1LUWA

Catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKQHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
publication title Catalytic and structural effects of amino acid substitution at histidine 30 in human manganese superoxide dismutase: insertion of valine C gamma into the substrate access channel
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1luwA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1luwA02
1IDSA 3CEIA 3AK2A 1EN4A 2AW9A 1AP5A 1BS3A 1XUQA 1PL4A 1ZTEA 2P4KA 3K9SA 3C3TA 1ZSPA 1AR5A 1MA1A 1BT8A 2CDYA 4BR6A 3BFRA 3IC9A 1Y67A 1KKCA 2RCVA 1SZXA 2CE4A 3AK3A 1B06A 3DC5A 1LUVA 1BSMA 1PM9A 1QNMA 5A9GA 4FFKA 1GN3A 1P7GA 3MDSA 1MSDA 2QKAA 3QVNA 1N0JA 3KKYA 3OT7A 1ZLZA 1AP6A 4GUNA 1MMMA 1AVMA 1GN2A 1XILA 5AG2A 4JYYA 4JZGA 1N0NA 1WB8A 1MNGA 1I0HA 1ZUQA 1JA8A 1IXBA 1GN6A 3TJTA 1XREA 1D5NA 3RN4A 4JZ2A 4YIOA 1IX9A 4E4EA 1XDCA 1LUWA 2QKCA 1EN6A 1VARA 1AR4A 1GN4A 3EVKA 4F6EA 1I08A 1EM1A 3C3SA 2ADQB 3LSUA 1VEWA 3AK1A 4C7UA 2ADPA 3DC6A 1WB7A 2GDSA 4X9QA 1EN5A 1JR9A 4YIPA
chains in the Genus database with same CATH superfamily
2PI4A 3SPGA 5CA1A 3CRRA 1XNQB 4OPAA 3OTFA 2E5LB 1SQBH 2EIMC 4PA9A 1XMOB 4UCSA 4DR5O 2OCCB 1K3EA 3OAAG 2QE7G 4TQDA 1G6UA 4G2KA 1OV9A 1GM9A 3SJAC 1K7DA 4J7KA 2EINC 1KB9F 1VF5B 1Z2GA 4O4LB 5JVDA 1UFIA 1Y74B 2CGNA 4DR6O 4I55A 3SPIA 2ZE6A 2N05A 3BEHA 2PF4E 3LUTB 4UFZA 3CYOA 1SESA 3L72H 2DE0X 3FYIB 1IBKB 5IJ0B 2JK5C 4RUFA 3ICXA 5CB4A 4LFAO 2HJDA 5EYPB 2A79B 3J7AU 3HKBB 2EBOA 4KL1A 3CRQA 4TSFG 4ASUG 3LSQA 4R50A 4OX9O 3BPZA 5KAIZ 5HFLA 3JD1A 3NXSA 5JJNB 1I0HA 1ZUQA 4GX1A 2HVJC 1DF4A 1M5IA 3LDDA 2R72A 2DJVA 4LC1A 1UPGA 1LUWA 5EBWC 1WLEA 3H9VA 4X88A 1AR4A 3JCUZ 1E1RG 4IIJA 1R6TA 1GM7A 3JAKB 1AI6A 4X64B 1SC5B 2OTLV 3OMIB 1AI4A 2Y0PA 2AZ2A 1H2MA 1WAZA 2K1EA 3AG4B 3T1CA 2A0LA 3SPHA 2ZINA 4YJ3A 4EB6A 3G6EV 4MW3A 4DV1B 1PPJH 1FJGB 1NVPD 1TA8A 1NR1A 2ZKOA 5C93A 4LF7B 2O57A 1Y67A 4ICGA 1XNQO 1VQ8V 2CE4A 3J80N 2P90A 3F7VC 1F4NA 3CWBH 3ZMUA 1ROPA 1FKAO 5IT9N 4A5UB 4PELA 1O9HA 4ZIBA 1M90W 5TISZ 1GN3A 2QJ1A 1NKDA 1K33A 2PZSA 1VIBA 2IJHA 5B1NA 2Q67A 3UT5A 2YXHA 1KYOF 3SJBC 1YJ9V 4RQEA 2YUAA 1YHQV 2LW7A 1VMGA 4IGGA 2BE3A 2BOCC 4GUNA 1NI8A 4JI0B 4CC5A 4JI3B 3CRMA 1F51A 2VRZA 1NBMG 4QPKA 2E75B 4J7JA 2AGAA 1IBKO 3H1KH 1QHTA 4I4TA 1VF7A 1NS1A 1KKDA 2LJ2A 1XREA 2RQ6A 2EIJB 4CS2A 4JZ2A 4D6TH 4DRXA 3N27A 3IAYA 1R3KC 1VARA 2JS5A 4G27B 2YDEA 4H44B 5B1AC 1S5JA 2Q0AA 3VQXA 2JJ2G 3K5NA 2P4VA 1HW7A 4FK5C 3ZCCA 2FB5A 1KU9A 2RN9A 2EIKB 3A0HZ 1P7BA 5ITZB 1Q8IA 2WA4A 4JTDB 1Q86W 1MA1A 1RSOB 3ABUA 5KLVH 3ZHRA 4FLWA 2D2CB 5EZYA 4I9QA 2QTOA 2LW1A 3C90A 4MVMA 2Q5ZA 5CA1B 2ZE5A 3AK3A 4KXRA 2Q6AA 4X1YA 1K4DC 2HEPA 5BR8O 4J10A 5A9GA 1AI7A 1NZ6A 5D5QA 4QNHB 3M7MX 4P2ZA 1FJGO 1YI2V 4WFGA 5FPRA 1WPXA 1F23A 3LDCA 4FZ0A 4LF7O 2OWOA 4TQFA 1GTOA 5LOVA 2W6JG 2KG7A 1FXKA 3ABLC 1AROP 2EILB 5JVDB 1OCCC 1K4CC 5IE9A 4IT5A 3G71V 3OR6C 4I55B 2W0FC 3HB3B 4TOIA 2CK3G 4JYYA 5BMVA 1BZKA 1MNGA 3ZRSA 2Q68A 4JI5O 5LBQA 3U11A 1XI1A 5B1AB 5IYCO 1S0VA 2EULA 2YC0A 4EEQA 5CB4B 4MVZA 3ZN1A 5KUKA 1EZJA 3T4DA 4JI3O 1PP9H 3JALA 4O2BA 5KHJA 3AG3B 4XBFA 3E83A 2M6YA 1M57B 2Y69C 1NVPB 4KP4A 2DYSB 4U7NA 2A06H 2FL4A 4X9QA 3WG7C 4DR1B 2GTAA 2ZNJA 1JFFA 3IFXA 3S3WA 2D3OW 4EFBA 1HR0O 4RO2A 4WF9V 1PL4A 4Z1VA 3QNEA 1WN7A 1VF6C 4NKGB 4IIJB 2WWWA 1BGYH 1N34O 4B3RB 4NXMB 3FB8C 4R8CA 1SF9A 4FLXA 1ZX3A 2IM9A 1CP9A 5JWPA 1SQQH 2KQXA 1PNMA 4YJ3B 4FLTA 4EB6B 3IC7A 3P3PA 3UO3A 4YJ2A 1BE3H 3QO5A 5JJJB 2ZD9A 4ZHQB 1R73A 5EIBC 2LGQA 4JV5B 2QKAA 3ABMB 3K5MA 3ETDA 1AILA 2Z0AA 4PDVA 2CTRA 1OCZC 2LFSA 1NTKH 1MABG 1QBZA 2BOBC 3CS5A 2L35A 1S72V 3SDLA 5JCOC 1AP6A 1KUQA 1AJQA 2ITDC 1IBMB 2CH7A 2IH3C 3JAMN 2UXDB 1M93A 5KHKA 4FFBA 3FB7C 4PA3A 3OTOB 2UXXA 4LF8B 5E79Z 3K59A 2Z3YA 3UT5B 1K92A 2YEVA 2WLLA 3W7WA 1IBLB 1IX9A 2LP7A 3CCQV 5EC2C 3Q4HA 2UUAO 4JI4B 1DTOA 3CCSV 1US6A 4HYOA 4NR1A 4EFEA 5K1PA 1Q6UA 3CRAA 3BAAA 1Y6XA 4I4TB 4UVAA 1XOUA 3E8GA 3I56V 2ZCEA 1WP8A 3UCSC 1FAFA 2B5UA 3BCCH 4DRXB 1JOYA 2JIZG 4MVSA 1ORQC 5CN0A 1H2KA 2HKOA 3P32A 5LXTA 2B1IA 1G1XB 1ZTEA 3K06A 3FFQA 2QA4V 2AHYA 1H5WA 1ZSPA 4PA4A 1RP3B 3LDEA 2Y0IA 1WA8A 3CC7V 3KG2A 3L70H 4GX2A 1AJPA 3ZN0A 3T4ZA 4DR1O 1VQMV 1B06A 2XT9A 3ZRXA 1FPOA 3ASOB 4HNAA 2XNDG 3GWOA 1LUVA 1P49A 3U10A 1PM9A 2QR4A 1SZTA 4JTAB 2IH1C 4B3RO 3HKCA 3N2GA 4LF9B 2UUCB 5DECA 3APQA 4QPJA 4YXWG 4LCUC 1IJGA 4X1YB 1QLEB 4LFAB 2RJZA 3ZX6A 3L9DA 4DV5B 4WFEA 3LNNA 4MVUA 4JV5O 4FLYA 1WP7A 3AG1B 3FB5C 1YDXA 5LOVB 1KC8W 2KG7B 1FXKB 3RBZA 3CCLV 4AILC 1Q90D 4R6ZA 2H3OA 3ZHVA 4BIOA 2Z5UA 3JARB 5BMVB 2QWOB 2BCCH 3SYCA 1GN4A 4I5SA 3OTOO 4TV8A 3I5DA 1BQZA 2YXLA 2IU0A 2DYRC 1SQGA 1VQ9V 2P06A 1URFA 3EHBB 4WCEV 1IBLO 3RYIA 4PDRA 4JI6O 3JYCA 4I50A 3JALB 4O2BB 2QWPB 4JI4O 3D36C 5B3SC 1K73W 1L0LH 4DV4B 2CTQA 5GTHZ 3BVOA 3FYEB 4FM0A 4DK0A 1F7YA 3BFRA 3K58A 1D5AA 5JQGA 2GUZA 2VQEB 4U3FH 1BSMA 4Q6GA 4JYBA 4X20A 3OD4A 4CBCA 1RPRA 3T2MA 3CCMV 5IWAO 3ZMTA 1OCOB 2DWEC 1P7GA 2CAZC 4UUJC 2Q7EA 5A2QN 5LA6A 3QVNA 3VQVA 2PGGA 3OT7A 2WPDG 3ZHTA 1SKVA 4YJ2B 1PNLA 3QO7A 3IJ4A 2WLNA 1WB8A 4JASA 4LF9O 2UUCO 3QO8A 4BAYA 3ASNB 1JNBA 3X2QB 2IU3A 1FXVA 2XHBA 1H2SB 3CB2A 1JJOA 3CRCA 2HFEC 2YIBA 3G67A 5H9CA 4O4IA 4DV5O 1H2GA 1SS3A 4FFBB 2XAFA 3L71H 1I08A 4NTYA 5KAFZ 4JI1B 1J5EO 3OR7C 5KHIA 4W4LA 2GDSA 3RVYA 2YEVB 4K0KB 4UB8Z 1RPOA 2WLLB 2PYLA 2ZR3A 1GM8A 4H0LB 1OCRB 2LO1A 4CC6A 5CA3A 1JQ0A 1CPYA 3Q4HB 2Q73A 5H6QA 5FLXN 2WLHA 2YSUB 1AR5A 2BTQA 2EIMB 2UXNA 1BHAA 3D3QA 4JYAO 1M1KW 1L0NH 5KUMA 3E89A 5B66Z 3CJHA 4B7EA 4DK1A 4GCZA 3CX5F 3K9AA 2RCVA 4E2LA 4LNUA 4DV3O 4J42A 2YIBD 2IW5A 1OZ0A 2EINB 3E22A 5J2UA 4DV4O 1TVKA 1BCCH 4GX0A 5BR8B 1WA8B 5JJEB 1CXZB 2OT5A 3T1HB 4WFFA 3E86A 5BY1A 4HNAB 1MZFA 2VQEO 1M56C 3STLC 3RW0A 4L8JA 4WBNA 3JD3A 5GTIZ 4RQFA 1YJWV 2PUSA 5LGUA 4MTGA 3M8AA 1VQ7V 1X59A 1J95A 1Q81W 2QM4A 2FMLA 4NYKA 2GHYA 3HKCB 3N2GB 4TWKA 3K5LA 5D5PA 4JI5B 1HNZB 3D3IA 1M4UA 2ILMA 1Q6IA 5LP6C 1QQCA 3H1HH 3S3XA 2JVDA 3G6BA 4R7CA 4JI7B 2OTJV 4X1IA 3D8CA 4B08A 2X7RB 3K03A 1FD9A 2HG5C 1YTFD 1EZVH 4EKWA 1UJWB 4DUYB 1QVGU 4RWUA 1VP7A 4ZOLA 3OUFA 5KX5A 1EM1A 5GONA 4QE7A 5CBFA 1A32A 1VF6A 2PY5A 3F7YC 3OFNG 3UKMA 1R3JC 1R6NA 4GYCB 4J9ZB 2Q7HA 2QKSA 3CP1A 3F5WC 1XUQA 1HR0B 4UV9A 4AI8A 4JI1O 4TV8B 4MVQA 1BT8A 5IY5C 1VQOV 5DN6G 4UXNA 1N34B 3H01A 3A0RA 4I7ZB 4LH7A 4K0KO 3HPLC 4X65B 2WLKA 3RYIB 4FZ1A 1K9MW 3A0BZ 3JATA 3VOUA 1R6KA 3CXCU 2YIAA 3RYCB 2F43G 1SQFA 3SJQC 1XBLA 4H13B 5JCOA 2QWQB 2UXCB 2EJRA 4JI2B 4UVBA 4FLVA 4MVOA 4BW5A 1FOUA 5H2FZ 3K0DA 5JQGB 4X1KA 4ABMA 2W0XA 2GUZB 1YF2A 2HVKC 4X20B 3JCZA 2DWDC 4Z1MG 4K8XA 2W6IG 1PV0A 3ABKC 2F1MA 3AG2C 2QSAA 1WJZA 1Z5VA 3G80A 3T1HO 4UVCA 5L3EA 5EIBD 3RVZA 3ZHSA 2QDOA 2BTOA 2Y4UA 5LA6B 4TUYA 4TV9A 3I55V 3ZJZA 2HHHB 4DV0O 5FPOA 1PKXA 4H33A 5EK0A 2A9HA 3K0GA 3WU2Z 3MHSC 5B1BC 3JSNA 2UUAB 3JD0A 3IGAC 1HNZO 3AK1A 3OGCC 1BMFG 3PJSK 2HJFC 4MTXA 3STZC 1ZL8A 3OUSA 3JAWA 3CEIA 1JMKC 4JI7O 1NJIW 1NTZH 2XAHA 2HR3A 2A7WA 2RDCA 3BABA 4DR2B 4DUYO 4P9OA 1V9PA 2EJ7A 2R9AA 1AB3A 4FLZA 1YSCA 3H1IH 2GTSA 2CGOA 5LMUB 3JD4A 2CDYA 1SQPH 1DF5A 4PD4F 3SGIA 4UCRA 1OJHA 1Y76A 1BQ0A 3DC5A 1K34A 2LGWA 1AI5A 3DSQA 4FFKA 5JH7A 2BTQB 2XASA 1S5HC 4DW1A 2WLJA 2UUBO 2OIGA 2KB1A 3CJHB 4X65O 3JASA 4LNUB 3ZRWA 2DOSA 3OMAB 3OMNB 1V54C 2JGDA 1Q6HA 4DR4B 4NB5A 3E22B 5J2UB 4F4LA 2QGNA 1YCIA 2UXBO 4LBEC 4MTOA 2F23A 1TVKB 1Y4MA 4UB6Z 3ABLB 4DW0A 3U0ZA 1MZEA 1OCCB 1XILA 1YTFB 2UU9O 1WNSA 3SPCA 2UXCO 4JI2O 1YXBA 3QTCA 4WFHA 5CBGA 1AR1B 3TXSA 1NT2B 4MT8A 3CCVV 2B9ZA 4B3MO 4FIPC 3H1LH 3ZRVA 3FAVA 4X8AA 4E4EA 4WBNB 3CCRV 2XTAA 3SYQA 2RNBA 3ML0A 1I5XA 4PJ0Z 3TGUH 4JAUA 4J7ZA 5LGTA 3D36A 2PYJA 1O9GA 5HFMA 1V55C 4DUZB 2CTPA 1PL0A 1EN5A 1JR9A 2Y69B 4UCOA 4LF5B 2HHHO 3SJCC 1LNQA 2AW9A 4X1IB 2QWNB 3WG7B 2V7QG 4K8ZA 4U3JA 4ZKIA 2IJIA 4JI6B 4B3TO 5DM6V 4IL6Z 2IBZH 4UCUA 4JYCA 4ZOLB 5KX5B 2YIDA 1GMGA 4N23A 5GONB 2IJJA 4K3AA 2ARHA 3O9OA 2QTSA 4GX5A 4CS3A 2Y48A 4PV1B 3IC9A 4B3SB 2K9PA 1XHXA 1SZXA 4J80A 1IURA 1GRJA 3WB1A 5J9PC 2G38A 4DR2O 3K3WA 4F6RA 1PD3A 4GZRB 1W2BU 1VQ6V 3K04A 4W4KA 5L3GA 1QLNA 1I5YA 3ZHUA 5LMUO 3T1YO 5IWAB 1GK9A 4BW9A 3JATB 4P9PA 4Z2WA 2JGUA 1ZLZA 3FB6C 3RYFA 2E76B 2P22C 3DXRA 1OCZB 4PI2A 4X89A 2NR5A 2YICA 1GN2A 1N4CA 4JZGA 1N0NA 2AHZA 5H5NA 2YI8A 1RM1C 3CCUV 1ENVA 2ZE8A 5EZYB 2M7WA 3ABTA 4NXNO 5J2TA 4X62B 5E1AC 4DR4O 1FYJA 4X1KB 4MTFA 2ZXWC 1TUBA 1Q82W 4I9WA 3EVKA 3OW2U 1L8DA 5LYJA 2LFRA 2WLIA 4LP8A 1MSWD 1W0KG 1Z5WA 4G28B 4JI8B 2X6BA 1J5EB 2JRIA 4TV9B 5F2VO 1SA0A 1N33B 4HBNA 1N32B 1P4RA 4CH6A 2EX3A 3J81N 2OCCC 2OCHA 1W59A 1EBOA 3L73H 4MW8A 2PI5A 1BL8A 2EZPA 4DUZO 2C2AA 4JYAB 2B1GA 1ZL8B 4LF5O 2H94A 3JAWB 4IYIA 4DV3B 1JJ2U 1YIJV 2IJKA 3SYPA 3ZBHA 1QNMA 3CMAV 3TCUA 2H8PC 4LFBB 3CMEV 4CS4A 4K35A 1OHHG 1XEQA 4B3SO 1MSDA 2FYUH 1SETA 2X0LA 1N0JA 1Y76B 4YY3B 1JFFB 3ETQA 5KHHA 3HKDA 5LP6A 1AVMA 2Q4PA 2ZDIC 5JH7B 4GKJB 2DQ0A 4NTXA 1MG1A 2XAJA 1JCHA 1TGOA 1GN6A 3JASB 4MVRA 2F95B 3ZRWB 3R66A 5BZBA 4PA6A 1KBHA 1KD1W 2VQFB 1GKFA 3B8NA 2F93B 1XDCA 2P6JA 3RFRA 4TT3G 4JTCB 4KHPO 3THOA 1FFXA 3ZMZA 4FJCC 1TAEA 3WB0A 4YHHB 4XDKA 1SRYA 2R9RB 1VEWA 4IHJA 4X62O 3AG4C 4JPRA 3FAVB 5CA0A 2DYRB 4WFAV 2NN4A 1B3QA 2X6CA 2ZQMA 1NQTA 5C8YA 2AXTZ 5CBHA 1XMQB 2P4KA 2CH7B 1JX9A 3PN1A 2QWRB 4XDJA 1R1BA 5B3SB 1KECA 4RAIA 4KUMA 4JI8O 4FLUA 3MAQA 4BR6A 3KCYA 1KKCA 5FL7G 1N33O 1N32O 2ZIOA 4B7KA 3E35A 3RGBA 4U3JB 1THZA 3AG7A 2KKWA 2AZ0A 2OYQA 1QVFU 5IJ9A 1H2NA 1HDJA 4UCVA 4DV2O 5IDJA 4D7SA 1RFYA 1GAXA 4LWSA 3MDSA 4PDLA 1KP2A 4P30A 3GWKC 1W0JG 4AHCA 4DR7B 2CUGA 4F6RB 3P30A 1I94O 1YEWA 5LXTB 2BSKA 4LFBO 2EZOA 4OXSA 4O2AA 4DV6B 5FNVA 4JAVA 1VQNV 3WFVA 1TUEB 2EIJC 1COWG 2DN9A 1VQLV 5B5EZ 4QIWF 4DV7O 4I0XA 4YY3O 3QF7A 3ZEDA 1HNWB 4FM2A 1QR9A 1XL4A 3RYFB 4JGSA 3DXRB 2XOKG 3RYHA 2L6LA 1N36B 4GKJO 4LR3A 2V1DA 3SR2C 4DV0B 3L74H 4ZHQA 1JPXA 4BIZA 1VQKV 1Q7YW 2ITCC 3HKEA 5J2TB 1VQ5V 1IZ3A 1WB7A 3DC6A 3BA8A 2VQFO 1Q3EA 4YIPA 2EIKC 4UCTA 1HNXB 3AK2A 3O65A 3RT3C 1EN4A 1TUBB 3HR0A 2E5LO 1XMOO 2MK3A 3FKSG 3DGEA 1BS3A 2ATKC 2R70A 1P84F 1BHBA 1QU7A 3K57A 3B40A 3E8FA 4YHHO 2P7TC 4GKKB 1XL6A 2Q0OC 1DK1A 2R9IA 5LYJB 3CC4V 1FFTB 2WLIB 3AEIA 2ETNA 2LQTA 4ZBMA 3VQWA 1KQSU 2DQ3A 4NVPA 1SA0B 1XMQO 1CEZA 5EBMC 5IYBO 3ZMVA 1G8MA 2WLMA 4U7OA 3E8HA 1F4MA 2UUBB 2EILC 3A2FA 1ZWIC 4KFMA 2ZIMA 3JSLA 1E79G 1DGSA 1R3LC 4I50B 3ZHQA 2JEXA 1MMMA 3UM7A 3ETEA 4AQYB 2UXBB 1XHZA 1M56B 2CTWA 2JS3A 2F66C 1D2DA 1NTMH 3K5OA 2UU9B 4J11A 1U96A 2DW4A 3B77A 5GW7A 4DR7O 3BRCA 1D5NA 4B3MB 3GB7C 2N74A 3AG3C 3HKDB 4J9YB 5LP6B 1SQXH 3B2EE 1EN6A 2NLJC 5L3DA 4O4HA 1H8HG 1NR7A 2P5OA 1M57C 4F6EA 2DYSC 2WAMA 3LSSA 4XDLA 4DV6O 4X64O 2PTMA 3UO2A 1HNWO 2QM8A 1I7FA 3FX7A 1N36O 1KMIZ 5IYZA 2DMXA 4DV1O 4LH6A 5BXZA 5LMNB 1FFXB 4B3TB 2RMKB 4X66B 3CC2V 2XUMA 1K97A 4IHJB 3APOA 5IY5B 1HNXO 5CA0B 4MS2A 1IVSA 3W7SA 4CH3A 4LFCB 3OGIB 3SPJA 5C8YB 4BWAA 4O4IB 4ZI7A 3N2KA 1XQ8A 4QGPA 4O4JA 3DTUB 3JARA 1XNRB 4GKKO 1G4YB 2GV9A 3B4SA 4J41A 4RUEA 3RWRD 3CD6V 3F5TA 1MOFA 3ABMC 1Q5OA 4N21A 1B6QA 4PA7A 3CSXA 2HP8A 4FMTA 3ZS8C 3MD0A 4FVMA 3T1YB 1YITV 4JAAA 2FTKA 5LL6Y 2MW2B 4WFBV 4JI0O 1AJNA 4FPPA 1VQ4V 5EBLC 3BY6A 1KP3A 4CH5A 5IJ9B 3A8TA 4PDMA 3ETGA 4D7TA 4LWSB 1IXBA 4IYHA 4DYLA 3ABKB 3AG2B 5KMGA 2E74B 2VWKA 1T5EA 4NXNB 1K5SA 2Q69A 1JVMA 4OGQB 2BSKB 2N04A 3H1JH 4AQYO 4LF4B 1YZBA 4UV8A 2F4VB 4O2AB 5FNVB 1S76D 5KA6A 1M9NA 2ADQB 4DO2A 5L3CA 2JDIG 4C7UA 2ADPA 2GBOA 5B1BB 4I0XB 4FM1A 4L87A 1IDSA 3CHXA 3RYHB 4O4LA 3W7TA 1Y74A 1AP5A 3B8MA 1NH2D 3L75H 1R3IC 3HKEB 3KDRA 5IJ0A 3ASOC 1S5LZ 3TXQA 2NNUA 3KCXA 4JF3A 4Q20A 4LF6B 3M99B 2JJ1G 3EFFK 5EYPA 3HKBA 5LMNO 3KZIZ 2Q9LA 2ZT9B 4X66O 2ZNIA 2ZE7A 3CPWU 3CCEV 2WSSG 1FXHA 4OPHA 2XAQA 2XAGA 1ZAUA 2ZDIA 3UQ8A 2YXYA 4DR3B 1QLEC 2QM7A 1IXMA 3W7XA 3ZMSA 4LFCO 1LR1A 3VBBA 3W7UA 1S3JA 1V54B 3B09A 1XNRO 3GVMA 3CE2A 1GH6A 1HP8A 1Y66A 2YS8A 1H38A 3AG1C 4BIUA 1JA8A 5LHIA 3FD9A 1FXKC 5IYDO 3JAKA 1PNKA 1B04A 3TJTA 4GT1A 4PHZA 5K1XA 2ZM6B 4PI0A 2A3QA 3RN4A 2OIEA 2WA3A 3E2EA 2QKCA 5L3FA 2KSDA 2ODMA 1WPBA 2HLDG 3ZIAG 5LHHA 2YI9A 4KHPB 3TETA 3SYOA 4DR5B 3C3SA 3LSUA 1QCEA 2VS0A 5KA5A 1Q43A 3K79A 5KHGA 2E3CA 2V4DA 3E8BA 3NR7A 1V55B 5EC1C 3WB2A 4LF4O 4O4HB 1GO3F 1K5QA 1H8EG 3C3TA 3K9SA 2F4VO 1L1FA 4DR6B 4QE9A 1FS0G 3QG5A 4NXMO 1X4TA 4QJFB 1H2LA 5B1OA 4TUYB 2X6AA 5IYZB 3OM3B 3VQYA 5L3BA 4HZ3A 3TK1A 2ZR2A 4CZZA 4OX9B 1OCOC 3OE7G 4DXWA 2JEUA 3LNMB 1NU1H 4HAMA 1U97A 4DV2B 1S77D 4LF6O 1EFRG 1QR8A 3KKYA 5H6RA 1IBMO 4ZI7B 3N2KB 5CMUA 4O4JB 3OEEG 2UXDO 1I94B 5LGNA 4GLXA 2Q8VA 4CH4A 2Y4TA 5AG2A 1SERA 3ASNC 5LHGA 4LF8O 3JD2A 2P67A 1YVWA 1DLBA 4DR3O 3X2QC 2QEXV 2VWJA 3OEHG 3BHPA 1HWYA 1N8RW 1RM1B 3BA9A 2FKXA 2GSMB 3EXAA 4DV7B 4YIOA 1K8AW 3CXHF 1YJNV 3SYAA 3RYCA 5ITZA 1SQVH 3K08A 2ZXWB 4H37A 3MHHC 1E1QG 2Q7GA 1NH2B 1VQPV 1RSOA 3G4SV 5KMGB 3CCJV 3P3NA 2ZM6O 1OCRC 5DEDA 4MSWC 3R65A 4NTWA 2JGDB
chains in the Genus database with same CATH topology
1IDSA 3CEIA 3AK2A 1EN4A 2AW9A 1AP5A 1BS3A 1XUQA 1PL4A 1ZTEA 2P4KA 3K9SA 3C3TA 1ZSPA 1AR5A 1MA1A 1BT8A 3KDRA 2CDYA 4BR6A 3BFRA 3IC9A 1Y67A 1KKCA 2RCVA 1SZXA 2CE4A 3AK3A 1B06A 3DC5A 1LUVA 1BSMA 1PM9A 1QNMA 5A9GA 4FFKA 1GN3A 1P7GA 3MDSA 1MSDA 2QKAA 3QVNA 1N0JA 3KKYA 3OT7A 1ZLZA 1AP6A 4GUNA 1MMMA 1AVMA 1GN2A 1XILA 5AG2A 4JYYA 4JZGA 1N0NA 1WB8A 1MNGA 1I0HA 1ZUQA 1JA8A 1IXBA 1GN6A 3TJTA 1XREA 1D5NA 3RN4A 4JZ2A 4YIOA 1IX9A 4E4EA 1XDCA 1LUWA 2QKCA 1EN6A 1VARA 1AR4A 1GN4A 3EVKA 4F6EA 1I08A 1EM1A 3C3SA 2ADQB 3LSUA 1VEWA 3AK1A 4C7UA 2ADPA 3DC6A 1WB7A 2GDSA 4X9QA 1EN5A 1JR9A 4YIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDS A;  3CEI A;  3AK2 A;  1EN4 A;  2AW9 A;  1AP5 A;  1BS3 A;  1XUQ A;  1PL4 A;  1ZTE A;  2P4K A;  3K9S A;  3C3T A;  1ZSP A;  1AR5 A;  1MA1 A;  1BT8 A;  2CDY A;  4BR6 A;  3BFR A;  3IC9 A;  1Y67 A;  1KKC A;  2RCV A;  1SZX A;  2CE4 A;  3AK3 A;  1B06 A;  3DC5 A;  1LUV A;  1BSM A;  1PM9 A;  1QNM A;  5A9G A;  4FFK A;  1GN3 A;  1P7G A;  3MDS A;  1MSD A;  2QKA A;  3QVN A;  1N0J A;  3KKY A;  3OT7 A;  1ZLZ A;  1AP6 A;  4GUN A;  1MMM A;  1AVM A;  1GN2 A;  1XIL A;  5AG2 A;  4JYY A;  4JZG A;  1N0N A;  1WB8 A;  1MNG A;  1I0H A;  1ZUQ A;  1JA8 A;  1IXB A;  1GN6 A;  3TJT A;  1XRE A;  1D5N A;  3RN4 A;  4JZ2 A;  4YIO A;  1IX9 A;  4E4E A;  1XDC A;  1LUW A;  2QKC A;  1EN6 A;  1VAR A;  1AR4 A;  1GN4 A;  3EVK A;  4F6E A;  1I08 A;  1EM1 A;  3C3S A;  2ADQ B;  3LSU A;  1VEW A;  3AK1 A;  4C7U A;  2ADP A;  3DC6 A;  1WB7 A;  2GDS A;  4X9Q A;  1EN5 A;  1JR9 A;  4YIP A; 
#chains in the Genus database with same CATH topology
 2PI4 A;  3SPG A;  5CA1 A;  3CRR A;  1XNQ B;  4OPA A;  3OTF A;  2E5L B;  1SQB H;  2EIM C;  4PA9 A;  1XMO B;  4UCS A;  4DR5 O;  2OCC B;  1K3E A;  3OAA G;  2QE7 G;  4TQD A;  1G6U A;  4G2K A;  1OV9 A;  1GM9 A;  3SJA C;  1K7D A;  4J7K A;  2EIN C;  1KB9 F;  1VF5 B;  1Z2G A;  4O4L B;  5JVD A;  1UFI A;  1Y74 B;  2CGN A;  4DR6 O;  4I55 A;  3SPI A;  2ZE6 A;  2N05 A;  3BEH A;  2PF4 E;  3LUT B;  4UFZ A;  3CYO A;  1SES A;  3L72 H;  2DE0 X;  3FYI B;  1IBK B;  5IJ0 B;  2JK5 C;  4RUF A;  3ICX A;  5CB4 A;  4LFA O;  2HJD A;  5EYP B;  2A79 B;  3J7A U;  3HKB B;  2EBO A;  4KL1 A;  3CRQ A;  4TSF G;  4ASU G;  3LSQ A;  4R50 A;  4OX9 O;  3BPZ A;  5KAI Z;  5HFL A;  3JD1 A;  3NXS A;  5JJN B;  1I0H A;  1ZUQ A;  4GX1 A;  2HVJ C;  1DF4 A;  1M5I A;  3LDD A;  2R72 A;  2DJV A;  4LC1 A;  1UPG A;  1LUW A;  5EBW C;  1WLE A;  3H9V A;  4X88 A;  1AR4 A;  3JCU Z;  1E1R G;  4IIJ A;  1R6T A;  1GM7 A;  3JAK B;  1AI6 A;  4X64 B;  1SC5 B;  2OTL V;  3OMI B;  1AI4 A;  2Y0P A;  2AZ2 A;  1H2M A;  1WAZ A;  2K1E A;  3AG4 B;  3T1C A;  2A0L A;  3SPH A;  2ZIN A;  4YJ3 A;  4EB6 A;  3G6E V;  4MW3 A;  4DV1 B;  1PPJ H;  1FJG B;  1NVP D;  1TA8 A;  1NR1 A;  2ZKO A;  5C93 A;  4LF7 B;  2O57 A;  1Y67 A;  4ICG A;  1XNQ O;  1VQ8 V;  2CE4 A;  3J80 N;  2P90 A;  3F7V C;  1F4N A;  3CWB H;  3ZMU A;  1ROP A;  1FKA O;  5IT9 N;  4A5U B;  4PEL A;  1O9H A;  4ZIB A;  1M90 W;  5TIS Z;  1GN3 A;  2QJ1 A;  1NKD A;  1K33 A;  2PZS A;  1VIB A;  2IJH A;  5B1N A;  2Q67 A;  3UT5 A;  2YXH A;  1KYO F;  3SJB C;  1YJ9 V;  4RQE A;  2YUA A;  1YHQ V;  2LW7 A;  1VMG A;  4IGG A;  2BE3 A;  2BOC C;  4GUN A;  1NI8 A;  4JI0 B;  4CC5 A;  4JI3 B;  3CRM A;  1F51 A;  2VRZ A;  1NBM G;  4QPK A;  2E75 B;  4J7J A;  2AGA A;  1IBK O;  3H1K H;  1QHT A;  4I4T A;  1VF7 A;  1NS1 A;  1KKD A;  2LJ2 A;  1XRE A;  2RQ6 A;  2EIJ B;  4CS2 A;  4JZ2 A;  4D6T H;  4DRX A;  3N27 A;  3IAY A;  1R3K C;  1VAR A;  2JS5 A;  4G27 B;  2YDE A;  4H44 B;  5B1A C;  1S5J A;  2Q0A A;  3VQX A;  2JJ2 G;  3K5N A;  2P4V A;  1HW7 A;  4FK5 C;  3ZCC A;  2FB5 A;  1KU9 A;  2RN9 A;  2EIK B;  3A0H Z;  1P7B A;  5ITZ B;  1Q8I A;  2WA4 A;  4JTD B;  1Q86 W;  1MA1 A;  1RSO B;  3ABU A;  5KLV H;  3ZHR A;  4FLW A;  2D2C B;  5EZY A;  4I9Q A;  2QTO A;  2LW1 A;  3C90 A;  4MVM A;  2Q5Z A;  5CA1 B;  2ZE5 A;  3AK3 A;  4KXR A;  2Q6A A;  4X1Y A;  1K4D C;  2HEP A;  5BR8 O;  4J10 A;  5A9G A;  1AI7 A;  1NZ6 A;  5D5Q A;  4QNH B;  3M7M X;  4P2Z A;  1FJG O;  1YI2 V;  4WFG A;  5FPR A;  1WPX A;  1F23 A;  3LDC A;  4FZ0 A;  4LF7 O;  2OWO A;  4TQF A;  1GTO A;  5LOV A;  2W6J G;  2KG7 A;  1FXK A;  3ABL C;  1ARO P;  2EIL B;  5JVD B;  1OCC C;  1K4C C;  5IE9 A;  4IT5 A;  3G71 V;  3OR6 C;  4I55 B;  2W0F C;  3HB3 B;  4TOI A;  2CK3 G;  4JYY A;  5BMV A;  1BZK A;  1MNG A;  3ZRS A;  2Q68 A;  4JI5 O;  5LBQ A;  3U11 A;  1XI1 A;  5B1A B;  5IYC O;  1S0V A;  2EUL A;  2YC0 A;  4EEQ A;  5CB4 B;  4MVZ A;  3ZN1 A;  5KUK A;  1EZJ A;  3T4D A;  4JI3 O;  1PP9 H;  3JAL A;  4O2B A;  5KHJ A;  3AG3 B;  4XBF A;  3E83 A;  2M6Y A;  1M57 B;  2Y69 C;  1NVP B;  4KP4 A;  2DYS B;  4U7N A;  2A06 H;  2FL4 A;  4X9Q A;  3WG7 C;  4DR1 B;  2GTA A;  2ZNJ A;  1JFF A;  3IFX A;  3S3W A;  2D3O W;  4EFB A;  1HR0 O;  4RO2 A;  4WF9 V;  1PL4 A;  4Z1V A;  3QNE A;  1WN7 A;  1VF6 C;  4NKG B;  4IIJ B;  2WWW A;  1BGY H;  1N34 O;  4B3R B;  4NXM B;  3FB8 C;  4R8C A;  1SF9 A;  4FLX A;  1ZX3 A;  2IM9 A;  1CP9 A;  5JWP A;  1SQQ H;  2KQX A;  1PNM A;  4YJ3 B;  4FLT A;  4EB6 B;  3IC7 A;  3P3P A;  3UO3 A;  4YJ2 A;  1BE3 H;  3QO5 A;  5JJJ B;  2ZD9 A;  4ZHQ B;  1R73 A;  5EIB C;  2LGQ A;  4JV5 B;  2QKA A;  3ABM B;  3K5M A;  3ETD A;  1AIL A;  2Z0A A;  4PDV A;  2CTR A;  1OCZ C;  2LFS A;  1NTK H;  1MAB G;  1QBZ A;  2BOB C;  3CS5 A;  2L35 A;  1S72 V;  3SDL A;  5JCO C;  1AP6 A;  1KUQ A;  1AJQ A;  2ITD C;  1IBM B;  2CH7 A;  2IH3 C;  3JAM N;  2UXD B;  1M93 A;  5KHK A;  4FFB A;  3FB7 C;  4PA3 A;  3OTO B;  2UXX A;  4LF8 B;  5E79 Z;  3K59 A;  2Z3Y A;  3UT5 B;  1K92 A;  2YEV A;  2WLL A;  3W7W A;  1IBL B;  1IX9 A;  2LP7 A;  3CCQ V;  5EC2 C;  3Q4H A;  2UUA O;  4JI4 B;  1DTO A;  3CCS V;  1US6 A;  4HYO A;  4NR1 A;  4EFE A;  5K1P A;  1Q6U A;  3CRA A;  3BAA A;  1Y6X A;  4I4T B;  4UVA A;  1XOU A;  3E8G A;  3I56 V;  2ZCE A;  1WP8 A;  3UCS C;  1FAF A;  2B5U A;  3BCC H;  4DRX B;  1JOY A;  2JIZ G;  4MVS A;  1ORQ C;  5CN0 A;  1H2K A;  2HKO A;  3P32 A;  5LXT A;  2B1I A;  1G1X B;  1ZTE A;  3K06 A;  3FFQ A;  2QA4 V;  2AHY A;  1H5W A;  1ZSP A;  4PA4 A;  1RP3 B;  3LDE A;  2Y0I A;  1WA8 A;  3CC7 V;  3KG2 A;  3L70 H;  4GX2 A;  1AJP A;  3ZN0 A;  3T4Z A;  4DR1 O;  1VQM V;  1B06 A;  2XT9 A;  3ZRX A;  1FPO A;  3ASO B;  4HNA A;  2XND G;  3GWO A;  1LUV A;  1P49 A;  3U10 A;  1PM9 A;  2QR4 A;  1SZT A;  4JTA B;  2IH1 C;  4B3R O;  3HKC A;  3N2G A;  4LF9 B;  2UUC B;  5DEC A;  3APQ A;  4QPJ A;  4YXW G;  4LCU C;  1IJG A;  4X1Y B;  1QLE B;  4LFA B;  2RJZ A;  3ZX6 A;  3L9D A;  4DV5 B;  4WFE A;  3LNN A;  4MVU A;  4JV5 O;  4FLY A;  1WP7 A;  3AG1 B;  3FB5 C;  1YDX A;  5LOV B;  1KC8 W;  2KG7 B;  1FXK B;  3RBZ A;  3CCL V;  4AIL C;  1Q90 D;  4R6Z A;  2H3O A;  3ZHV A;  4BIO A;  2Z5U A;  3JAR B;  5BMV B;  2QWO B;  2BCC H;  3SYC A;  1GN4 A;  4I5S A;  3OTO O;  4TV8 A;  3I5D A;  1BQZ A;  2YXL A;  2IU0 A;  2DYR C;  1SQG A;  1VQ9 V;  2P06 A;  1URF A;  3EHB B;  4WCE V;  1IBL O;  3RYI A;  4PDR A;  4JI6 O;  3JYC A;  4I50 A;  3JAL B;  4O2B B;  2QWP B;  4JI4 O;  3D36 C;  5B3S C;  1K73 W;  1L0L H;  4DV4 B;  2CTQ A;  5GTH Z;  3BVO A;  3FYE B;  4FM0 A;  4DK0 A;  1F7Y A;  3BFR A;  3K58 A;  1D5A A;  5JQG A;  2GUZ A;  2VQE B;  4U3F H;  1BSM A;  4Q6G A;  4JYB A;  4X20 A;  3OD4 A;  4CBC A;  1RPR A;  3T2M A;  3CCM V;  5IWA O;  3ZMT A;  1OCO B;  2DWE C;  1P7G A;  2CAZ C;  4UUJ C;  2Q7E A;  5A2Q N;  5LA6 A;  3QVN A;  3VQV A;  2PGG A;  3OT7 A;  2WPD G;  3ZHT A;  1SKV A;  4YJ2 B;  1PNL A;  3QO7 A;  3IJ4 A;  2WLN A;  1WB8 A;  4JAS A;  4LF9 O;  2UUC O;  3QO8 A;  4BAY A;  3ASN B;  1JNB A;  3X2Q B;  2IU3 A;  1FXV A;  2XHB A;  1H2S B;  3CB2 A;  1JJO A;  3CRC A;  2HFE C;  2YIB A;  3G67 A;  5H9C A;  4O4I A;  4DV5 O;  1H2G A;  1SS3 A;  4FFB B;  2XAF A;  3L71 H;  1I08 A;  4NTY A;  5KAF Z;  4JI1 B;  1J5E O;  3OR7 C;  5KHI A;  4W4L A;  2GDS A;  3RVY A;  2YEV B;  4K0K B;  4UB8 Z;  1RPO A;  2WLL B;  2PYL A;  2ZR3 A;  1GM8 A;  4H0L B;  1OCR B;  2LO1 A;  4CC6 A;  5CA3 A;  1JQ0 A;  1CPY A;  3Q4H B;  2Q73 A;  5H6Q A;  5FLX N;  2WLH A;  2YSU B;  1AR5 A;  2BTQ A;  2EIM B;  2UXN A;  1BHA A;  3D3Q A;  4JYA O;  1M1K W;  1L0N H;  5KUM A;  3E89 A;  5B66 Z;  3CJH A;  4B7E A;  4DK1 A;  4GCZ A;  3CX5 F;  3K9A A;  2RCV A;  4E2L A;  4LNU A;  4DV3 O;  4J42 A;  2YIB D;  2IW5 A;  1OZ0 A;  2EIN B;  3E22 A;  5J2U A;  4DV4 O;  1TVK A;  1BCC H;  4GX0 A;  5BR8 B;  1WA8 B;  5JJE B;  1CXZ B;  2OT5 A;  3T1H B;  4WFF A;  3E86 A;  5BY1 A;  4HNA B;  1MZF A;  2VQE O;  1M56 C;  3STL C;  3RW0 A;  4L8J A;  4WBN A;  3JD3 A;  5GTI Z;  4RQF A;  1YJW V;  2PUS A;  5LGU A;  4MTG A;  3M8A A;  1VQ7 V;  1X59 A;  1J95 A;  1Q81 W;  2QM4 A;  2FML A;  4NYK A;  2GHY A;  3HKC B;  3N2G B;  4TWK A;  3K5L A;  5D5P A;  4JI5 B;  1HNZ B;  3D3I A;  1M4U A;  2ILM A;  1Q6I A;  5LP6 C;  1QQC A;  3H1H H;  3S3X A;  2JVD A;  3G6B A;  4R7C A;  4JI7 B;  2OTJ V;  4X1I A;  3D8C A;  4B08 A;  2X7R B;  3K03 A;  1FD9 A;  2HG5 C;  1YTF D;  1EZV H;  4EKW A;  1UJW B;  4DUY B;  1QVG U;  4RWU A;  1VP7 A;  4ZOL A;  3OUF A;  5KX5 A;  1EM1 A;  5GON A;  4QE7 A;  5CBF A;  1A32 A;  1VF6 A;  2PY5 A;  3F7Y C;  3OFN G;  3UKM A;  1R3J C;  1R6N A;  4GYC B;  4J9Z B;  2Q7H A;  2QKS A;  3CP1 A;  3F5W C;  1XUQ A;  1HR0 B;  4UV9 A;  4AI8 A;  4JI1 O;  4TV8 B;  4MVQ A;  1BT8 A;  5IY5 C;  1VQO V;  5DN6 G;  4UXN A;  1N34 B;  3H01 A;  3A0R A;  4I7Z B;  4LH7 A;  4K0K O;  3HPL C;  4X65 B;  2WLK A;  3RYI B;  4FZ1 A;  1K9M W;  3A0B Z;  3JAT A;  3VOU A;  1R6K A;  3CXC U;  2YIA A;  3RYC B;  2F43 G;  1SQF A;  3SJQ C;  1XBL A;  4H13 B;  5JCO A;  2QWQ B;  2UXC B;  2EJR A;  4JI2 B;  4UVB A;  4FLV A;  4MVO A;  4BW5 A;  1FOU A;  5H2F Z;  3K0D A;  5JQG B;  4X1K A;  4ABM A;  2W0X A;  2GUZ B;  1YF2 A;  2HVK C;  4X20 B;  3JCZ A;  2DWD C;  4Z1M G;  4K8X A;  2W6I G;  1PV0 A;  3ABK C;  2F1M A;  3AG2 C;  2QSA A;  1WJZ A;  1Z5V A;  3G80 A;  3T1H O;  4UVC A;  5L3E A;  5EIB D;  3RVZ A;  3ZHS A;  2QDO A;  2BTO A;  2Y4U A;  5LA6 B;  4TUY A;  4TV9 A;  3I55 V;  3ZJZ A;  2HHH B;  4DV0 O;  5FPO A;  1PKX A;  4H33 A;  5EK0 A;  2A9H A;  3K0G A;  3WU2 Z;  3MHS C;  5B1B C;  3JSN A;  2UUA B;  3JD0 A;  3IGA C;  1HNZ O;  3AK1 A;  3OGC C;  1BMF G;  3PJS K;  2HJF C;  4MTX A;  3STZ C;  1ZL8 A;  3OUS A;  3JAW A;  3CEI A;  1JMK C;  4JI7 O;  1NJI W;  1NTZ H;  2XAH A;  2HR3 A;  2A7W A;  2RDC A;  3BAB A;  4DR2 B;  4DUY O;  4P9O A;  1V9P A;  2EJ7 A;  2R9A A;  1AB3 A;  4FLZ A;  1YSC A;  3H1I H;  2GTS A;  2CGO A;  5LMU B;  3JD4 A;  2CDY A;  1SQP H;  1DF5 A;  4PD4 F;  3SGI A;  4UCR A;  1OJH A;  1Y76 A;  1BQ0 A;  3DC5 A;  1K34 A;  2LGW A;  1AI5 A;  3DSQ A;  4FFK A;  5JH7 A;  2BTQ B;  2XAS A;  1S5H C;  4DW1 A;  2WLJ A;  2UUB O;  2OIG A;  2KB1 A;  3CJH B;  4X65 O;  3JAS A;  4LNU B;  3ZRW A;  2DOS A;  3OMA B;  3OMN B;  1V54 C;  2JGD A;  1Q6H A;  4DR4 B;  4NB5 A;  3E22 B;  5J2U B;  4F4L A;  2QGN A;  1YCI A;  2UXB O;  4LBE C;  4MTO A;  2F23 A;  1TVK B;  1Y4M A;  4UB6 Z;  3ABL B;  4DW0 A;  3U0Z A;  1MZE A;  1OCC B;  1XIL A;  1YTF B;  2UU9 O;  1WNS A;  3SPC A;  2UXC O;  4JI2 O;  1YXB A;  3QTC A;  4WFH A;  5CBG A;  1AR1 B;  3TXS A;  1NT2 B;  4MT8 A;  3CCV V;  2B9Z A;  4B3M O;  4FIP C;  3H1L H;  3ZRV A;  3FAV A;  4X8A A;  4E4E A;  4WBN B;  3CCR V;  2XTA A;  3SYQ A;  2RNB A;  3ML0 A;  1I5X A;  4PJ0 Z;  3TGU H;  4JAU A;  4J7Z A;  5LGT A;  3D36 A;  2PYJ A;  1O9G A;  5HFM A;  1V55 C;  4DUZ B;  2CTP A;  1PL0 A;  1EN5 A;  1JR9 A;  2Y69 B;  4UCO A;  4LF5 B;  2HHH O;  3SJC C;  1LNQ A;  2AW9 A;  4X1I B;  2QWN B;  3WG7 B;  2V7Q G;  4K8Z A;  4U3J A;  4ZKI A;  2IJI A;  4JI6 B;  4B3T O;  5DM6 V;  4IL6 Z;  2IBZ H;  4UCU A;  4JYC A;  4ZOL B;  5KX5 B;  2YID A;  1GMG A;  4N23 A;  5GON B;  2IJJ A;  4K3A A;  2ARH A;  3O9O A;  2QTS A;  4GX5 A;  4CS3 A;  2Y48 A;  4PV1 B;  3IC9 A;  4B3S B;  2K9P A;  1XHX A;  1SZX A;  4J80 A;  1IUR A;  1GRJ A;  3WB1 A;  5J9P C;  2G38 A;  4DR2 O;  3K3W A;  4F6R A;  1PD3 A;  4GZR B;  1W2B U;  1VQ6 V;  3K04 A;  4W4K A;  5L3G A;  1QLN A;  1I5Y A;  3ZHU A;  5LMU O;  3T1Y O;  5IWA B;  1GK9 A;  4BW9 A;  3JAT B;  4P9P A;  4Z2W A;  2JGU A;  1ZLZ A;  3FB6 C;  3RYF A;  2E76 B;  2P22 C;  3DXR A;  1OCZ B;  4PI2 A;  4X89 A;  2NR5 A;  2YIC A;  1GN2 A;  1N4C A;  4JZG A;  1N0N A;  2AHZ A;  5H5N A;  2YI8 A;  1RM1 C;  3CCU V;  1ENV A;  2ZE8 A;  5EZY B;  2M7W A;  3ABT A;  4NXN O;  5J2T A;  4X62 B;  5E1A C;  4DR4 O;  1FYJ A;  4X1K B;  4MTF A;  2ZXW C;  1TUB A;  1Q82 W;  4I9W A;  3EVK A;  3OW2 U;  1L8D A;  5LYJ A;  2LFR A;  2WLI A;  4LP8 A;  1MSW D;  1W0K G;  1Z5W A;  4G28 B;  4JI8 B;  2X6B A;  1J5E B;  2JRI A;  4TV9 B;  5F2V O;  1SA0 A;  1N33 B;  4HBN A;  1N32 B;  1P4R A;  4CH6 A;  2EX3 A;  3J81 N;  2OCC C;  2OCH A;  1W59 A;  1EBO A;  3L73 H;  4MW8 A;  2PI5 A;  1BL8 A;  2EZP A;  4DUZ O;  2C2A A;  4JYA B;  2B1G A;  1ZL8 B;  4LF5 O;  2H94 A;  3JAW B;  4IYI A;  4DV3 B;  1JJ2 U;  1YIJ V;  2IJK A;  3SYP A;  3ZBH A;  1QNM A;  3CMA V;  3TCU A;  2H8P C;  4LFB B;  3CME V;  4CS4 A;  4K35 A;  1OHH G;  1XEQ A;  4B3S O;  1MSD A;  2FYU H;  1SET A;  2X0L A;  1N0J A;  1Y76 B;  4YY3 B;  1JFF B;  3ETQ A;  5KHH A;  3HKD A;  5LP6 A;  1AVM A;  2Q4P A;  2ZDI C;  5JH7 B;  4GKJ B;  2DQ0 A;  4NTX A;  1MG1 A;  2XAJ A;  1JCH A;  1TGO A;  1GN6 A;  3JAS B;  4MVR A;  2F95 B;  3ZRW B;  3R66 A;  5BZB A;  4PA6 A;  1KBH A;  1KD1 W;  2VQF B;  1GKF A;  3B8N A;  2F93 B;  1XDC A;  2P6J A;  3RFR A;  4TT3 G;  4JTC B;  4KHP O;  3THO A;  1FFX A;  3ZMZ A;  4FJC C;  1TAE A;  3WB0 A;  4YHH B;  4XDK A;  1SRY A;  2R9R B;  1VEW A;  4IHJ A;  4X62 O;  3AG4 C;  4JPR A;  3FAV B;  5CA0 A;  2DYR B;  4WFA V;  2NN4 A;  1B3Q A;  2X6C A;  2ZQM A;  1NQT A;  5C8Y A;  2AXT Z;  5CBH A;  1XMQ B;  2P4K A;  2CH7 B;  1JX9 A;  3PN1 A;  2QWR B;  4XDJ A;  1R1B A;  5B3S B;  1KEC A;  4RAI A;  4KUM A;  4JI8 O;  4FLU A;  3MAQ A;  4BR6 A;  3KCY A;  1KKC A;  5FL7 G;  1N33 O;  1N32 O;  2ZIO A;  4B7K A;  3E35 A;  3RGB A;  4U3J B;  1THZ A;  3AG7 A;  2KKW A;  2AZ0 A;  2OYQ A;  1QVF U;  5IJ9 A;  1H2N A;  1HDJ A;  4UCV A;  4DV2 O;  5IDJ A;  4D7S A;  1RFY A;  1GAX A;  4LWS A;  3MDS A;  4PDL A;  1KP2 A;  4P30 A;  3GWK C;  1W0J G;  4AHC A;  4DR7 B;  2CUG A;  4F6R B;  3P30 A;  1I94 O;  1YEW A;  5LXT B;  2BSK A;  4LFB O;  2EZO A;  4OXS A;  4O2A A;  4DV6 B;  5FNV A;  4JAV A;  1VQN V;  3WFV A;  1TUE B;  2EIJ C;  1COW G;  2DN9 A;  1VQL V;  5B5E Z;  4QIW F;  4DV7 O;  4I0X A;  4YY3 O;  3QF7 A;  3ZED A;  1HNW B;  4FM2 A;  1QR9 A;  1XL4 A;  3RYF B;  4JGS A;  3DXR B;  2XOK G;  3RYH A;  2L6L A;  1N36 B;  4GKJ O;  4LR3 A;  2V1D A;  3SR2 C;  4DV0 B;  3L74 H;  4ZHQ A;  1JPX A;  4BIZ A;  1VQK V;  1Q7Y W;  2ITC C;  3HKE A;  5J2T B;  1VQ5 V;  1IZ3 A;  1WB7 A;  3DC6 A;  3BA8 A;  2VQF O;  1Q3E A;  4YIP A;  2EIK C;  4UCT A;  1HNX B;  3AK2 A;  3O65 A;  3RT3 C;  1EN4 A;  1TUB B;  3HR0 A;  2E5L O;  1XMO O;  2MK3 A;  3FKS G;  3DGE A;  1BS3 A;  2ATK C;  2R70 A;  1P84 F;  1BHB A;  1QU7 A;  3K57 A;  3B40 A;  3E8F A;  4YHH O;  2P7T C;  4GKK B;  1XL6 A;  2Q0O C;  1DK1 A;  2R9I A;  5LYJ B;  3CC4 V;  1FFT B;  2WLI B;  3AEI A;  2ETN A;  2LQT A;  4ZBM A;  3VQW A;  1KQS U;  2DQ3 A;  4NVP A;  1SA0 B;  1XMQ O;  1CEZ A;  5EBM C;  5IYB O;  3ZMV A;  1G8M A;  2WLM A;  4U7O A;  3E8H A;  1F4M A;  2UUB B;  2EIL C;  3A2F A;  1ZWI C;  4KFM A;  2ZIM A;  3JSL A;  1E79 G;  1DGS A;  1R3L C;  4I50 B;  3ZHQ A;  2JEX A;  1MMM A;  3UM7 A;  3ETE A;  4AQY B;  2UXB B;  1XHZ A;  1M56 B;  2CTW A;  2JS3 A;  2F66 C;  1D2D A;  1NTM H;  3K5O A;  2UU9 B;  4J11 A;  1U96 A;  2DW4 A;  3B77 A;  5GW7 A;  4DR7 O;  3BRC A;  1D5N A;  4B3M B;  3GB7 C;  2N74 A;  3AG3 C;  3HKD B;  4J9Y B;  5LP6 B;  1SQX H;  3B2E E;  1EN6 A;  2NLJ C;  5L3D A;  4O4H A;  1H8H G;  1NR7 A;  2P5O A;  1M57 C;  4F6E A;  2DYS C;  2WAM A;  3LSS A;  4XDL A;  4DV6 O;  4X64 O;  2PTM A;  3UO2 A;  1HNW O;  2QM8 A;  1I7F A;  3FX7 A;  1N36 O;  1KMI Z;  5IYZ A;  2DMX A;  4DV1 O;  4LH6 A;  5BXZ A;  5LMN B;  1FFX B;  4B3T B;  2RMK B;  4X66 B;  3CC2 V;  2XUM A;  1K97 A;  4IHJ B;  3APO A;  5IY5 B;  1HNX O;  5CA0 B;  4MS2 A;  1IVS A;  3W7S A;  4CH3 A;  4LFC B;  3OGI B;  3SPJ A;  5C8Y B;  4BWA A;  4O4I B;  4ZI7 A;  3N2K A;  1XQ8 A;  4QGP A;  4O4J A;  3DTU B;  3JAR A;  1XNR B;  4GKK O;  1G4Y B;  2GV9 A;  3B4S A;  4J41 A;  4RUE A;  3RWR D;  3CD6 V;  3F5T A;  1MOF A;  3ABM C;  1Q5O A;  4N21 A;  1B6Q A;  4PA7 A;  3CSX A;  2HP8 A;  4FMT A;  3ZS8 C;  3MD0 A;  4FVM A;  3T1Y B;  1YIT V;  4JAA A;  2FTK A;  5LL6 Y;  2MW2 B;  4WFB V;  4JI0 O;  1AJN A;  4FPP A;  1VQ4 V;  5EBL C;  3BY6 A;  1KP3 A;  4CH5 A;  5IJ9 B;  3A8T A;  4PDM A;  3ETG A;  4D7T A;  4LWS B;  1IXB A;  4IYH A;  4DYL A;  3ABK B;  3AG2 B;  5KMG A;  2E74 B;  2VWK A;  1T5E A;  4NXN B;  1K5S A;  2Q69 A;  1JVM A;  4OGQ B;  2BSK B;  2N04 A;  3H1J H;  4AQY O;  4LF4 B;  1YZB A;  4UV8 A;  2F4V B;  4O2A B;  5FNV B;  1S76 D;  5KA6 A;  1M9N A;  2ADQ B;  4DO2 A;  5L3C A;  2JDI G;  4C7U A;  2ADP A;  2GBO A;  5B1B B;  4I0X B;  4FM1 A;  4L87 A;  1IDS A;  3CHX A;  3RYH B;  4O4L A;  3W7T A;  1Y74 A;  1AP5 A;  3B8M A;  1NH2 D;  3L75 H;  1R3I C;  3HKE B;  3KDR A;  5IJ0 A;  3ASO C;  1S5L Z;  3TXQ A;  2NNU A;  3KCX A;  4JF3 A;  4Q20 A;  4LF6 B;  3M99 B;  2JJ1 G;  3EFF K;  5EYP A;  3HKB A;  5LMN O;  3KZI Z;  2Q9L A;  2ZT9 B;  4X66 O;  2ZNI A;  2ZE7 A;  3CPW U;  3CCE V;  2WSS G;  1FXH A;  4OPH A;  2XAQ A;  2XAG A;  1ZAU A;  2ZDI A;  3UQ8 A;  2YXY A;  4DR3 B;  1QLE C;  2QM7 A;  1IXM A;  3W7X A;  3ZMS A;  4LFC O;  1LR1 A;  3VBB A;  3W7U A;  1S3J A;  1V54 B;  3B09 A;  1XNR O;  3GVM A;  3CE2 A;  1GH6 A;  1HP8 A;  1Y66 A;  2YS8 A;  1H38 A;  3AG1 C;  4BIU A;  1JA8 A;  5LHI A;  3FD9 A;  1FXK C;  5IYD O;  3JAK A;  1PNK A;  1B04 A;  3TJT A;  4GT1 A;  4PHZ A;  5K1X A;  2ZM6 B;  4PI0 A;  2A3Q A;  3RN4 A;  2OIE A;  2WA3 A;  3E2E A;  2QKC A;  5L3F A;  2KSD A;  2ODM A;  1WPB A;  2HLD G;  3ZIA G;  5LHH A;  2YI9 A;  4KHP B;  3TET A;  3SYO A;  4DR5 B;  3C3S A;  3LSU A;  1QCE A;  2VS0 A;  5KA5 A;  1Q43 A;  3K79 A;  5KHG A;  2E3C A;  2V4D A;  3E8B A;  3NR7 A;  1V55 B;  5EC1 C;  3WB2 A;  4LF4 O;  4O4H B;  1GO3 F;  1K5Q A;  1H8E G;  3C3T A;  3K9S A;  2F4V O;  1L1F A;  4DR6 B;  4QE9 A;  1FS0 G;  3QG5 A;  4NXM O;  1X4T A;  4QJF B;  1H2L A;  5B1O A;  4TUY B;  2X6A A;  5IYZ B;  3OM3 B;  3VQY A;  5L3B A;  4HZ3 A;  3TK1 A;  2ZR2 A;  4CZZ A;  4OX9 B;  1OCO C;  3OE7 G;  4DXW A;  2JEU A;  3LNM B;  1NU1 H;  4HAM A;  1U97 A;  4DV2 B;  1S77 D;  4LF6 O;  1EFR G;  1QR8 A;  3KKY A;  5H6R A;  1IBM O;  4ZI7 B;  3N2K B;  5CMU A;  4O4J B;  3OEE G;  2UXD O;  1I94 B;  5LGN A;  4GLX A;  2Q8V A;  4CH4 A;  2Y4T A;  5AG2 A;  1SER A;  3ASN C;  5LHG A;  4LF8 O;  3JD2 A;  2P67 A;  1YVW A;  1DLB A;  4DR3 O;  3X2Q C;  2QEX V;  2VWJ A;  3OEH G;  3BHP A;  1HWY A;  1N8R W;  1RM1 B;  3BA9 A;  2FKX A;  2GSM B;  3EXA A;  4DV7 B;  4YIO A;  1K8A W;  3CXH F;  1YJN V;  3SYA A;  3RYC A;  5ITZ A;  1SQV H;  3K08 A;  2ZXW B;  4H37 A;  3MHH C;  1E1Q G;  2Q7G A;  1NH2 B;  1VQP V;  1RSO A;  3G4S V;  5KMG B;  3CCJ V;  3P3N A;  2ZM6 O;  1OCR C;  5DED A;  4MSW C;  3R65 A;  4NTW A;  2JGD B; 
#chains in the Genus database with same CATH homology
 1IDS A;  3CEI A;  3AK2 A;  1EN4 A;  2AW9 A;  1AP5 A;  1BS3 A;  1XUQ A;  1PL4 A;  1ZTE A;  2P4K A;  3K9S A;  3C3T A;  1ZSP A;  1AR5 A;  1MA1 A;  1BT8 A;  3KDR A;  2CDY A;  4BR6 A;  3BFR A;  3IC9 A;  1Y67 A;  1KKC A;  2RCV A;  1SZX A;  2CE4 A;  3AK3 A;  1B06 A;  3DC5 A;  1LUV A;  1BSM A;  1PM9 A;  1QNM A;  5A9G A;  4FFK A;  1GN3 A;  1P7G A;  3MDS A;  1MSD A;  2QKA A;  3QVN A;  1N0J A;  3KKY A;  3OT7 A;  1ZLZ A;  1AP6 A;  4GUN A;  1MMM A;  1AVM A;  1GN2 A;  1XIL A;  5AG2 A;  4JYY A;  4JZG A;  1N0N A;  1WB8 A;  1MNG A;  1I0H A;  1ZUQ A;  1JA8 A;  1IXB A;  1GN6 A;  3TJT A;  1XRE A;  1D5N A;  3RN4 A;  4JZ2 A;  4YIO A;  1IX9 A;  4E4E A;  1XDC A;  1LUW A;  2QKC A;  1EN6 A;  1VAR A;  1AR4 A;  1GN4 A;  3EVK A;  4F6E A;  1I08 A;  1EM1 A;  3C3S A;  2ADQ B;  3LSU A;  1VEW A;  3AK1 A;  4C7U A;  2ADP A;  3DC6 A;  1WB7 A;  2GDS A;  4X9Q A;  1EN5 A;  1JR9 A;  4YIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...