHB 4UCTA 3M7MX 4C7UA 4LF5O 1SQXH 2UUCO 1SETA 4DR2B 2E74B 4IGGA 3O65A 4PA7A 1IBLO 1AR5A 3RT3C 2L35A 1N33B 2A79B 4HNAB 3K0DA 4GKJO 2HP8A 1VMGA 2ZDIC 4FPPA 4HAMA 2QTSA 1FXHA 2Y69B 1N32B 3J80N 1JVMA 1GRJA 4QPJA 4P30A 1JPXA 1EZVH 3K9SA 4OX9B 2ZE6A 4X66O 2LW7A 1GMGA 4J9YB 3K59A 2VWKA 1KECA 4XDLA 4YHHB 3K3WA 2WLIA 2AGAA 4OPHA 2F43G 1DTOA 5BMVB 4F6EA 2ZQMA 3FYEB 4X8AA 5IYZA 2E5LB 3OMNB 4PDMA 1FFXB 3N2KB 3CYOA 5BY1A 3O9OA 1L0NH 4LH6A 2IW5A 1EM1A 4U3FH 4GX0A 1IBLB 3ABLB 3KDRA 2QKSA 1BT8A 1GM9A 2QDOA 2Y4UA 1XNQB 2QWPB 2DMXA 4UXNA 3BFRA 2YDEA 2F66C 4JI8O 1BL8A 1W0JG 4DR1B 2NLJC 1Q6IA 4ZIBA 4G28B 5D5PA 1YEWA 1AJPA 3K5MA 3KKYA 3UM7A 3HPLC 1NZ6A 4DR4O 3ABMC 1L8DA 1RSOA 1U97A 3WG7B 4YY3B 4DK0A 4LC1A 2QJ1A 3ZMTA 1RP3B 4D6TH 3OR6C 3GVMA 5CA0B 4LFCO 1KB9F 5FNVA 1QLNA 1I08A 1AR4A 1R3IC 1FS0G 1Y74B 2HG5C 3W7UA 4O2AA 2GBOA 5AG2A 1FAFA 4QGPA 4TV9B 2OTLV 2MW2B 5JVDB 1NTMH 4O4JA 3KCYA 2W6JG 5IWAO 1M56C 4UV9A 2JJ2G 3STZC 1YJ9V 4O4LB 1EFRG 3NR7A 1J95A 4QIWF 5J2UA 4LR3A 4BW9A 3F7YC 4L87A 1NH2D 4QJFB 1GK9A 1F4MA 1VQ7V 4YIOA 4AQYO 1R6KA 3CCRV 5B1AC 2OIGA 5B66Z 3TK1A 3J7AU 2JGDA 4LFCB 3B77A 2YICA 3A0RA 1VQPV 4JI0O 3D3QA 4JI1O 4MVQA 2XTAA 2EBOA 2RN9A 1H2NA 4PDRA 5H9CA 4JI2O 3FFQA 1GM7A 2IM9A 4IHJB 2AXTZ 1EN5A 3L75H 2YXLA 1SZXA 4X1IA 3K03A 5IWAB 4U3JB 3SGIA 1SQPH 3ABKB 3AK3A 3CCMV 1TUBB 3M99B 2DYSB 1Y4MA 4JPRA 2A7WA 4NTXA 4DV5O 1W59A 4LF4B 2DJVA 3TETA 3T1YB 1GM8A 1WA8B 1EBOA 1Z2GA 3P32A 1B3QA 2A06H 1FXVA 2QKAA 1NVPB 1KQSU 4F6RB 3OW2U 3JAWA 4AQYB 3S3WA 4IIJB 3VQWA 3WB2A 1AB3A 4R8CA 4PI0A 2GUZA 2KSDA 3OFNG 5KAFZ 3CEIA 5KX5A 1VQ4V 1SC5B 4LF7O 2BCCH 4FLVA 4GX5A 1VARA 2CTWA 3A8TA 2B1IA 1MZEA 4NTYA 3K08A 3ZMSA 4JI2B 3SYQA 3CP1A 3M8AA 2ZR3A 3RYIA 4X1YA 2P4KA 1V55B 2LO1A 2RDCA 4K8XA 5IYZB 3I56V 4U7OA 4ZKIA 2F4VO 3B09A 2R9AA 4LF8O 1NT2B 4IYIA 2D3OW 1QLEC 4UVBA 1IZ3A 1K8AW 4HBNA 2Q73A 4R6ZA 4BIUA 3E22A 2KG7A 3CRAA 4HYOA 4I4TA 4DV7B 1JNBA 3AG1B 2VS0A 2JJ1G 1B06A 1XILA 2QR4A 1JJOA 3W7WA 4FLXA 4WFEA 2PUSA 1S76D 5LP6A 3L73H 1YHQV 4DR5B 4H37A 3CJHA 3DC6A 2A3QA 4MTFA 3ZRWA 3AK2A 2WAMA 1HR0O 3JASA 4JGSA 1CPYA 3CSXA 1WN7A 4FZ1A 5EZYB 1SRYA 2GHYA 5KAIZ 1OCZC 5IDJA 1R3LC 1OJHA 3W7SA 4NB5A 1YJWV 3JALB 3T4ZA 4TV8B 5LGTA 3D36C 4U7NA 4TUYB 3BRCA 4TQFA 5H2FZ 1SA0A 1D2DA 1RPRA 1YSCA 2ZE7A 5CA3A 1XHZA 5EYPB 3ZEDA 2YIAA 1H2LA 2LP7A 1IBMB 1DGSA 1E1RG 2AHZA 4LF8B 1XMOO 1GO3F 1UJWB 2ATKC 4O4JB 2Q6AA 3P3NA 4UVAA 2JVDA 1AI5A 2HEPA 4X65B 5A9GA 1PL4A 1O9GA 3RW0A 5F2VO 2IBZH 4QE7A 1IBKB 1MSWD 4XDKA 1XHXA 4B3MO 1CEZA 3UO2A 1BCCH 2UXCB 4YJ2B 2XUMA 4RUEA 1VQKV 1N34B 2N74A 1QR8A 1HR0B 3ZBHA 2E76B 1S0VA 1BQ0A 4F4LA 4DV2O 1N0NA 2JGDB 1XL6A 3AEIA 3JARA 3B2EE 2Y4TA 1ENVA 3DGEA 3L9DA 1YI2V 4ZI7A 4FLYA 4FZ0A 1WAZA 3LNNA 4BAYA 1SQGA 2X6AA 3ABLC 1YTFB 2UUBO 3ABMB 4NXNO 1TUEB 3E2EA 4NKGB 2A0LA 2JEXA 4LF6O 1Q3EA 1DLBA 3IAYA 2ZIOA 2EZOA 3WB0A 3QVNA 3D36A 3F7VC 5H6RA 4R50A 3Q4HA 2ZT9B 1HNXO 4B3MB 1PD3A 4JYAO 1PV0A 4HNAA 2F95B 3SJAC 4O4IA 4DV4O 3B8NA 3E35A 3UO3A 5KMGA 4OXSA 1M56B 2WLHA 4IT5A 1XMQO 2E75B 1YDXA 3T1CA 4DV2B 4RAIA 3TGUH 1V54C 4UFZA 1M57C 4DV3B 3F5TA 4OGQB 1K7DA 5LHHA 4DR3O 1NR7A 2WLMA 2QKCA 3OTOO 2C2AA 4MT8A 4DV6B 3LSSA 4MVSA 3CCQV 2UUBB 4GZRB 4X1YB 3OMIB 5B1AB 1S5HC 1M93A 2B9ZA 2PY5A 5BMVA 5KHKA 5EC2C 4WF9V 3OE7G 2XAJA 1FFXA 3ICXA 1Q81W 2DQ0A 3N2KA 1XUQA 2LJ2A 3CCSV 1S72V 2F93B 4LFBB 2YIBA 4H0LB 3ZRSA 1TAEA 4JI4O 4I4TB 4IYHA 2CTQA 1F4NA 2R72A 1JQ0A 4BWAA 1DK1A 1MZFA 4JYAB 3ZJZA 4B3RO 1P7GA 4K3AA 4XBFA 3VOUA 2N05A 1LUWA 1N8RW 1XI1A 3HB3B 3LDDA 4CC5A 1WJZA 1KP2A 1SQBH 4B3SO 2Y0PA 1I94O 2HJFC 1K9MW 3P3PA 1HDJA 5CA0A 2X0LA 4Z2WA 2BOBC 1IXMA 4J11A 1Z5VA 1SA0B 3SPIA 1Y74A 4I7ZB 3AG2B 4MVOA 1SS3A 4TV9A 4BW5A 1JCHA 1XNRO 2ZM6B 1NI8A 1YZBA 1G4YB 3CCEV 4PJ0Z 4DR2O 3RYHB 5BZBA 3W7XA 4OPAA 4MTOA 4DO2A 1MMMA 3FKSG 2YI9A 4UUJC 4UVCA 1H5WA 3HR0A 4FLWA 1M4UA 1QLEB 2P90A 4O2BB 1ZSPA 1AR1B 2PI5A 3L70H 1N32O 1I7FA 5E79Z 4KP4A 1K92A 1OCCB 4OX9O 1YVWA 2FKXA 1PNMA 2P06A 4X62B 3WB1A 4QE9A 1Q5OA 2ZNJA 2Z5UA 4YHHO 3DXRB 5LMUB 1SQFA 1RPOA 4LBEC 4UV8A 1XNRB 2ZE5A 4IHJA 2IJJA 3ZMUA 1OCZB 2E5LO 2JRIA 5IE9A 1XQ8A 1Q6HA 4U3JA 2WLLB 3B8MA 1TUBA 5L3FA 3Q4HB 4WFGA 2ZD9A 2YS8A 5KHHA 2ADQB 5LA6B 2CE4A 1FPOA 4AI8A 4MVRA 1M9NA 1WA8A 2GTSA 3SJBC 4O4IB 5KMGB 2WLKA 1XNQO 4DRXA 4F6RA 4ABMA 1OCRC 3CS5A 2ZKOA 2Q0OC 3VQYA 4WCEV 4IIJA 2P6JA 3MD0A 3MHSC 1US6A 3VQXA 3ETGA 4Z1VA 4DR1O 1RFYA 4J7ZA 1IJGA 1SQVH 2LW1A 3SPHA 1AI4A 4ZOLB 1MA1A 5JH7B 2Y48A 2HVJC 2XASA 3JATB 3JD4A 4LNUB 4YY3O 1JJ2U 2QA4V 2EJRA 2OTJV 2XOKG 3RFRA 5IY5C 1X4TA 3FB6C 4GX1A 5B1OA 1AP6A 3TXSA 1E1QG 2EILC 1UFIA 4JTCB 2MK3A 2ZINA 2IJIA 2ETNA 2IH3C 3EFFK 1O9HA 4YJ3B 2X6CA 2BTQB 3EVKA 1PM9A 1M5IA 5IYDO 5JJJB 4MVZA 3T1HO 3ETDA 3HKDA 4J7KA 4JV5B 2Q7GA 1ZL8A 3CX5F 4HZ3A 2YXYA 3OGIB 3RVZA 5EZYA 2Q4PA 2W6IG 4RO2A 3CRRA 2OWOA 2EZPA 2JGUA 2EIJC 2ZDIA 3HKEB 1VQ5V 3B4SA 3JALA 4TV8A 5EBMC 3LSUA 3PJSK 4TUYA 3RVYA 1KKCA 1V54B 5EYPA 3E86A 1FJGO 1M57B 1MOFA 1A32A 5LBQA 3RYCB 3A0HZ 3UKMA 4LWSB 4LF9B 2AZ2A 1MNGA 3G4SV 5TISZ 4K8ZA 2DYRC 1PNKA 2RMKB 3WU2Z 3D3IA 3ABUA 3SYPA 1VQ8V 3T1HB 4LF4O 4I55B 3T1YO 2RJZA 3S3XA 5JJEB 5KHJA 1CP9A 1YITV 4D7TA 2UUAB 1Y66A 4YJ2A 4PA9A 1OV9A 4WFAV 3ZIAG 1G1XB 3RN4A 1QVFU 4GUNA 5LMNB 3ETEA 4JI7B 2KKWA 3SYCA 3ZHRA 2VWJA 3AG7A 4GT1A 1KKDA 3E8HA 5KA6A 1FJGB 3CC4V 4GKKB 2QGNA 3A0BZ 2DWEC 5IJ9B 4CS3A 2YI8A 2Z0AA 5CBFA 2UXDB 5JQGA 3FB7C 1NKDA 1IX9A 3STLC 5GONA 1RM1C 5IYBO 3ZHUA 1HWYA 4FIPC 1KP3A 4DV7O 4RQEA 4EEQA 2ZCEA 4YXWG 2DQ3A 2O57A 1VIBA 4DRXB 2JS5A 5L3EA 1B6QA 1N36O 3ZCCA 2P4VA 4LFAB 2WPDG 4DR5O 5JJNB 3LDCA 5DM6V 2ZXWC 2CH7B 2EINC 3C90A 5B1BC 3AG2C 4G27B 5EIBC 2QM7A 4RQFA 3E83A 3CHXA 1Y76A 2HR3A 4JTAB 3ZHTA 1HNZB 4CH6A 3BCCH 4PI2A 3QNEA 4X9QA 1SERA 4PA6A 1IBMO 3OR7C 3FX7A 1R6NA 4FJCC 2EJ7A 2JK5C 1R3JC 3QTCA 1UPGA 1Y6XA 4X65O 1G6UA 3VQVA 4K0KB 2NNUA 3AK1A 3ZX6A 1OCOC 1TVKB 3BY6A 1N0JA 4Z1MG 1N36B 2UU9O 3HKDB 1IBKO 1OCCC 4K35A 5LHIA 1WB7A 3CRCA 1ZL8B 1GH6A 1XL4A 3K06A 1N4CA 2UXCO 1IVSA 1D5AA 2X6BA 1NTZH 2VQFB 1N34O 5B1NA 3MHHC 4JYBA 1OCRB 2K9PA 4MVUA 2HJDA 4UCSA 4N21A 4PDLA 1FKAO 3ZMVA 2RNBA 3MDSA 1H2SB 3BHPA 2H3OA 3JD3A 1JMKC 3SJCC 1G8MA 3JD1A 5JWPA 3OT7A 2G38A 5IY5B 1JX9A 3CB2A 2OCCC 4CBCA 2EILB 3CXHF 4FLZA 3RYHA 2UU9B 1R3KC 1SQQH 3K58A 5CBGA 5DECA 4DV1B 5L3BA 5LL6Y 5IYCO 1BGYH 1HW7A 5A2QN 4P9PA 5GTIZ 5ITZA 3SR2C 4O2BA 4ZHQB 3OD4A 1P4RA 1K5SA 4GLXA 2LGQA 2BSKA 4CC6A 4DV3O 4MS2A 1VF6C 3IC7A 4P9OA 4DV6O 2W0XA 4TWKA 3JCUZ 2QM4A 3DXRA 1B04A 5KUKA 1CXZB 1DF5A 1I5YA 2CUGA 1K33A 5LOVB 1QNMA 1M90W 4UCRA 4KHPB 5JQGB 3L71H 2CAZC 2PYLA 2EIJB 1AROP 5GONB 3ZS8C 4EKWA 4KL1A 2AW9A 1ZLZA 4LFBO 2WLLA 1NH2B 4WFHA 1FOUA 1HNWB 3DC5A 4CS2A 1J5EO 3OM3B 5LA6A 1GAXA 4DUYO 3BA8A 2EIMC 3FB8C 1EN6A 2ILMA 5D5QA 1QVGU 2UXBB 4NTWA 3K9AA 1NQTA 3FYIB 4NXMB 1ZTEA 2DYRB 2H94A 2YIBD 4MW8A 1FXKC 4ZOLA 1ZWIC 5JH7A 3JATA 4LNUA 3BA9A 1LUVA 5IJ0A 1WB8A 5LGNA 2FMLA 1Y76B 3LUTB 3SJQC 5EC1C 1S5LZ 1OHHG 3HKCB 3QO8A 4B08A 3HKBA 4N23A 4GX2A 3RYFB 3FD9A 4I50B 4H33A 3L74H 3APQA 3OTFA 1S5JA 4DR6B 4YJ3A 2CGNA 2ZM6O 2BTQA 1J5EB 4JAUA 1Z5WA 4DUYB 1YCIA 1H8EG 4J41A 3WFVA 2ITCC 2IH1C 2JEUA 3C3SA 4DUZB 2PGGA 3UT5B 4G2KA 3ZRVA 2Q69A 1BS3A 3H1KH 4X20A 4DK1A 3OMAB 1Q90D 1RM1B 2P5OA 4YIPA 2R70A 3R66A 5K1XA 4UCVA 2QE7G 3K04A 2NN4A 4MSWC 2Q5ZA 1AI6A 2R9RB 3HKEA 5LXTB 4X62O 3G67A 1V9PA 4W4KA 1FD9A 4PA3A 3U11A 4DR7B 2ZXWB 2EINB 4RWUA 2WA3A 5B1BB 5LMUO 4I9QA 1W0KG 1VF7A 4TT3G 3OUSA 3ZRXA 1AVMA 3RYCA 4LWSA 1PP9H 2KQXA 4CZZA 1LNQA 1VQ9V 5EK0A 5IT9N 3ETQA 1ZAUA 2V4DA 4WBNB 4I55A 2DOSA 2OCHA 5E1AC 4FK5C 5ITZB 3CCUV 1VEWA 2IU3A 1NTKH 1OCOB 3KG2A 1IURA 2BSKB 1BMFG 5KUMA 3CE2A 2JIZG 4FM1A 3BVOA 4FFBB 4H44B 3SPJA 2XAGA 1KD1W 3H1JH 1NVPD 3H1IH 1W2BU 3K57A 2D2CB 3OEEG 2FTKA 4UCUA 1PNLA 5IJ9A 5B3SC 2BOCC 1XBLA 5LGUA 5CBHA 4FLTA 3IFXA 3JD2A 3CRMA 2PZSA 1BE3H 2CK3G 4JZ2A 2OYQA 1HP8A 1SKVA 3ZHSA 3JAKB 1D5NA 2WLNA 2VQEO 3OGCC 4CH5A 5J2TB 4JV5O 2OCCB 4TOIA 1EZJA 3KZIZ 4LCUC 4A5UB 2KB1A 1OZ0A 3I55V 4J80A 2FYUH 2CH7A 5CN0A 3B40A 3K79A 4JI3B 5IJ0B 2H8PC 1Q43A 1TA8A 4TQDA 4W4LA 1PKXA 2ZE8A 3EHBB 3SYOA 1AP5A 3HKBB 4DV0O 2WA4A 3X2QB 4B3TB 5K1PA 4JI5B 2IJHA 2VRZA 2JDIG 1URFA 3JSNA 4JYYA 2Q68A 4PELA 3RWRD 2N04A 2UXXA 3E8BA 5BR8B 1KU9A 2HLDG 3AG4C 4LF9O 3TJTA 1XDCA 5C8YB 5CA1B 2VQEB 1TVKA 4LF5B 3JCZA 3K5LA 4LH7A 4X20B 2UUCB 1KUQA 2UUAO 4UCOA 3LNMB 4UB8Z 4FMTA 3FAVB 1XREA 1AJQA 2EIMB 4GKJB 4J7JA 1KMIZ 2YSUB 2DW4A 5LMNO 4JI7O 2YEVB 3U10A 1SESA 5KHGA 1QQCA 4DV0B 2Q8VA 3L72H 3TCUA 1KYOF 2P67A 4X66B 4PHZA
chains in the Genus database with same CATH topology
4JZ2A 3KDRA 1D5NA 1BT8A 1EN5A 1AP6A 1SZXA 2CDYA 3AK1A 1QNMA 3BFRA 1N0JA 4JZGA 3RN4A 4GUNA 3AK3A 1WB7A 1MMMA 2AW9A 1ZLZA 2ADPA 3KKYA 1JR9A 1IDSA 3DC5A 1IXBA 2QKCA 3EVKA 1ZSPA 2QKAA 1PM9A 1GN3A 1AVMA 1EN6A 4BR6A 5A9GA 1PL4A 1AP5A 4C7UA 1I08A 1AR4A 3CEIA 1IX9A 1GN4A 1ZTEA 1XUQA 3MDSA 1BSMA 5AG2A 1AR5A 4JYYA 1VARA 1EN4A 1LUVA 1WB8A 3OT7A 1VEWA 1P7GA 2P4KA 3TJTA 1XDCA 1N0NA 1LUWA 2RCVA 4E4EA 3C3TA 2GDSA 3LSUA 3K9SA 1KKCA 2ADQB 2CE4A 1I0HA 4FFKA 3IC9A 1ZUQA 4YIOA 1JA8A 1XREA 1Y67A 3C3SA 1B06A 1XILA 4F6EA 1MNGA 1BS3A 3QVNA 4X9QA 1GN6A 1MA1A 1EM1A 1MSDA 3DC6A 3AK2A 4YIPA 1GN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ2 A;  1D5N A;  1BT8 A;  1EN5 A;  1AP6 A;  1SZX A;  2CDY A;  3AK1 A;  1QNM A;  3BFR A;  1N0J A;  4JZG A;  3RN4 A;  4GUN A;  3AK3 A;  1WB7 A;  1MMM A;  2AW9 A;  1ZLZ A;  2ADP A;  3KKY A;  1JR9 A;  1IDS A;  3DC5 A;  1IXB A;  2QKC A;  3EVK A;  1ZSP A;  2QKA A;  1PM9 A;  1GN3 A;  1AVM A;  1EN6 A;  4BR6 A;  5A9G A;  1PL4 A;  1AP5 A;  4C7U A;  1I08 A;  1AR4 A;  3CEI A;  1IX9 A;  1GN4 A;  1ZTE A;  1XUQ A;  3MDS A;  1BSM A;  5AG2 A;  1AR5 A;  4JYY A;  1VAR A;  1EN4 A;  1LUV A;  1WB8 A;  3OT7 A;  1VEW A;  1P7G A;  2P4K A;  3TJT A;  1XDC A;  1N0N A;  1LUW A;  2RCV A;  4E4E A;  3C3T A;  2GDS A;  3LSU A;  3K9S A;  1KKC A;  2ADQ B;  2CE4 A;  1I0H A;  4FFK A;  3IC9 A;  1ZUQ A;  4YIO A;  1JA8 A;  1XRE A;  1Y67 A;  3C3S A;  1B06 A;  1XIL A;  4F6E A;  1MNG A;  1BS3 A;  3QVN A;  4X9Q A;  1GN6 A;  1MA1 A;  1EM1 A;  1MSD A;  3DC6 A;  3AK2 A;  4YIP A;  1GN2 A; 
#chains in the Genus database with same CATH topology
 1FXK B;  4GKK O;  5FPR A;  3N2G A;  2GTA A;  3A2F A;  1YIJ V;  4MTG A;  4Q20 A;  1T5E A;  2UXD O;  4JZG A;  3CWB H;  1Q82 W;  1JOY A;  2QSA A;  2CTR A;  1QCE A;  3G80 A;  4R7C A;  3QO7 A;  3JYC A;  4DYL A;  1NBM G;  4EB6 A;  3SDL A;  5KLV H;  1YTF D;  3CRQ A;  1R1B A;  4I0X B;  4P2Z A;  1SF9 A;  3BPZ A;  2XND G;  4LFA O;  4O4H B;  4ZHQ A;  4ZBM A;  4I9W A;  5CMU A;  5LYJ B;  4JI8 B;  2HVK C;  4J9Z B;  3TXQ A;  4MW3 A;  1XOU A;  4NR1 A;  5EBW C;  2XT9 A;  5DED A;  3AG3 C;  4DR4 B;  1WP7 A;  1NU1 H;  2V1D A;  5J9P C;  5LOV A;  1HNZ O;  4ICG A;  4E4E A;  1AJN A;  1ROP A;  4JI6 O;  2LGW A;  4MVM A;  5H5N A;  5CB4 A;  5BXZ A;  1I0H A;  3W7T A;  2OT5 A;  3ASO C;  3NXS A;  2F1M A;  1KC8 W;  4JF3 A;  2EX3 A;  4K0K O;  1Y67 A;  1BHB A;  2QWO B;  5LP6 C;  3CC2 V;  3H1H H;  3G6E V;  3SYA A;  3BAA A;  2AZ0 A;  1GN6 A;  1Q7Y W;  1MSD A;  5B5E Z;  2VQF O;  3BAB A;  1PL0 A;  3VBB A;  4WFF A;  4PD4 F;  4GYC B;  5HFM A;  2P7T C;  4TSF G;  1JFF A;  1H8H G;  2EIK C;  1P7B A;  2WWW A;  3E89 A;  2HFE C;  3PN1 A;  3ASN C;  3HKC A;  3CPW U;  2E3C A;  4KFM A;  3U0Z A;  1QU7 A;  4DXW A;  3RYF A;  2M7W A;  4JI6 B;  4I50 A;  4JI0 B;  4JI1 B;  5L3G A;  1IDS A;  4NYK A;  1IXB A;  1K34 A;  2WLI B;  2YID A;  4FM2 A;  1WPX A;  2XAH A;  2B1G A;  1LR1 A;  3I5D A;  1H2K A;  2Z3Y A;  2Q7E A;  5FL7 G;  2CTP A;  3UT5 A;  1WLE A;  4XDJ A;  5KA5 A;  2BTO A;  4DV1 O;  5B3S B;  3GWK C;  4I5S A;  4DV5 B;  1EN4 A;  1K5Q A;  2CGO A;  5EIB D;  4JAA A;  2ZNI A;  2V7Q G;  1L1F A;  3JSL A;  2DWD C;  1K3E A;  1L0L H;  3R65 A;  2ODM A;  2P22 C;  1QBZ A;  2PYJ A;  4QPK A;  4NVP A;  5JCO C;  1MAB G;  2LQT A;  2DE0 X;  2WSS G;  3OUF A;  5LXT A;  2YUA A;  4LF7 B;  3FB5 C;  1RSO B;  4X64 O;  1M1K W;  3ABT A;  1ZUQ A;  1JA8 A;  3N2G B;  3SPC A;  3ZMZ A;  5FNV B;  4AHC A;  4KHP O;  1I5X A;  1YXB A;  4E2L A;  5GTH Z;  4PV1 B;  4QNH B;  4X1K A;  1AIL A;  1Q86 W;  4O2A B;  3QG5 A;  2M6Y A;  2F4V B;  1HNW O;  4WBN A;  2QEX V;  4EB6 B;  3CCJ V;  1GN2 A;  3CMA V;  4DW0 A;  2Y69 C;  3RGB A;  1NR1 A;  5C93 A;  4RUF A;  2UXB O;  3AG4 B;  3QF7 A;  4LP8 A;  3RBZ A;  1P84 F;  3EXA A;  4BIZ A;  3X2Q C;  1S77 D;  3H1L H;  1U96 A;  1E79 G;  4NXM O;  5J2U B;  2ADP A;  1QHT A;  2QWN B;  1TGO A;  5EBL C;  1QR9 A;  4FFB A;  3UCS C;  4L8J A;  3DTU B;  1BHA A;  4X64 B;  1S3J A;  2R9I A;  4D7S A;  3G71 V;  3F5W C;  2A9H A;  4CH3 A;  4BR6 A;  2PF4 E;  3ML0 A;  3ZN1 A;  4CH4 A;  4PDV A;  1WPB A;  5JCO A;  3LSQ A;  1F51 A;  1BSM A;  2QTO A;  5CB4 B;  5HFL A;  4DR6 O;  4JYC A;  1VQL V;  1YJN V;  1XMO B;  4B7E A;  3H9V A;  4X1I B;  2RQ6 A;  3JAK A;  4DUZ O;  2W0F C;  1BQZ A;  2LFR A;  1SZT A;  4EFB A;  1KBH A;  2K1E A;  5J2T A;  3C3T A;  2UXN A;  1VQO V;  4DW1 A;  1MG1 A;  3UQ8 A;  1COW G;  5L3D A;  4JAS A;  3WG7 C;  3IJ4 A;  3IC9 A;  5FLX N;  3JAW B;  1JFF B;  1AI7 A;  3ZHV A;  3LDE A;  2GUZ B;  3BEH A;  4WFB V;  4MTX A;  4B7K A;  1VP7 A;  5KX5 B;  2X7R B;  2QWQ B;  4DR7 O;  3E8G A;  5KHI A;  1VQN V;  1WP8 A;  1K4C C;  2ZIM A;  1NJI W;  3GB7 C;  3DSQ A;  1ZX3 A;  3AG3 B;  3CME V;  3RYI B;  1VF5 B;  4NXN B;  1VF6 A;  3ZHQ A;  1PPJ H;  1R73 A;  4KXR A;  2CDY A;  4CS4 A;  1THZ A;  3JD0 A;  5FPO A;  1VQM V;  4LF6 B;  2IJK A;  2QM8 A;  5C8Y A;  5CA1 A;  3SPG A;  3P30 A;  2ZR2 A;  1H2M A;  3E22 B;  2KG7 B;  3E8F A;  2FL4 A;  4FM0 A;  4AIL C;  3CCL V;  1HNX B;  2BE3 A;  3ASO B;  3GWO A;  1GN3 A;  3FAV A;  4DV4 B;  2EUL A;  3CD6 V;  5LP6 B;  1XMQ B;  1GKF A;  2YEV A;  2PI4 A;  3CJH B;  1GN4 A;  2Q0A A;  3J81 N;  4FLU A;  3ZRW B;  3N27 A;  3CCV V;  3JAS B;  3OEH G;  2JS3 A;  1ORQ C;  3T2M A;  3THO A;  3APO A;  2QWR B;  1FXK A;  5GW7 A;  1DF4 A;  1P49 A;  3K5O A;  3OTO B;  4JAV A;  4DR3 B;  3T4D A;  2GV9 A;  2Q67 A;  1Q6U A;  3ABK C;  4FVM A;  2EIK B;  3CC7 V;  3KCX A;  4X1K B;  2RCV A;  1K97 A;  1R6T A;  1VQ6 V;  3ASN B;  2DYS C;  3CXC U;  2Y0I A;  2GDS A;  2IU0 A;  2F23 A;  1YF2 A;  2DN9 A;  2PTM A;  5LHG A;  3QO5 A;  3G6B A;  2ITD C;  5JVD A;  2HHH O;  4FFK A;  4JI4 B;  2Q9L A;  3OAA G;  2L6L A;  1NS1 A;  2YXH A;  2AHY A;  1F7Y A;  1Q8I A;  2LFS A;  2WLJ A;  4I0X A;  2GSM B;  1K73 W;  4B3R B;  1K4D C;  2XAF A;  3MAQ A;  4O4L A;  4X89 A;  4O4H A;  1FFT B;  1XEQ A;  2Q7H A;  4GCZ A;  1WNS A;  4Q6G A;  5H6Q A;  1GTO A;  1F23 A;  2FB5 A;  4ASU G;  5LYJ A;  4UB6 Z;  4EFE A;  2ARH A;  4PA4 A;  4BIO A;  1H38 A;  1N33 O;  1BZK A;  4JI3 O;  4B3S B;  4H13 B;  4KUM A;  1H2G A;  2B5U A;  1I94 B;  5DN6 G;  3H01 A;  2OIE A;  1V55 C;  2NR5 A;  3K5N A;  1FYJ A;  4X88 A;  1X59 A;  4B3T O;  2HKO A;  2XAQ A;  3JAR B;  3K0G A;  4JI5 O;  3ZN0 A;  4J10 A;  3IGA C;  3JAM N;  4ZI7 B;  2XHB A;  1JR9 A;  3AG1 C;  5BR8 O;  4JTD B;  4IL6 Z;  2YC0 A;  4J42 A;  5L3C A;  3D8C A;  2HHH B;  4UCT A;  3M7M X;  4C7U A;  4LF5 O;  1SQX H;  2UUC O;  1SET A;  4DR2 B;  2E74 B;  4IGG A;  3O65 A;  4PA7 A;  1IBL O;  1AR5 A;  3RT3 C;  2L35 A;  1N33 B;  2A79 B;  4HNA B;  3K0D A;  4GKJ O;  2HP8 A;  1VMG A;  2ZDI C;  4FPP A;  4HAM A;  2QTS A;  1FXH A;  2Y69 B;  1N32 B;  3J80 N;  1JVM A;  1GRJ A;  4QPJ A;  4P30 A;  1JPX A;  1EZV H;  3K9S A;  4OX9 B;  2ZE6 A;  4X66 O;  2LW7 A;  1GMG A;  4J9Y B;  3K59 A;  2VWK A;  1KEC A;  4XDL A;  4YHH B;  3K3W A;  2WLI A;  2AGA A;  4OPH A;  2F43 G;  1DTO A;  5BMV B;  4F6E A;  2ZQM A;  3FYE B;  4X8A A;  5IYZ A;  2E5L B;  3OMN B;  4PDM A;  1FFX B;  3N2K B;  3CYO A;  5BY1 A;  3O9O A;  1L0N H;  4LH6 A;  2IW5 A;  1EM1 A;  4U3F H;  4GX0 A;  1IBL B;  3ABL B;  3KDR A;  2QKS A;  1BT8 A;  1GM9 A;  2QDO A;  2Y4U A;  1XNQ B;  2QWP B;  2DMX A;  4UXN A;  3BFR A;  2YDE A;  2F66 C;  4JI8 O;  1BL8 A;  1W0J G;  4DR1 B;  2NLJ C;  1Q6I A;  4ZIB A;  4G28 B;  5D5P A;  1YEW A;  1AJP A;  3K5M A;  3KKY A;  3UM7 A;  3HPL C;  1NZ6 A;  4DR4 O;  3ABM C;  1L8D A;  1RSO A;  1U97 A;  3WG7 B;  4YY3 B;  4DK0 A;  4LC1 A;  2QJ1 A;  3ZMT A;  1RP3 B;  4D6T H;  3OR6 C;  3GVM A;  5CA0 B;  4LFC O;  1KB9 F;  5FNV A;  1QLN A;  1I08 A;  1AR4 A;  1R3I C;  1FS0 G;  1Y74 B;  2HG5 C;  3W7U A;  4O2A A;  2GBO A;  5AG2 A;  1FAF A;  4QGP A;  4TV9 B;  2OTL V;  2MW2 B;  5JVD B;  1NTM H;  4O4J A;  3KCY A;  2W6J G;  5IWA O;  1M56 C;  4UV9 A;  2JJ2 G;  3STZ C;  1YJ9 V;  4O4L B;  1EFR G;  3NR7 A;  1J95 A;  4QIW F;  5J2U A;  4LR3 A;  4BW9 A;  3F7Y C;  4L87 A;  1NH2 D;  4QJF B;  1GK9 A;  1F4M A;  1VQ7 V;  4YIO A;  4AQY O;  1R6K A;  3CCR V;  5B1A C;  2OIG A;  5B66 Z;  3TK1 A;  3J7A U;  2JGD A;  4LFC B;  3B77 A;  2YIC A;  3A0R A;  1VQP V;  4JI0 O;  3D3Q A;  4JI1 O;  4MVQ A;  2XTA A;  2EBO A;  2RN9 A;  1H2N A;  4PDR A;  5H9C A;  4JI2 O;  3FFQ A;  1GM7 A;  2IM9 A;  4IHJ B;  2AXT Z;  1EN5 A;  3L75 H;  2YXL A;  1SZX A;  4X1I A;  3K03 A;  5IWA B;  4U3J B;  3SGI A;  1SQP H;  3ABK B;  3AK3 A;  3CCM V;  1TUB B;  3M99 B;  2DYS B;  1Y4M A;  4JPR A;  2A7W A;  4NTX A;  4DV5 O;  1W59 A;  4LF4 B;  2DJV A;  3TET A;  3T1Y B;  1GM8 A;  1WA8 B;  1EBO A;  1Z2G A;  3P32 A;  1B3Q A;  2A06 H;  1FXV A;  2QKA A;  1NVP B;  1KQS U;  4F6R B;  3OW2 U;  3JAW A;  4AQY B;  3S3W A;  4IIJ B;  3VQW A;  3WB2 A;  1AB3 A;  4R8C A;  4PI0 A;  2GUZ A;  2KSD A;  3OFN G;  5KAF Z;  3CEI A;  5KX5 A;  1VQ4 V;  1SC5 B;  4LF7 O;  2BCC H;  4FLV A;  4GX5 A;  1VAR A;  2CTW A;  3A8T A;  2B1I A;  1MZE A;  4NTY A;  3K08 A;  3ZMS A;  4JI2 B;  3SYQ A;  3CP1 A;  3M8A A;  2ZR3 A;  3RYI A;  4X1Y A;  2P4K A;  1V55 B;  2LO1 A;  2RDC A;  4K8X A;  5IYZ B;  3I56 V;  4U7O A;  4ZKI A;  2F4V O;  3B09 A;  2R9A A;  4LF8 O;  1NT2 B;  4IYI A;  2D3O W;  1QLE C;  4UVB A;  1IZ3 A;  1K8A W;  4HBN A;  2Q73 A;  4R6Z A;  4BIU A;  3E22 A;  2KG7 A;  3CRA A;  4HYO A;  4I4T A;  4DV7 B;  1JNB A;  3AG1 B;  2VS0 A;  2JJ1 G;  1B06 A;  1XIL A;  2QR4 A;  1JJO A;  3W7W A;  4FLX A;  4WFE A;  2PUS A;  1S76 D;  5LP6 A;  3L73 H;  1YHQ V;  4DR5 B;  4H37 A;  3CJH A;  3DC6 A;  2A3Q A;  4MTF A;  3ZRW A;  3AK2 A;  2WAM A;  1HR0 O;  3JAS A;  4JGS A;  1CPY A;  3CSX A;  1WN7 A;  4FZ1 A;  5EZY B;  1SRY A;  2GHY A;  5KAI Z;  1OCZ C;  5IDJ A;  1R3L C;  1OJH A;  3W7S A;  4NB5 A;  1YJW V;  3JAL B;  3T4Z A;  4TV8 B;  5LGT A;  3D36 C;  4U7N A;  4TUY B;  3BRC A;  4TQF A;  5H2F Z;  1SA0 A;  1D2D A;  1RPR A;  1YSC A;  2ZE7 A;  5CA3 A;  1XHZ A;  5EYP B;  3ZED A;  2YIA A;  1H2L A;  2LP7 A;  1IBM B;  1DGS A;  1E1R G;  2AHZ A;  4LF8 B;  1XMO O;  1GO3 F;  1UJW B;  2ATK C;  4O4J B;  2Q6A A;  3P3N A;  4UVA A;  2JVD A;  1AI5 A;  2HEP A;  4X65 B;  5A9G A;  1PL4 A;  1O9G A;  3RW0 A;  5F2V O;  2IBZ H;  4QE7 A;  1IBK B;  1MSW D;  4XDK A;  1XHX A;  4B3M O;  1CEZ A;  3UO2 A;  1BCC H;  2UXC B;  4YJ2 B;  2XUM A;  4RUE A;  1VQK V;  1N34 B;  2N74 A;  1QR8 A;  1HR0 B;  3ZBH A;  2E76 B;  1S0V A;  1BQ0 A;  4F4L A;  4DV2 O;  1N0N A;  2JGD B;  1XL6 A;  3AEI A;  3JAR A;  3B2E E;  2Y4T A;  1ENV A;  3DGE A;  3L9D A;  1YI2 V;  4ZI7 A;  4FLY A;  4FZ0 A;  1WAZ A;  3LNN A;  4BAY A;  1SQG A;  2X6A A;  3ABL C;  1YTF B;  2UUB O;  3ABM B;  4NXN O;  1TUE B;  3E2E A;  4NKG B;  2A0L A;  2JEX A;  4LF6 O;  1Q3E A;  1DLB A;  3IAY A;  2ZIO A;  2EZO A;  3WB0 A;  3QVN A;  3D36 A;  3F7V C;  5H6R A;  4R50 A;  3Q4H A;  2ZT9 B;  1HNX O;  4B3M B;  1PD3 A;  4JYA O;  1PV0 A;  4HNA A;  2F95 B;  3SJA C;  4O4I A;  4DV4 O;  3B8N A;  3E35 A;  3UO3 A;  5KMG A;  4OXS A;  1M56 B;  2WLH A;  4IT5 A;  1XMQ O;  2E75 B;  1YDX A;  3T1C A;  4DV2 B;  4RAI A;  3TGU H;  1V54 C;  4UFZ A;  1M57 C;  4DV3 B;  3F5T A;  4OGQ B;  1K7D A;  5LHH A;  4DR3 O;  1NR7 A;  2WLM A;  2QKC A;  3OTO O;  2C2A A;  4MT8 A;  4DV6 B;  3LSS A;  4MVS A;  3CCQ V;  2UUB B;  4GZR B;  4X1Y B;  3OMI B;  5B1A B;  1S5H C;  1M93 A;  2B9Z A;  2PY5 A;  5BMV A;  5KHK A;  5EC2 C;  4WF9 V;  3OE7 G;  2XAJ A;  1FFX A;  3ICX A;  1Q81 W;  2DQ0 A;  3N2K A;  1XUQ A;  2LJ2 A;  3CCS V;  1S72 V;  2F93 B;  4LFB B;  2YIB A;  4H0L B;  3ZRS A;  1TAE A;  4JI4 O;  4I4T B;  4IYH A;  2CTQ A;  1F4N A;  2R72 A;  1JQ0 A;  4BWA A;  1DK1 A;  1MZF A;  4JYA B;  3ZJZ A;  4B3R O;  1P7G A;  4K3A A;  4XBF A;  3VOU A;  2N05 A;  1LUW A;  1N8R W;  1XI1 A;  3HB3 B;  3LDD A;  4CC5 A;  1WJZ A;  1KP2 A;  1SQB H;  4B3S O;  2Y0P A;  1I94 O;  2HJF C;  1K9M W;  3P3P A;  1HDJ A;  5CA0 A;  2X0L A;  4Z2W A;  2BOB C;  1IXM A;  4J11 A;  1Z5V A;  1SA0 B;  3SPI A;  1Y74 A;  4I7Z B;  3AG2 B;  4MVO A;  1SS3 A;  4TV9 A;  4BW5 A;  1JCH A;  1XNR O;  2ZM6 B;  1NI8 A;  1YZB A;  1G4Y B;  3CCE V;  4PJ0 Z;  4DR2 O;  3RYH B;  5BZB A;  3W7X A;  4OPA A;  4MTO A;  4DO2 A;  1MMM A;  3FKS G;  2YI9 A;  4UUJ C;  4UVC A;  1H5W A;  3HR0 A;  4FLW A;  1M4U A;  1QLE B;  2P90 A;  4O2B B;  1ZSP A;  1AR1 B;  2PI5 A;  3L70 H;  1N32 O;  1I7F A;  5E79 Z;  4KP4 A;  1K92 A;  1OCC B;  4OX9 O;  1YVW A;  2FKX A;  1PNM A;  2P06 A;  4X62 B;  3WB1 A;  4QE9 A;  1Q5O A;  2ZNJ A;  2Z5U A;  4YHH O;  3DXR B;  5LMU B;  1SQF A;  1RPO A;  4LBE C;  4UV8 A;  1XNR B;  2ZE5 A;  4IHJ A;  2IJJ A;  3ZMU A;  1OCZ B;  2E5L O;  2JRI A;  5IE9 A;  1XQ8 A;  1Q6H A;  4U3J A;  2WLL B;  3B8M A;  1TUB A;  5L3F A;  3Q4H B;  4WFG A;  2ZD9 A;  2YS8 A;  5KHH A;  2ADQ B;  5LA6 B;  2CE4 A;  1FPO A;  4AI8 A;  4MVR A;  1M9N A;  1WA8 A;  2GTS A;  3SJB C;  4O4I B;  5KMG B;  2WLK A;  1XNQ O;  4DRX A;  4F6R A;  4ABM A;  1OCR C;  3CS5 A;  2ZKO A;  2Q0O C;  3VQY A;  4WCE V;  4IIJ A;  2P6J A;  3MD0 A;  3MHS C;  1US6 A;  3VQX A;  3ETG A;  4Z1V A;  4DR1 O;  1RFY A;  4J7Z A;  1IJG A;  1SQV H;  2LW1 A;  3SPH A;  1AI4 A;  4ZOL B;  1MA1 A;  5JH7 B;  2Y48 A;  2HVJ C;  2XAS A;  3JAT B;  3JD4 A;  4LNU B;  4YY3 O;  1JJ2 U;  2QA4 V;  2EJR A;  2OTJ V;  2XOK G;  3RFR A;  5IY5 C;  1X4T A;  3FB6 C;  4GX1 A;  5B1O A;  1AP6 A;  3TXS A;  1E1Q G;  2EIL C;  1UFI A;  4JTC B;  2MK3 A;  2ZIN A;  2IJI A;  2ETN A;  2IH3 C;  3EFF K;  1O9H A;  4YJ3 B;  2X6C A;  2BTQ B;  3EVK A;  1PM9 A;  1M5I A;  5IYD O;  5JJJ B;  4MVZ A;  3T1H O;  3ETD A;  3HKD A;  4J7K A;  4JV5 B;  2Q7G A;  1ZL8 A;  3CX5 F;  4HZ3 A;  2YXY A;  3OGI B;  3RVZ A;  5EZY A;  2Q4P A;  2W6I G;  4RO2 A;  3CRR A;  2OWO A;  2EZP A;  2JGU A;  2EIJ C;  2ZDI A;  3HKE B;  1VQ5 V;  3B4S A;  3JAL A;  4TV8 A;  5EBM C;  3LSU A;  3PJS K;  4TUY A;  3RVY A;  1KKC A;  1V54 B;  5EYP A;  3E86 A;  1FJG O;  1M57 B;  1MOF A;  1A32 A;  5LBQ A;  3RYC B;  3A0H Z;  3UKM A;  4LWS B;  4LF9 B;  2AZ2 A;  1MNG A;  3G4S V;  5TIS Z;  4K8Z A;  2DYR C;  1PNK A;  2RMK B;  3WU2 Z;  3D3I A;  3ABU A;  3SYP A;  1VQ8 V;  3T1H B;  4LF4 O;  4I55 B;  3T1Y O;  2RJZ A;  3S3X A;  5JJE B;  5KHJ A;  1CP9 A;  1YIT V;  4D7T A;  2UUA B;  1Y66 A;  4YJ2 A;  4PA9 A;  1OV9 A;  4WFA V;  3ZIA G;  1G1X B;  3RN4 A;  1QVF U;  4GUN A;  5LMN B;  3ETE A;  4JI7 B;  2KKW A;  3SYC A;  3ZHR A;  2VWJ A;  3AG7 A;  4GT1 A;  1KKD A;  3E8H A;  5KA6 A;  1FJG B;  3CC4 V;  4GKK B;  2QGN A;  3A0B Z;  2DWE C;  5IJ9 B;  4CS3 A;  2YI8 A;  2Z0A A;  5CBF A;  2UXD B;  5JQG A;  3FB7 C;  1NKD A;  1IX9 A;  3STL C;  5GON A;  1RM1 C;  5IYB O;  3ZHU A;  1HWY A;  4FIP C;  1KP3 A;  4DV7 O;  4RQE A;  4EEQ A;  2ZCE A;  4YXW G;  2DQ3 A;  2O57 A;  1VIB A;  4DRX B;  2JS5 A;  5L3E A;  1B6Q A;  1N36 O;  3ZCC A;  2P4V A;  4LFA B;  2WPD G;  4DR5 O;  5JJN B;  3LDC A;  5DM6 V;  2ZXW C;  2CH7 B;  2EIN C;  3C90 A;  5B1B C;  3AG2 C;  4G27 B;  5EIB C;  2QM7 A;  4RQF A;  3E83 A;  3CHX A;  1Y76 A;  2HR3 A;  4JTA B;  3ZHT A;  1HNZ B;  4CH6 A;  3BCC H;  4PI2 A;  3QNE A;  4X9Q A;  1SER A;  4PA6 A;  1IBM O;  3OR7 C;  3FX7 A;  1R6N A;  4FJC C;  2EJ7 A;  2JK5 C;  1R3J C;  3QTC A;  1UPG A;  1Y6X A;  4X65 O;  1G6U A;  3VQV A;  4K0K B;  2NNU A;  3AK1 A;  3ZX6 A;  1OCO C;  1TVK B;  3BY6 A;  1N0J A;  4Z1M G;  1N36 B;  2UU9 O;  3HKD B;  1IBK O;  1OCC C;  4K35 A;  5LHI A;  1WB7 A;  3CRC A;  1ZL8 B;  1GH6 A;  1XL4 A;  3K06 A;  1N4C A;  2UXC O;  1IVS A;  1D5A A;  2X6B A;  1NTZ H;  2VQF B;  1N34 O;  5B1N A;  3MHH C;  4JYB A;  1OCR B;  2K9P A;  4MVU A;  2HJD A;  4UCS A;  4N21 A;  4PDL A;  1FKA O;  3ZMV A;  2RNB A;  3MDS A;  1H2S B;  3BHP A;  2H3O A;  3JD3 A;  1JMK C;  3SJC C;  1G8M A;  3JD1 A;  5JWP A;  3OT7 A;  2G38 A;  5IY5 B;  1JX9 A;  3CB2 A;  2OCC C;  4CBC A;  2EIL B;  3CXH F;  4FLZ A;  3RYH A;  2UU9 B;  1R3K C;  1SQQ H;  3K58 A;  5CBG A;  5DEC A;  4DV1 B;  5L3B A;  5LL6 Y;  5IYC O;  1BGY H;  1HW7 A;  5A2Q N;  4P9P A;  5GTI Z;  5ITZ A;  3SR2 C;  4O2B A;  4ZHQ B;  3OD4 A;  1P4R A;  1K5S A;  4GLX A;  2LGQ A;  2BSK A;  4CC6 A;  4DV3 O;  4MS2 A;  1VF6 C;  3IC7 A;  4P9O A;  4DV6 O;  2W0X A;  4TWK A;  3JCU Z;  2QM4 A;  3DXR A;  1B04 A;  5KUK A;  1CXZ B;  1DF5 A;  1I5Y A;  2CUG A;  1K33 A;  5LOV B;  1QNM A;  1M90 W;  4UCR A;  4KHP B;  5JQG B;  3L71 H;  2CAZ C;  2PYL A;  2EIJ B;  1ARO P;  5GON B;  3ZS8 C;  4EKW A;  4KL1 A;  2AW9 A;  1ZLZ A;  4LFB O;  2WLL A;  1NH2 B;  4WFH A;  1FOU A;  1HNW B;  3DC5 A;  4CS2 A;  1J5E O;  3OM3 B;  5LA6 A;  1GAX A;  4DUY O;  3BA8 A;  2EIM C;  3FB8 C;  1EN6 A;  2ILM A;  5D5Q A;  1QVG U;  2UXB B;  4NTW A;  3K9A A;  1NQT A;  3FYI B;  4NXM B;  1ZTE A;  2DYR B;  2H94 A;  2YIB D;  4MW8 A;  1FXK C;  4ZOL A;  1ZWI C;  5JH7 A;  3JAT A;  4LNU A;  3BA9 A;  1LUV A;  5IJ0 A;  1WB8 A;  5LGN A;  2FML A;  1Y76 B;  3LUT B;  3SJQ C;  5EC1 C;  1S5L Z;  1OHH G;  3HKC B;  3QO8 A;  4B08 A;  3HKB A;  4N23 A;  4GX2 A;  3RYF B;  3FD9 A;  4I50 B;  4H33 A;  3L74 H;  3APQ A;  3OTF A;  1S5J A;  4DR6 B;  4YJ3 A;  2CGN A;  2ZM6 O;  2BTQ A;  1J5E B;  4JAU A;  1Z5W A;  4DUY B;  1YCI A;  1H8E G;  4J41 A;  3WFV A;  2ITC C;  2IH1 C;  2JEU A;  3C3S A;  4DUZ B;  2PGG A;  3UT5 B;  4G2K A;  3ZRV A;  2Q69 A;  1BS3 A;  3H1K H;  4X20 A;  4DK1 A;  3OMA B;  1Q90 D;  1RM1 B;  2P5O A;  4YIP A;  2R70 A;  3R66 A;  5K1X A;  4UCV A;  2QE7 G;  3K04 A;  2NN4 A;  4MSW C;  2Q5Z A;  1AI6 A;  2R9R B;  3HKE A;  5LXT B;  4X62 O;  3G67 A;  1V9P A;  4W4K A;  1FD9 A;  4PA3 A;  3U11 A;  4DR7 B;  2ZXW B;  2EIN B;  4RWU A;  2WA3 A;  5B1B B;  5LMU O;  4I9Q A;  1W0K G;  1VF7 A;  4TT3 G;  3OUS A;  3ZRX A;  1AVM A;  3RYC A;  4LWS A;  1PP9 H;  2KQX A;  4CZZ A;  1LNQ A;  1VQ9 V;  5EK0 A;  5IT9 N;  3ETQ A;  1ZAU A;  2V4D A;  4WBN B;  4I55 A;  2DOS A;  2OCH A;  5E1A C;  4FK5 C;  5ITZ B;  3CCU V;  1VEW A;  2IU3 A;  1NTK H;  1OCO B;  3KG2 A;  1IUR A;  2BSK B;  1BMF G;  5KUM A;  3CE2 A;  2JIZ G;  4FM1 A;  3BVO A;  4FFB B;  4H44 B;  3SPJ A;  2XAG A;  1KD1 W;  3H1J H;  1NVP D;  3H1I H;  1W2B U;  3K57 A;  2D2C B;  3OEE G;  2FTK A;  4UCU A;  1PNL A;  5IJ9 A;  5B3S C;  2BOC C;  1XBL A;  5LGU A;  5CBH A;  4FLT A;  3IFX A;  3JD2 A;  3CRM A;  2PZS A;  1BE3 H;  2CK3 G;  4JZ2 A;  2OYQ A;  1HP8 A;  1SKV A;  3ZHS A;  3JAK B;  1D5N A;  2WLN A;  2VQE O;  3OGC C;  4CH5 A;  5J2T B;  4JV5 O;  2OCC B;  4TOI A;  1EZJ A;  3KZI Z;  4LCU C;  4A5U B;  2KB1 A;  1OZ0 A;  3I55 V;  4J80 A;  2FYU H;  2CH7 A;  5CN0 A;  3B40 A;  3K79 A;  4JI3 B;  5IJ0 B;  2H8P C;  1Q43 A;  1TA8 A;  4TQD A;  4W4L A;  1PKX A;  2ZE8 A;  3EHB B;  3SYO A;  1AP5 A;  3HKB B;  4DV0 O;  2WA4 A;  3X2Q B;  4B3T B;  5K1P A;  4JI5 B;  2IJH A;  2VRZ A;  2JDI G;  1URF A;  3JSN A;  4JYY A;  2Q68 A;  4PEL A;  3RWR D;  2N04 A;  2UXX A;  3E8B A;  5BR8 B;  1KU9 A;  2HLD G;  3AG4 C;  4LF9 O;  3TJT A;  1XDC A;  5C8Y B;  5CA1 B;  2VQE B;  1TVK A;  4LF5 B;  3JCZ A;  3K5L A;  4LH7 A;  4X20 B;  2UUC B;  1KUQ A;  2UUA O;  4UCO A;  3LNM B;  4UB8 Z;  4FMT A;  3FAV B;  1XRE A;  1AJQ A;  2EIM B;  4GKJ B;  4J7J A;  1KMI Z;  2YSU B;  2DW4 A;  5LMN O;  4JI7 O;  2YEV B;  3U10 A;  1SES A;  5KHG A;  1QQC A;  4DV0 B;  2Q8V A;  3L72 H;  3TCU A;  1KYO F;  2P67 A;  4X66 B;  4PHZ A; 
#chains in the Genus database with same CATH homology
 4JZ2 A;  3KDR A;  1D5N A;  1BT8 A;  1EN5 A;  1AP6 A;  1SZX A;  2CDY A;  3AK1 A;  1QNM A;  3BFR A;  1N0J A;  4JZG A;  3RN4 A;  4GUN A;  3AK3 A;  1WB7 A;  1MMM A;  2AW9 A;  1ZLZ A;  2ADP A;  3KKY A;  1JR9 A;  1IDS A;  3DC5 A;  1IXB A;  2QKC A;  3EVK A;  1ZSP A;  2QKA A;  1PM9 A;  1GN3 A;  1AVM A;  1EN6 A;  4BR6 A;  5A9G A;  1PL4 A;  1AP5 A;  4C7U A;  1I08 A;  1AR4 A;  3CEI A;  1IX9 A;  1GN4 A;  1ZTE A;  1XUQ A;  3MDS A;  1BSM A;  5AG2 A;  1AR5 A;  4JYY A;  1VAR A;  1EN4 A;  1LUV A;  1WB8 A;  3OT7 A;  1VEW A;  1P7G A;  2P4K A;  3TJT A;  1XDC A;  1N0N A;  1LUW A;  2RCV A;  4E4E A;  3C3T A;  2GDS A;  3LSU A;  3K9S A;  1KKC A;  2ADQ B;  2CE4 A;  1I0H A;  4FFK A;  3IC9 A;  1ZUQ A;  4YIO A;  1JA8 A;  1XRE A;  1Y67 A;  3C3S A;  1B06 A;  1XIL A;  4F6E A;  1MNG A;  1BS3 A;  3QVN A;  4X9Q A;  1GN6 A;  1MA1 A;  1EM1 A;  1MSD A;  3DC6 A;  3AK2 A;  4YIP A;  1GN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...