3TJTA

Crystal structure analysis of the superoxide dismutase from clostridium difficile
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
202
structure length
202
Chain Sequence
NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
publication title Crystal Structure of the superoxide dismutase from Clostridium difficile
rcsb
source organism Clostridium difficile
total genus 74
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3tjtA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3tjtA02
5AG2A 1KKCA 1MMMA 1AR4A 1ZLZA 1WB7A 1BSMA 3MDSA 3RN4A 1MSDA 1ZSPA 2QKAA 1IDSA 3AK1A 1JR9A 1EN6A 1IXBA 3BFRA 4FFKA 4YIPA 2QKCA 3OT7A 3AK3A 1AR5A 1GN2A 1VARA 4YIOA 2CE4A 1XREA 1XDCA 2GDSA 4JZGA 3DC5A 3EVKA 1BT8A 1JA8A 1LUVA 1I0HA 4BR6A 5A9GA 3C3TA 1PL4A 1WB8A 1MA1A 2ADQB 1GN6A 3DC6A 1GN3A 1SZXA 1B06A 1Y67A 1PM9A 1AP5A 3IC9A 4E4EA 1D5NA 4JYYA 2AW9A 1P7GA 1ZTEA 2P4KA 3C3SA 1N0JA 3LSUA 4C7UA 4GUNA 1ZUQA 1QNMA 1XILA 3CEIA 1BS3A 2ADPA 3K9SA 2CDYA 1GN4A 3TJTA 1I08A 1EN4A 4F6EA 3KKYA 1AP6A 1LUWA 3QVNA 4JZ2A 1MNGA 1N0NA 1IX9A 3AK2A 2RCVA 1VEWA 4X9QA 1AVMA 1EN5A 1XUQA 1EM1A
chains in the Genus database with same CATH superfamily
3E35A 4DR4O 4FLZA 1NTZH 3JD3A 2FTKA 2X7RB 1IZ3A 4DV0O 1J5EB 3G6EV 4J7ZA 1W2BU 5JQGA 4FPPA 2YICA 3DGEA 5KA6A 4FK5C 3G67A 1F4MA 5JJNB 1N34B 1ZAUA 1RP3B 2XAGA 3ZCCA 3CHXA 5LP6A 3DSQA 3DTUB 4MVQA 2ATKC 4YHHB 5BMVA 3FAVA 2UU9B 2WA4A 3JSNA 5B66Z 1VQ9V 4NXMO 3EHBB 2Q7HA 1S0VA 3ABKB 1NJIW 4U7NA 5TISZ 1AB3A 2UXNA 1SESA 2E3CA 3LDDA 3C3TA 1K8AW 1MSWD 1Y66A 4I50A 1QR8A 1V54C 1GN6A 2X6BA 4LF7O 1Y76A 3KG2A 5IJ0B 2VQEB 2V7QG 1U96A 4O4LA 3NR7A 3STZC 4PA4A 4JYAO 1NTMH 2O57A 4DRXB 1H8HG 1BGYH 1GM8A 2P4VA 5FNVB 4NTWA 4LNUB 2P5OA 3CEIA 1YZBA 2ADPA 4JI8B 4FM0A 1B6QA 2JRIA 3CJHA 4MW3A 4LFCO 3QTCA 4ZOLA 1H2KA 3OM3B 1AILA 2R70A 3ZRWA 4O2AB 1G1XB 1FS0G 5IE9A 1XL4A 3ETQA 1SZTA 2F66C 3AG3B 1MNGA 4DR2B 2QWPB 4XDLA 2ZNJA 2YIAA 1D5AA 3H1LH 5JH7A 1AVMA 3CPWU 3B8NA 4J80A 1Q6HA 4Q6GA 4K3AA 5EZYB 2LFRA 1YHQV 1FXHA 3ZRXA 2IM9A 2OCHA 4TQFA 1FXKC 3HKBA 3RN4A 3G4SV 4X1IB 4JTAB 4UXNA 2QE7G 5JCOA 2HP8A 1AJPA 2WLNA 4UVCA 2GUZB 1N34O 1Q81W 2Q68A 1TUBB 2X6CA 3OT7A 1WP8A 1NU1H 1W59A 3L72H 2VWJA 4IHJA 2OIGA 5CA1B 1T5EA 4X1KA 2UU9O 3CB2A 2UXDO 4OX9O 1LUVA 4NVPA 3X2QC 2BTQB 4P2ZA 3T2MA 1HNXB 2LW7A 5EIBD 4RQFA 2E5LB 1R6TA 4CS4A 1PM9A 2P06A 4E4EA 1Q43A 1AI5A 4JYYA 2IJHA 3BPZA 1ROPA 2UXXA 2P4KA 2QWOB 3FB7C 3JASA 4LFAO 3CMAV 4UCRA 1UJWB 1NZ6A 4WF9V 1BQ0A 3K9SA 2UUBO 4MVRA 2YI9A 2WLMA 1A32A 1FYJA 1VQ5V 1VQ4V 1XNRB 1LUWA 2A06H 3QVNA 4WCEV 3CS5A 5LP6C 1RM1C 1NS1A 5C8YA 1BCCH 1FXKB 4DR2O 1XMQB 3OFNG 3VOUA 4X64B 3KDRA 1EM1A 2A9HA 4QPJA 1Y74A 3CC2V 3QNEA 3Q4HB 4JPRA 4X8AA 5B3SC 4PA3A 4LF9O 1NT2B 1N32O 1IDSA 4JAAA 2AGAA 3OMAB 4QPKA 4DV3O 4GKKB 4FLWA 3GVMA 3VQVA 1JR9A 3E2EA 4B3MO 5KHKA 1KKDA 4XDJA 1AI6A 3J7AU 5KX5A 5KHIA 4GT1A 1DK1A 2QM8A 1Q86W 3P3NA 2RNBA 3X2QB 2NNUA 5IYCO 4EFBA 2E75B 4KFMA 4GKJO 2CGOA 5LYJB 1GO3F 3BVOA 5E1AC 1KECA 4WFAV 5LHIA 2BCCH 2KG7B 3LDCA 3WB0A 3AG2C 4B3TO 4DR1B 1F7YA 4DR7B 1DF5A 1TVKB 2K1EA 1YJWV 2BSKB 3JSLA 5L3EA 1K9MW 5LA6B 5CBGA 3LDEA 4JI7B 3OAAG 1G8MA 2DE0X 2PUSA 5JQGB 4X20B 1HWYA 1L8DA 1UPGA 4IYHA 3J81N 3K9AA 1IJGA 3E89A 4JAUA 4J9YB 5LP6B 2Y48A 3ZMVA 3FB6C 5IJ9A 5IY5C 3W7TA 1XBLA 4JI1B 1YJ9V 5ITZB 1K5SA 3E8FA 5B3SB 1RPRA 2VQFB 2WLLB 3B77A 1I94B 4KP4A 2L35A 4NB5A 4K0KB 2F4VB 1WB7A 4I50B 2HHHB 3ABUA 1S76D 2QKAA 1Y76B 2M6YA 1HNZB 4FLYA 2HJDA 3ZHUA 5IJ0A 4O4LB 1NI8A 4X62B 4X66B 4B7KA 5CA0B 1G6UA 4DRXA 3G6BA 1H5WA 2EJ7A 2ZT9B 5J2UA 2K9PA 3K08A 4LNUA 2P22C 2GV9A 3G80A 4GYCB 2IU3A 2PGGA 5LGTA 3CCRV 3AG2B 1Q6UA 1MA1A 3DC6A 4NR1A 2XAHA 1MOFA 2ZXWC 2VRZA 1S5LZ 4BWAA 2JGDA 5JH7B 4FFBB 5LL6Y 5DN6G 1BQZA 3O9OA 1FJGO 2B1IA 3N2KB 4C7UA 2JS5A 2OT5A 1IVSA 4R6ZA 2RQ6A 4X65B 3OTOO 4FZ0A 1IBLB 2CUGA 1QU7A 3H1KH 1VQPV 2XT9A 1H2NA 1VF6C 4U7OA 3BRCA 4DUZB 2DJVA 4X1IA 2DYRC 5IY5B 5DM6V 3JAKB 1XNQB 2GTSA 1M56C 4UVAA 2GUZA 5BY1A 2QJ1A 2W0FC 4JTCB 4NYKA 4BW9A 4X88A 5D5PA 1WP7A 1F51A 1RFYA 4I9WA 2Y69C 3VBBA 5CA1A 4QIWF 4KXRA 3RYCA 1AR1B 1N33O 3SYAA 4JI2B 2EZPA 3CCLV 4H44B 4WBNA 3HKEA 3K3WA 3TXQA 1SQQH 3RWRD 1HNZO 4DV0B 3B4SA 1BE3H 1GK9A 1J95A 4FLXA 5EIBC 2CGNA 2HVKC 3WG7C 5IWAO 4DR6B 2LJ2A 5L3DA 5CN0A 1Q7YW 2MK3A 1NBMG 2IU0A 2DWDC 3K5MA 2XAQA 1JA8A 2ZNIA 2FKXA 1YVWA 2WA3A 2ADQB 3L9DA 1BHBA 1K3EA 4DK1A 4R8CA 2CK3G 3IC9A 3OMNB 3WB1A 2EBOA 1G4YB 2M7WA 3QO7A 1PKXA 2YDEA 4LF6O 1QVFU 4UCSA 3ZN0A 3FFQA 1FXKA 2N04A 4XDKA 3RVZA 4UCUA 5GW7A 4Z1MG 2HVJC 3KCYA 3L74H 4YJ3B 3KZIZ 3D3IA 3ZRVA 3SPIA 3OEEG 3Q4HA 2CDYA 4PDRA 2DYRB 5KAFZ 3CXCU 2Y4UA 2PI5A 5JWPA 1M56B 2A79B 1VQMV 3THOA 2RJZA 1AI4A 2DWEC 4G28B 2Y69B 4MVMA 1XMOO 5EC1C 4LFCB 1NH2D 2C2AA 1DTOA 1XNQO 3MHHC 3ZMZA 1K33A 1JOYA 4KHPO 3ZMTA 2YEVB 3SPHA 5AG2A 2QWNB 1E79G 3ZRSA 5LYJA 4DUYO 3L75H 4TV8A 3U11A 1VQ7V 4D6TH 2ZM6O 2KG7A 4QNHB 2R9RB 1SQGA 4HZ3A 1NVPD 1CPYA 1KBHA 3HKCA 1TVKA 3WG7B 4JI2O 1QLNA 5IYDO 3D36C 3OMIB 3TXSA 5LA6A 3FYIB 1ENVA 2X6AA 5GTHZ 1DLBA 5IYZB 1NTKH 3I55V 1FD9A 1XI1A 1N36O 4J41A 4X20A 2Q8VA 4DR6O 1I0HA 4BR6A 1GKFA 1B06A 5IJ9B 1M5IA 2JJ2G 1IBMO 2UUCO 4JI3O 4EFEA 3ML0A 1KMIZ 2FYUH 2UXDB 4OX9B 1EZJA 1ORQC 5LXTB 1QR9A 4U3JA 2BTOA 3A0RA 5ITZA 3E8BA 2WLLA 3CX5F 5LHHA 2HLDG 2QM7A 1GN4A 1PNLA 3T1YO 2B1GA 4GCZA 2IBZH 1L0NH 1EN4A 1R3LC 2FB5A 4O2BB 4LFAB 1O9GA 3H9VA 1THZA 2UUBB 3HPLC 3RFRA 5GONB 1B04A 5CA0A 1YJNV 2H8PC 4BW5A 4FVMA 4TT3G 5J2UB 2FMLA 3JD2A 1NR1A 5LOVB 2RCVA 2ZE7A 3SPJA 5B1NA 4FIPC 1WN7A 4HYOA 4Q20A 4NXNO 1HNWO 2X0LA 4JYCA 4J42A 2YXYA 1FAFA 1NKDA 1WPBA 3A8TA 1FOUA 1MSDA 3WFVA 3RVYA 4O4JB 4X89A 5JVDA 2YSUB 2XOKG 2JGDB 5KMGA 1E1RG 4FLTA 4LWSA 4FFBA 3JD0A 1M1KW 3WU2Z 4GX5A 4N21A 1YDXA 3TK1A 5IT9N 4LF9B 5BZBA 2Z0AA 4AI8A 1N32B 4YIPA 3N2KA 2YIBD 4DV3B 2CE4A 1VQNV 2JEUA 5KHHA 1R73A 4B3MB 2WLIB 2LP7A 3EVKA 3JCZA 4K8XA 1KU9A 1VQKV 4LF5O 3L71H 3GWKC 3MD0A 3JARB 4EB6B 5DEDA 4JASA 3BCCH 2ZDIA 4B3SO 3JAKA 3TGUH 1SKVA 4LF8B 4E2LA 1SQXH 4GKJB 4NTYA 3MHSC 1K34A 2R72A 1SQVH 2Z5UA 1R6NA 1VIBA 1N0JA 1V54B 4GX0A 2CH7B 1HW7A 3BHPA 1ZUQA 3RYCB 2XASA 4B3TB 2ITCC 5EBMC 4MTGA 2ZE8A 1H2MA 3W7UA 1YTFB 3HB3B 5KUMA 4PI2A 3BEHA 4WBNB 3HKEB 4XBFA 3D3QA 2PY5A 3K59A 4CBCA 3QO8A 5CB4A 2H3OA 1JX9A 1P4RA 4DV1B 4FMTA 1N0NA 1H38A 4BIOA 5CBHA 4K35A 1V9PA 3SPCA 2ZKOA 1RSOB 4CH5A 2Y0IA 1AR4A 2F95B 1K7DA 2HG5C 3K0DA 1Q3EA 3AK1A 3ZHTA 4U3FH 4O4IA 1KP3A 4MVZA 3CXHF 1MZFA 2H94A 4UV9A 1BHAA 1GH6A 1VQOV 4PHZA 2ZE5A 2E74B 4HNAA 2PYJA 1IXBA 3H01A 2KQXA 1VF6A 2XTAA 2DW4A 4YJ3A 3E8GA 1VARA 5B1AC 3VQWA 3C90A 1XOUA 1YIJV 3OW2U 2JEXA 1PL4A 2QTOA 1MG1A 2CAZC 1KD1W 1GN3A 3OUFA 1OCRC 3A0BZ 4CS3A 3ETGA 5LBQA 2EINC 3CE2A 4FZ1A 1ZTEA 4DV2O 1SC5B 3C3SA 4LF8O 2Q67A 2YEVA 4P30A 2HKOA 5H9CA 4MS2A 3JALB 4OPAA 3SR2C 4TV8B 1LNQA 4AQYB 4O4HB 4DV4O 1MZEA 5EBWC 4CC6A 4F6EA 4FM1A 1FJGB 2UXCB 3K57A 1H2GA 3HKCB 2VWKA 3HKDB 4ASUG 3OTOB 1CP9A 1SQPH 1OCOC 5B1BC 2R9AA 2HFEC 3ZHRA 1HR0O 2Q0OC 5IYZA 4DV1O 1P7BA 3E22B 2W0XA 3I5DA 1M57C 4DW1A 4UFZA 4Z1VA 2WLKA 2QSAA 4FLUA 4CH6A 1MABG 1JJ2U 4LH7A 3ASNC 1RM1B 5LMNO 3WB2A 3SYOA 4UVBA 5LHGA 2OCCC 2ZDIC 2Q4PA 4U3JB 4B08A 2YC0A 5B1AB 5LXTA 2ODMA 3JD4A 1N33B 5CMUA 4UB8Z 4FFKA 1JVMA 1R3JC 3ABLC 1CEZA 3B40A 4PA7A 1NR7A 3B8MA 1WJZA 3ZMUA 4OPHA 1OCRB 1QVGU 4UCOA 4O2BA 2ITDC 2D3OW 2ETNA 2Y4TA 1K5QA 2V1DA 2EINB 5IWAB 1F23A 2QM4A 1AP5A 5GONA 5KUKA 4D7TA 3K58A 1P84F 5LOVA 3OEHG 2NLJC 2WAMA 5KLVH 4X1YA 2ZCEA 3ZJZA 2QWRB 3LSUA 3RW0A 4GUNA 1XILA 1BS3A 1NH2B 2KKWA 4JI0O 4A5UB 1OHHG 4I7ZB 5CA3A 1CXZB 2F1MA 5JVDB 4LF6B 1OCOB 4O4JA 5B1BB 3D36A 5KMGB 1E1QG 4LWSB 2EILC 4AQYO 3CC4V 2QDOA 1SA0B 4GX1A 3ZBHA 2UXBB 2IH3C 4JZ2A 2XUMA 2UXCO 3H1IH 4PI0A 3CC7V 5LMUO 1JJOA 1M57B 4DV5O 2OIEA 1HDJA 3CD6V 4R7CA 2WLIA 5BXZA 3CSXA 4HAMA 4TV9A 3ASNB 4JGSA 5KAIZ 1XMOB 2P6JA 3JARA 4EB6A 2OCCB 3MDSA 3W7XA 4TUYB 4WFFA 4DR3O 4PDVA 3ZMSA 1Z5VA 4GLXA 3IAYA 1SRYA 4KHPB 3UCSC 4CS2A 3ABMC 2F93B 3APQA 3ABLB 3J80N 1TUEB 5GTIZ 4DUYB 3ICXA 4ICGA 4TQDA 4ZKIA 2F43G 2CH7A 5EYPA 3KCXA 2ZM6B 3JD1A 4RQEA 4DV6B 1M93A 4YIOA 3W7WA 1KP2A 4ZHQB 3BY6A 4MVUA 2UUAO 3EFFK 4IT5A 3A2FA 3DXRB 1Z2GA 1I5XA 4OGQB 5CB4B 2AZ2A 5K1XA 1N36B 2G38A 3OE7G 2QGNA 3UO3A 2LGWA 3BA8A 3CRMA 5LGNA 4LF4O 1IBMB 1RSOA 1Y4MA 2UUCB 4JI3B 1V55C 2ZXWB 3RYIB 3LNMB 3T4ZA 4G2KA 2EILB 1EFRG 4IIJB 3P30A 4I0XB 1SETA 4O4IB 1AP6A 5EBLC 4DW0A 1ZL8A 4HNAB 4YY3O 4B7EA 1K97A 2WLJA 1I5YA 2ZR3A 3T1YB 4JI5B 1FXVA 3AK2A 1GAXA 2Q0AA 2LQTA 3T1HO 2UXBO 4YJ2B 4QJFB 1FPOA 3M99B 3OUSA 2P67A 1M4UA 3UKMA 3ABMB 3E86A 4JAVA 4YXWG 2WWWA 4ZI7B 3AEIA 3I56V 1JMKC 2L6LA 3FX7A 1WPXA 4NXNB 1HNWB 4MW8A 4MTFA 1XQ8A 1M9NA 4I55B 4JI4O 4NTXA 3JALA 3JATB 2Q9LA 2Y0PA 4JZGA 3DC5A 1UFIA 4AILC 4O4HA 4TWKA 1OCZC 2ZINA 3CP1A 1KYOF 4DV6O 2AZ0A 1SQFA 2RDCA 2CTRA 3RYFB 5A9GA 1AJQA 3JAWA 2PTMA 3HKDA 3IFXA 4N23A 3SYPA 4IYIA 2Z3YA 4UUJC 3SJBC 3SJAC 4KL1A 1KQSU 3RT3C 4LF5B 1V55B 4LBEC 1GM9A 1QBZA 4RWUA 1QNMA 4B3SB 3E22A 3OR7C 2ZIMA 1H2LA 1OJHA 5J2TA 2D2CB 5HFLA 3ZHQA 5FL7G 2QR4A 1OZ0A 1QCEA 3RYHA 3ASOC 2OTLV 3S3XA 4I9QA 3IJ4A 3MAQA 5KA5A 4WFBV 1PPJH 2ZD9A 4L8JA 5EC2C 1VF5B 1JQ0A 4MTOA 1K4DC 3N2GB 1VQ6V 4PD4F 1XUQA 2Q5ZA 1XHXA 4JI5O 3VQXA 4KUMA 4DR5O 2DN9A 4PDLA 1Q90D 4PA6A 4LFBO 5FPRA 1GRJA 1VQ8V 4AHCA 3CRAA 5H5NA 1B3QA 4EKWA 2P90A 2Q7GA 3FB5C 4MVSA 3GB7C 4JV5O 3ZIAG 4X1YB 1SS3A 3A0HZ 1K4CC 1I7FA 4IL6Z 1OCZB 2QEXV 2A3QA 3ABTA 4DV7O 1BMFG 5B5EZ 3BAAA 1U97A 4I5SA 1VMGA 4WFEA 2DQ3A 3LSQA 1PNMA 4B3RO 3CYOA 4D7SA 1SA0A 1Q82W 2MW2B 3K06A 2R9IA 1S72V 2AW9A 2XAJA 2YS8A 4R50A 1ZX3A 2E76B 1VF7A 3UO2A 2HR3A 2RMKB 4TV9B 3U10A 4BIUA 1W0JG 5H6RA 5D5QA 1YI2V 1XHZA 5B1OA 2JK5C 3ASOB 1P49A 4TUYA 1FKAO 1I08A 4UB6Z 3K79A 4DV2B 1S3JA 3E8HA 5A2QN 4L87A 2OWOA 2IW5A 3T4DA 4RO2A 2FL4A 2QA4V 3SPGA 4DYLA 1X59A 1OV9A 2A7WA 1J5EO 1IX9A 3RGBA 4H37A 5EYPB 5BR8B 4DV4B 3K04A 2XAFA 4FM2A 2LFSA 5H2FZ 3JYCA 4ZHQA 2RN9A 1JNBA 1KC8W 3ZHVA 3E83A 4F6RB 3DXRA 1ZLZA 5KHGA 3ZHSA 4YHHO 3M7MX 1ZSPA 1QHTA 1HR0B 2DQ0A 4QGPA 2JJ1G 1SQBH 4DK0A 3JCUZ 3SYQA 3JAMN 3UQ8A 3CMEV 2OYQA 2BOBC 1OCCC 2PF4E 3TCUA 2QTSA 2ZQMA 2ZE6A 5LMNB 5IYBO 1GN2A 3RYIA 2VQEO 3UT5B 1WAZA 1BT8A 4IIJA 4LCUC 4MSWC 4I0XA 2NN4A 3SJCC 2BE3A 1FFXB 1ZL8B 3AG7A 1GMGA 2B5UA 4G27B 3H1JH 4JI8O 4MTXA 2VS0A 4J11A 4DXWA 1Z5WA 5DECA 3EXAA 4YJ2A 3U0ZA 2YIBA 3OR6C 1GTOA 5F2VO 1PL0A 4EEQA 4K8ZA 2P7TC 3TJTA 3ZEDA 3IGAC 2DMXA 1F4NA 3NXSA 1W0KG 3APOA 4J7JA 1QLEC 1JFFA 1TA8A 4ZI7A 3F7VC 1O9HA 2JGUA 4LC1A 4JTDB 2CTQA 4JI0B 3CRQA 4PDMA 2IJJA 2CTPA 5E79Z 2ARHA 1TAEA 4I55A 4X9QA 4WFHA 3AG4C 3JATA 4CC5A 2YXHA 5BR8O 5EK0A 1KKCA 1BL8A 1MMMA 2EIMC 2IH1C 5FPOA 3P3PA 4GX2A 4H33A 2EJRA 3JAWB 3RYFA 4UCVA 4RUEA 2KSDA 5LMUB 3ETEA 4DV5B 1TGOA 1OCCB 1L0LH 1WA8B 2WPDG 1FFTB 2GHYA 2PI4A 4CZZA 1EN6A 3ZS8C 3L73H 4QE9A 1EBOA 1S77D 3PN1A 4J10A 3CCUV 2QKCA 1M90W 4BIZA 3ETDA 4DR3B 2HEPA 1HNXO 3F5WC 2E5LO 4HBNA 4MT8A 1XL6A 3T1CA 1XREA 5J2TB 3W7SA 3M8AA 4ZBMA 5JJEB 2IJKA 4I4TA 4JYBA 1PV0A 3CCVV 1HP8A 1KB9F 3RYHB 3K0GA 3FB8C 1WB8A 3QF7A 2Q69A 1R3KC 1D5NA 3CWBH 5C93A 2UUAB 3ZX6A 4TOIA 1GM7A 2JVDA 3N2GA 1DF4A 1YF2A 4WFGA 5BMVB 3FAVB 1SF9A 4PA9A 5JCOC 5FLXN 1S5HC 1XNRO 1QLEB 3CCJV 2ILMA 3K5LA 2EZOA 3IC7A 1X4TA 2PYLA 1YTFD 4J9ZB 5L3GA 3KKYA 3OGCC 4LF4B 1XMQO 4X64O 3SGIA 4GZRB 4P9OA 4RUFA 3AG4B 2JDIG 1AJNA 4P9PA 4Z2WA 3B09A 4OXSA 2CTWA 2EIMB 2BOCC 3STLC 3ZN1A 4GKKO 5LGUA 5FNVA 4YY3B 1EZVH 3BA9A 3G71V 3CJHB 3N27A 1BSMA 5J9PC 2EIKC 4ZOLB 3ZRWB 2YI8A 3T1HB 4CH4A 4O2AA 1Q5OA 1NVPB 2DYSC 2AHZA 3H1HH 3QG5A 1AI7A 4MVOA 2AXTZ 3BFRA 2JIZG 1D2DA 3CCEV 2WLHA 1US6A 2XNDG 1PP9H 4ABMA 3AK3A 1AR5A 2V4DA 2JS3A 1VQLV 1IBKB 3P32A 2GDSA 1PNKA 1QQCA 4DR1O 5EZYA 4JI6B 4DR7O 3K03A 3TETA 5L3FA 1PD3A 3F7YC 3HR0A 4ZIBA 4DO2A 3HKBB 2B9ZA 3R65A 3O65A 3OD4A 3CRCA 1Y67A 2EIJC 4JI4B 3D8CA 4JI7O 5H6QA 4QE7A 4IGGA 3K5OA 3R66A 2QWQB 3FKSG 2GSMB 2EULA 2ZIOA 4FJCC 1JCHA 2F23A 4TSFG 4LH6A 1Q6IA 3OTFA 5KHJA 1H8EG 1TUBA 2AHYA 4IHJB 2GBOA 4F6RA 3QO5A 2PZSA 3K5NA 4X1KB 5IDJA 2LW1A 2YXLA 4J7KA 1K73W 2HJFC 3AG1C 1N4CA 3LUTB 1JPXA 4JI1O 2BTQA 2W6JG 3RBZA 2VQFO 1R1BA 1I94O 5JJJB 1K92A 1XEQA 4K0KO 3OGIB 4W4KA 2F4VO 2HHHO 1IURA 4F4LA 2A0LA 4DR4B 3FD9A 3SDLA 3JASB 3SJQC 2QKSA 2EIKB 3L70H 2LGQA 3UT5A 1S5JA 4CH3A 4X62O 5HFMA 4X66O 1FFXA 2DYSB 4PJ0Z 3CCSV 3BABA 1NQTA 1RPOA 2EX3A 4LP8A 4DR5B 2WSSG 4LFBB 2Q7EA 4NXMB 1R3IC 1SERA 2GTAA 2IJIA 1YEWA 2N05A 2YUAA 3LSSA 1AROP 5C8YB 1XDCA 4JV5B 3SYCA 4LF7B 4BAYA 2N74A 1DGSA 2DOSA 1JFFB 3FYEB 1Y74B 2EIJB 3PJSK 2W6IG 2Q73A 1IBKO 4UV8A 4W4LA 3ABKC 1VP7A 1SZXA 4JI6O 4JYAB 1COWG 3B2EE 4X65O 1IBLO 1WNSA 5L3BA 2YIDA 4JF3A 4DV7B 5CBFA 1P7GA 1L1FA 1IXMA 2ZR2A 1YITV 4FLVA 5KX5B 4DUZO 1Y6XA 5K1PA 4RAIA 4B3RB 3AG1B 2XHBA 3S3WA 1YCIA 3F5TA 2OTJV 1URFA 3GWOA 3VQYA 4H13B 3LNNA 3UM7A 1N8RW 4H0LB 4LR3A 2NR5A 3CCQV 1WA8A 1YXBA 5L3CA 1ZWIC 2Q6AA 1BZKA 1WLEA 4PELA 1R6KA 4UCTA 2KB1A 2LO1A 1LR1A 1H2SB 1VEWA 3CCMV 3AG3C 1YSCA 2BSKA 1Q8IA 4NKGB 1EN5A 4I4TB 1KUQA 3CRRA 4PV1B
chains in the Genus database with same CATH topology
5AG2A 1KKCA 1MMMA 1AR4A 1ZLZA 1WB7A 1BSMA 3MDSA 3RN4A 1MSDA 1ZSPA 2QKAA 1IDSA 3AK1A 1JR9A 1EN6A 1IXBA 3BFRA 4FFKA 4YIPA 2QKCA 3OT7A 3AK3A 1AR5A 1GN2A 1VARA 4YIOA 2CE4A 1XREA 1XDCA 2GDSA 4JZGA 3DC5A 3EVKA 1BT8A 1JA8A 1LUVA 1I0HA 4BR6A 5A9GA 3C3TA 1PL4A 1WB8A 1MA1A 2ADQB 1GN6A 3DC6A 1GN3A 1SZXA 1B06A 1Y67A 1PM9A 1AP5A 3IC9A 4E4EA 1D5NA 4JYYA 2AW9A 1P7GA 1ZTEA 2P4KA 3C3SA 1N0JA 3LSUA 4C7UA 4GUNA 1ZUQA 1QNMA 1XILA 3CEIA 1BS3A 2ADPA 3K9SA 2CDYA 1GN4A 3TJTA 1I08A 1EN4A 4F6EA 3KKYA 1AP6A 1LUWA 3QVNA 4JZ2A 1MNGA 1N0NA 1IX9A 3AK2A 2RCVA 1VEWA 4X9QA 1AVMA 1EN5A 1XUQA 3KDRA 1EM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AG2 A;  1KKC A;  1MMM A;  1AR4 A;  1ZLZ A;  1WB7 A;  1BSM A;  3MDS A;  3RN4 A;  1MSD A;  1ZSP A;  2QKA A;  1IDS A;  3AK1 A;  1JR9 A;  1EN6 A;  1IXB A;  3BFR A;  4FFK A;  4YIP A;  2QKC A;  3OT7 A;  3AK3 A;  1AR5 A;  1GN2 A;  1VAR A;  4YIO A;  2CE4 A;  1XRE A;  1XDC A;  2GDS A;  4JZG A;  3DC5 A;  3EVK A;  1BT8 A;  1JA8 A;  1LUV A;  1I0H A;  4BR6 A;  5A9G A;  3C3T A;  1PL4 A;  1WB8 A;  1MA1 A;  2ADQ B;  1GN6 A;  3DC6 A;  1GN3 A;  1SZX A;  1B06 A;  1Y67 A;  1PM9 A;  1AP5 A;  3IC9 A;  4E4E A;  1D5N A;  4JYY A;  2AW9 A;  1P7G A;  1ZTE A;  2P4K A;  3C3S A;  1N0J A;  3LSU A;  4C7U A;  4GUN A;  1ZUQ A;  1QNM A;  1XIL A;  3CEI A;  1BS3 A;  2ADP A;  3K9S A;  2CDY A;  1GN4 A;  3TJT A;  1I08 A;  1EN4 A;  4F6E A;  3KKY A;  1AP6 A;  1LUW A;  3QVN A;  4JZ2 A;  1MNG A;  1N0N A;  1IX9 A;  3AK2 A;  2RCV A;  1VEW A;  4X9Q A;  1AVM A;  1EN5 A;  1XUQ A;  1EM1 A; 
#chains in the Genus database with same CATH topology
 3E35 A;  4DR4 O;  4FLZ A;  1NTZ H;  3JD3 A;  2FTK A;  2X7R B;  1IZ3 A;  4DV0 O;  1J5E B;  3G6E V;  4J7Z A;  1W2B U;  5JQG A;  4FPP A;  2YIC A;  3DGE A;  5KA6 A;  4FK5 C;  3G67 A;  1F4M A;  5JJN B;  1N34 B;  1ZAU A;  1RP3 B;  2XAG A;  3ZCC A;  3CHX A;  5LP6 A;  3DSQ A;  3DTU B;  4MVQ A;  2ATK C;  4YHH B;  5BMV A;  3FAV A;  2UU9 B;  2WA4 A;  3JSN A;  5B66 Z;  1VQ9 V;  4NXM O;  3EHB B;  2Q7H A;  1S0V A;  3ABK B;  1NJI W;  4U7N A;  5TIS Z;  1AB3 A;  2UXN A;  1SES A;  2E3C A;  3LDD A;  3C3T A;  1K8A W;  1MSW D;  1Y66 A;  4I50 A;  1QR8 A;  1V54 C;  1GN6 A;  2X6B A;  4LF7 O;  1Y76 A;  3KG2 A;  5IJ0 B;  2VQE B;  2V7Q G;  1U96 A;  4O4L A;  3NR7 A;  3STZ C;  4PA4 A;  4JYA O;  1NTM H;  2O57 A;  4DRX B;  1H8H G;  1BGY H;  1GM8 A;  2P4V A;  5FNV B;  4NTW A;  4LNU B;  2P5O A;  3CEI A;  1YZB A;  2ADP A;  4JI8 B;  4FM0 A;  1B6Q A;  2JRI A;  3CJH A;  4MW3 A;  4LFC O;  3QTC A;  4ZOL A;  1H2K A;  3OM3 B;  1AIL A;  2R70 A;  3ZRW A;  4O2A B;  1G1X B;  1FS0 G;  5IE9 A;  1XL4 A;  3ETQ A;  1SZT A;  2F66 C;  3AG3 B;  1MNG A;  4DR2 B;  2QWP B;  4XDL A;  2ZNJ A;  2YIA A;  1D5A A;  3H1L H;  5JH7 A;  1AVM A;  3CPW U;  3B8N A;  4J80 A;  1Q6H A;  4Q6G A;  4K3A A;  5EZY B;  2LFR A;  1YHQ V;  1FXH A;  3ZRX A;  2IM9 A;  2OCH A;  4TQF A;  1FXK C;  3HKB A;  3RN4 A;  3G4S V;  4X1I B;  4JTA B;  4UXN A;  2QE7 G;  5JCO A;  2HP8 A;  1AJP A;  2WLN A;  4UVC A;  2GUZ B;  1N34 O;  1Q81 W;  2Q68 A;  1TUB B;  2X6C A;  3OT7 A;  1WP8 A;  1NU1 H;  1W59 A;  3L72 H;  2VWJ A;  4IHJ A;  2OIG A;  5CA1 B;  1T5E A;  4X1K A;  2UU9 O;  3CB2 A;  2UXD O;  4OX9 O;  1LUV A;  4NVP A;  3X2Q C;  2BTQ B;  4P2Z A;  3T2M A;  1HNX B;  2LW7 A;  5EIB D;  4RQF A;  2E5L B;  1R6T A;  4CS4 A;  1PM9 A;  2P06 A;  4E4E A;  1Q43 A;  1AI5 A;  4JYY A;  2IJH A;  3BPZ A;  1ROP A;  2UXX A;  2P4K A;  2QWO B;  3FB7 C;  3JAS A;  4LFA O;  3CMA V;  4UCR A;  1UJW B;  1NZ6 A;  4WF9 V;  1BQ0 A;  3K9S A;  2UUB O;  4MVR A;  2YI9 A;  2WLM A;  1A32 A;  1FYJ A;  1VQ5 V;  1VQ4 V;  1XNR B;  1LUW A;  2A06 H;  3QVN A;  4WCE V;  3CS5 A;  5LP6 C;  1RM1 C;  1NS1 A;  5C8Y A;  1BCC H;  1FXK B;  4DR2 O;  1XMQ B;  3OFN G;  3VOU A;  4X64 B;  3KDR A;  1EM1 A;  2A9H A;  4QPJ A;  1Y74 A;  3CC2 V;  3QNE A;  3Q4H B;  4JPR A;  4X8A A;  5B3S C;  4PA3 A;  4LF9 O;  1NT2 B;  1N32 O;  1IDS A;  4JAA A;  2AGA A;  3OMA B;  4QPK A;  4DV3 O;  4GKK B;  4FLW A;  3GVM A;  3VQV A;  1JR9 A;  3E2E A;  4B3M O;  5KHK A;  1KKD A;  4XDJ A;  1AI6 A;  3J7A U;  5KX5 A;  5KHI A;  4GT1 A;  1DK1 A;  2QM8 A;  1Q86 W;  3P3N A;  2RNB A;  3X2Q B;  2NNU A;  5IYC O;  4EFB A;  2E75 B;  4KFM A;  4GKJ O;  2CGO A;  5LYJ B;  1GO3 F;  3BVO A;  5E1A C;  1KEC A;  4WFA V;  5LHI A;  2BCC H;  2KG7 B;  3LDC A;  3WB0 A;  3AG2 C;  4B3T O;  4DR1 B;  1F7Y A;  4DR7 B;  1DF5 A;  1TVK B;  2K1E A;  1YJW V;  2BSK B;  3JSL A;  5L3E A;  1K9M W;  5LA6 B;  5CBG A;  3LDE A;  4JI7 B;  3OAA G;  1G8M A;  2DE0 X;  2PUS A;  5JQG B;  4X20 B;  1HWY A;  1L8D A;  1UPG A;  4IYH A;  3J81 N;  3K9A A;  1IJG A;  3E89 A;  4JAU A;  4J9Y B;  5LP6 B;  2Y48 A;  3ZMV A;  3FB6 C;  5IJ9 A;  5IY5 C;  3W7T A;  1XBL A;  4JI1 B;  1YJ9 V;  5ITZ B;  1K5S A;  3E8F A;  5B3S B;  1RPR A;  2VQF B;  2WLL B;  3B77 A;  1I94 B;  4KP4 A;  2L35 A;  4NB5 A;  4K0K B;  2F4V B;  1WB7 A;  4I50 B;  2HHH B;  3ABU A;  1S76 D;  2QKA A;  1Y76 B;  2M6Y A;  1HNZ B;  4FLY A;  2HJD A;  3ZHU A;  5IJ0 A;  4O4L B;  1NI8 A;  4X62 B;  4X66 B;  4B7K A;  5CA0 B;  1G6U A;  4DRX A;  3G6B A;  1H5W A;  2EJ7 A;  2ZT9 B;  5J2U A;  2K9P A;  3K08 A;  4LNU A;  2P22 C;  2GV9 A;  3G80 A;  4GYC B;  2IU3 A;  2PGG A;  5LGT A;  3CCR V;  3AG2 B;  1Q6U A;  1MA1 A;  3DC6 A;  4NR1 A;  2XAH A;  1MOF A;  2ZXW C;  2VRZ A;  1S5L Z;  4BWA A;  2JGD A;  5JH7 B;  4FFB B;  5LL6 Y;  5DN6 G;  1BQZ A;  3O9O A;  1FJG O;  2B1I A;  3N2K B;  4C7U A;  2JS5 A;  2OT5 A;  1IVS A;  4R6Z A;  2RQ6 A;  4X65 B;  3OTO O;  4FZ0 A;  1IBL B;  2CUG A;  1QU7 A;  3H1K H;  1VQP V;  2XT9 A;  1H2N A;  1VF6 C;  4U7O A;  3BRC A;  4DUZ B;  2DJV A;  4X1I A;  2DYR C;  5IY5 B;  5DM6 V;  3JAK B;  1XNQ B;  2GTS A;  1M56 C;  4UVA A;  2GUZ A;  5BY1 A;  2QJ1 A;  2W0F C;  4JTC B;  4NYK A;  4BW9 A;  4X88 A;  5D5P A;  1WP7 A;  1F51 A;  1RFY A;  4I9W A;  2Y69 C;  3VBB A;  5CA1 A;  4QIW F;  4KXR A;  3RYC A;  1AR1 B;  1N33 O;  3SYA A;  4JI2 B;  2EZP A;  3CCL V;  4H44 B;  4WBN A;  3HKE A;  3K3W A;  3TXQ A;  1SQQ H;  3RWR D;  1HNZ O;  4DV0 B;  3B4S A;  1BE3 H;  1GK9 A;  1J95 A;  4FLX A;  5EIB C;  2CGN A;  2HVK C;  3WG7 C;  5IWA O;  4DR6 B;  2LJ2 A;  5L3D A;  5CN0 A;  1Q7Y W;  2MK3 A;  1NBM G;  2IU0 A;  2DWD C;  3K5M A;  2XAQ A;  1JA8 A;  2ZNI A;  2FKX A;  1YVW A;  2WA3 A;  2ADQ B;  3L9D A;  1BHB A;  1K3E A;  4DK1 A;  4R8C A;  2CK3 G;  3IC9 A;  3OMN B;  3WB1 A;  2EBO A;  1G4Y B;  2M7W A;  3QO7 A;  1PKX A;  2YDE A;  4LF6 O;  1QVF U;  4UCS A;  3ZN0 A;  3FFQ A;  1FXK A;  2N04 A;  4XDK A;  3RVZ A;  4UCU A;  5GW7 A;  4Z1M G;  2HVJ C;  3KCY A;  3L74 H;  4YJ3 B;  3KZI Z;  3D3I A;  3ZRV A;  3SPI A;  3OEE G;  3Q4H A;  2CDY A;  4PDR A;  2DYR B;  5KAF Z;  3CXC U;  2Y4U A;  2PI5 A;  5JWP A;  1M56 B;  2A79 B;  1VQM V;  3THO A;  2RJZ A;  1AI4 A;  2DWE C;  4G28 B;  2Y69 B;  4MVM A;  1XMO O;  5EC1 C;  4LFC B;  1NH2 D;  2C2A A;  1DTO A;  1XNQ O;  3MHH C;  3ZMZ A;  1K33 A;  1JOY A;  4KHP O;  3ZMT A;  2YEV B;  3SPH A;  5AG2 A;  2QWN B;  1E79 G;  3ZRS A;  5LYJ A;  4DUY O;  3L75 H;  4TV8 A;  3U11 A;  1VQ7 V;  4D6T H;  2ZM6 O;  2KG7 A;  4QNH B;  2R9R B;  1SQG A;  4HZ3 A;  1NVP D;  1CPY A;  1KBH A;  3HKC A;  1TVK A;  3WG7 B;  4JI2 O;  1QLN A;  5IYD O;  3D36 C;  3OMI B;  3TXS A;  5LA6 A;  3FYI B;  1ENV A;  2X6A A;  5GTH Z;  1DLB A;  5IYZ B;  1NTK H;  3I55 V;  1FD9 A;  1XI1 A;  1N36 O;  4J41 A;  4X20 A;  2Q8V A;  4DR6 O;  1I0H A;  4BR6 A;  1GKF A;  1B06 A;  5IJ9 B;  1M5I A;  2JJ2 G;  1IBM O;  2UUC O;  4JI3 O;  4EFE A;  3ML0 A;  1KMI Z;  2FYU H;  2UXD B;  4OX9 B;  1EZJ A;  1ORQ C;  5LXT B;  1QR9 A;  4U3J A;  2BTO A;  3A0R A;  5ITZ A;  3E8B A;  2WLL A;  3CX5 F;  5LHH A;  2HLD G;  2QM7 A;  1GN4 A;  1PNL A;  3T1Y O;  2B1G A;  4GCZ A;  2IBZ H;  1L0N H;  1EN4 A;  1R3L C;  2FB5 A;  4O2B B;  4LFA B;  1O9G A;  3H9V A;  1THZ A;  2UUB B;  3HPL C;  3RFR A;  5GON B;  1B04 A;  5CA0 A;  1YJN V;  2H8P C;  4BW5 A;  4FVM A;  4TT3 G;  5J2U B;  2FML A;  3JD2 A;  1NR1 A;  5LOV B;  2RCV A;  2ZE7 A;  3SPJ A;  5B1N A;  4FIP C;  1WN7 A;  4HYO A;  4Q20 A;  4NXN O;  1HNW O;  2X0L A;  4JYC A;  4J42 A;  2YXY A;  1FAF A;  1NKD A;  1WPB A;  3A8T A;  1FOU A;  1MSD A;  3WFV A;  3RVY A;  4O4J B;  4X89 A;  5JVD A;  2YSU B;  2XOK G;  2JGD B;  5KMG A;  1E1R G;  4FLT A;  4LWS A;  4FFB A;  3JD0 A;  1M1K W;  3WU2 Z;  4GX5 A;  4N21 A;  1YDX A;  3TK1 A;  5IT9 N;  4LF9 B;  5BZB A;  2Z0A A;  4AI8 A;  1N32 B;  4YIP A;  3N2K A;  2YIB D;  4DV3 B;  2CE4 A;  1VQN V;  2JEU A;  5KHH A;  1R73 A;  4B3M B;  2WLI B;  2LP7 A;  3EVK A;  3JCZ A;  4K8X A;  1KU9 A;  1VQK V;  4LF5 O;  3L71 H;  3GWK C;  3MD0 A;  3JAR B;  4EB6 B;  5DED A;  4JAS A;  3BCC H;  2ZDI A;  4B3S O;  3JAK A;  3TGU H;  1SKV A;  4LF8 B;  4E2L A;  1SQX H;  4GKJ B;  4NTY A;  3MHS C;  1K34 A;  2R72 A;  1SQV H;  2Z5U A;  1R6N A;  1VIB A;  1N0J A;  1V54 B;  4GX0 A;  2CH7 B;  1HW7 A;  3BHP A;  1ZUQ A;  3RYC B;  2XAS A;  4B3T B;  2ITC C;  5EBM C;  4MTG A;  2ZE8 A;  1H2M A;  3W7U A;  1YTF B;  3HB3 B;  5KUM A;  4PI2 A;  3BEH A;  4WBN B;  3HKE B;  4XBF A;  3D3Q A;  2PY5 A;  3K59 A;  4CBC A;  3QO8 A;  5CB4 A;  2H3O A;  1JX9 A;  1P4R A;  4DV1 B;  4FMT A;  1N0N A;  1H38 A;  4BIO A;  5CBH A;  4K35 A;  1V9P A;  3SPC A;  2ZKO A;  1RSO B;  4CH5 A;  2Y0I A;  1AR4 A;  2F95 B;  1K7D A;  2HG5 C;  3K0D A;  1Q3E A;  3AK1 A;  3ZHT A;  4U3F H;  4O4I A;  1KP3 A;  4MVZ A;  3CXH F;  1MZF A;  2H94 A;  4UV9 A;  1BHA A;  1GH6 A;  1VQO V;  4PHZ A;  2ZE5 A;  2E74 B;  4HNA A;  2PYJ A;  1IXB A;  3H01 A;  2KQX A;  1VF6 A;  2XTA A;  2DW4 A;  4YJ3 A;  3E8G A;  1VAR A;  5B1A C;  3VQW A;  3C90 A;  1XOU A;  1YIJ V;  3OW2 U;  2JEX A;  1PL4 A;  2QTO A;  1MG1 A;  2CAZ C;  1KD1 W;  1GN3 A;  3OUF A;  1OCR C;  3A0B Z;  4CS3 A;  3ETG A;  5LBQ A;  2EIN C;  3CE2 A;  4FZ1 A;  1ZTE A;  4DV2 O;  1SC5 B;  3C3S A;  4LF8 O;  2Q67 A;  2YEV A;  4P30 A;  2HKO A;  5H9C A;  4MS2 A;  3JAL B;  4OPA A;  3SR2 C;  4TV8 B;  1LNQ A;  4AQY B;  4O4H B;  4DV4 O;  1MZE A;  5EBW C;  4CC6 A;  4F6E A;  4FM1 A;  1FJG B;  2UXC B;  3K57 A;  1H2G A;  3HKC B;  2VWK A;  3HKD B;  4ASU G;  3OTO B;  1CP9 A;  1SQP H;  1OCO C;  5B1B C;  2R9A A;  2HFE C;  3ZHR A;  1HR0 O;  2Q0O C;  5IYZ A;  4DV1 O;  1P7B A;  3E22 B;  2W0X A;  3I5D A;  1M57 C;  4DW1 A;  4UFZ A;  4Z1V A;  2WLK A;  2QSA A;  4FLU A;  4CH6 A;  1MAB G;  1JJ2 U;  4LH7 A;  3ASN C;  1RM1 B;  5LMN O;  3WB2 A;  3SYO A;  4UVB A;  5LHG A;  2OCC C;  2ZDI C;  2Q4P A;  4U3J B;  4B08 A;  2YC0 A;  5B1A B;  5LXT A;  2ODM A;  3JD4 A;  1N33 B;  5CMU A;  4UB8 Z;  4FFK A;  1JVM A;  1R3J C;  3ABL C;  1CEZ A;  3B40 A;  4PA7 A;  1NR7 A;  3B8M A;  1WJZ A;  3ZMU A;  4OPH A;  1OCR B;  1QVG U;  4UCO A;  4O2B A;  2ITD C;  2D3O W;  2ETN A;  2Y4T A;  1K5Q A;  2V1D A;  2EIN B;  5IWA B;  1F23 A;  2QM4 A;  1AP5 A;  5GON A;  5KUK A;  4D7T A;  3K58 A;  1P84 F;  5LOV A;  3OEH G;  2NLJ C;  2WAM A;  5KLV H;  4X1Y A;  2ZCE A;  3ZJZ A;  2QWR B;  3LSU A;  3RW0 A;  4GUN A;  1XIL A;  1BS3 A;  1NH2 B;  2KKW A;  4JI0 O;  4A5U B;  1OHH G;  4I7Z B;  5CA3 A;  1CXZ B;  2F1M A;  5JVD B;  4LF6 B;  1OCO B;  4O4J A;  5B1B B;  3D36 A;  5KMG B;  1E1Q G;  4LWS B;  2EIL C;  4AQY O;  3CC4 V;  2QDO A;  1SA0 B;  4GX1 A;  3ZBH A;  2UXB B;  2IH3 C;  4JZ2 A;  2XUM A;  2UXC O;  3H1I H;  4PI0 A;  3CC7 V;  5LMU O;  1JJO A;  1M57 B;  4DV5 O;  2OIE A;  1HDJ A;  3CD6 V;  4R7C A;  2WLI A;  5BXZ A;  3CSX A;  4HAM A;  4TV9 A;  3ASN B;  4JGS A;  5KAI Z;  1XMO B;  2P6J A;  3JAR A;  4EB6 A;  2OCC B;  3MDS A;  3W7X A;  4TUY B;  4WFF A;  4DR3 O;  4PDV A;  3ZMS A;  1Z5V A;  4GLX A;  3IAY A;  1SRY A;  4KHP B;  3UCS C;  4CS2 A;  3ABM C;  2F93 B;  3APQ A;  3ABL B;  3J80 N;  1TUE B;  5GTI Z;  4DUY B;  3ICX A;  4ICG A;  4TQD A;  4ZKI A;  2F43 G;  2CH7 A;  5EYP A;  3KCX A;  2ZM6 B;  3JD1 A;  4RQE A;  4DV6 B;  1M93 A;  4YIO A;  3W7W A;  1KP2 A;  4ZHQ B;  3BY6 A;  4MVU A;  2UUA O;  3EFF K;  4IT5 A;  3A2F A;  3DXR B;  1Z2G A;  1I5X A;  4OGQ B;  5CB4 B;  2AZ2 A;  5K1X A;  1N36 B;  2G38 A;  3OE7 G;  2QGN A;  3UO3 A;  2LGW A;  3BA8 A;  3CRM A;  5LGN A;  4LF4 O;  1IBM B;  1RSO A;  1Y4M A;  2UUC B;  4JI3 B;  1V55 C;  2ZXW B;  3RYI B;  3LNM B;  3T4Z A;  4G2K A;  2EIL B;  1EFR G;  4IIJ B;  3P30 A;  4I0X B;  1SET A;  4O4I B;  1AP6 A;  5EBL C;  4DW0 A;  1ZL8 A;  4HNA B;  4YY3 O;  4B7E A;  1K97 A;  2WLJ A;  1I5Y A;  2ZR3 A;  3T1Y B;  4JI5 B;  1FXV A;  3AK2 A;  1GAX A;  2Q0A A;  2LQT A;  3T1H O;  2UXB O;  4YJ2 B;  4QJF B;  1FPO A;  3M99 B;  3OUS A;  2P67 A;  1M4U A;  3UKM A;  3ABM B;  3E86 A;  4JAV A;  4YXW G;  2WWW A;  4ZI7 B;  3AEI A;  3I56 V;  1JMK C;  2L6L A;  3FX7 A;  1WPX A;  4NXN B;  1HNW B;  4MW8 A;  4MTF A;  1XQ8 A;  1M9N A;  4I55 B;  4JI4 O;  4NTX A;  3JAL A;  3JAT B;  2Q9L A;  2Y0P A;  4JZG A;  3DC5 A;  1UFI A;  4AIL C;  4O4H A;  4TWK A;  1OCZ C;  2ZIN A;  3CP1 A;  1KYO F;  4DV6 O;  2AZ0 A;  1SQF A;  2RDC A;  2CTR A;  3RYF B;  5A9G A;  1AJQ A;  3JAW A;  2PTM A;  3HKD A;  3IFX A;  4N23 A;  3SYP A;  4IYI A;  2Z3Y A;  4UUJ C;  3SJB C;  3SJA C;  4KL1 A;  1KQS U;  3RT3 C;  4LF5 B;  1V55 B;  4LBE C;  1GM9 A;  1QBZ A;  4RWU A;  1QNM A;  4B3S B;  3E22 A;  3OR7 C;  2ZIM A;  1H2L A;  1OJH A;  5J2T A;  2D2C B;  5HFL A;  3ZHQ A;  5FL7 G;  2QR4 A;  1OZ0 A;  1QCE A;  3RYH A;  3ASO C;  2OTL V;  3S3X A;  4I9Q A;  3IJ4 A;  3MAQ A;  5KA5 A;  4WFB V;  1PPJ H;  2ZD9 A;  4L8J A;  5EC2 C;  1VF5 B;  1JQ0 A;  4MTO A;  1K4D C;  3N2G B;  1VQ6 V;  4PD4 F;  1XUQ A;  2Q5Z A;  1XHX A;  4JI5 O;  3VQX A;  4KUM A;  4DR5 O;  2DN9 A;  4PDL A;  1Q90 D;  4PA6 A;  4LFB O;  5FPR A;  1GRJ A;  1VQ8 V;  4AHC A;  3CRA A;  5H5N A;  1B3Q A;  4EKW A;  2P90 A;  2Q7G A;  3FB5 C;  4MVS A;  3GB7 C;  4JV5 O;  3ZIA G;  4X1Y B;  1SS3 A;  3A0H Z;  1K4C C;  1I7F A;  4IL6 Z;  1OCZ B;  2QEX V;  2A3Q A;  3ABT A;  4DV7 O;  1BMF G;  5B5E Z;  3BAA A;  1U97 A;  4I5S A;  1VMG A;  4WFE A;  2DQ3 A;  3LSQ A;  1PNM A;  4B3R O;  3CYO A;  4D7S A;  1SA0 A;  1Q82 W;  2MW2 B;  3K06 A;  2R9I A;  1S72 V;  2AW9 A;  2XAJ A;  2YS8 A;  4R50 A;  1ZX3 A;  2E76 B;  1VF7 A;  3UO2 A;  2HR3 A;  2RMK B;  4TV9 B;  3U10 A;  4BIU A;  1W0J G;  5H6R A;  5D5Q A;  1YI2 V;  1XHZ A;  5B1O A;  2JK5 C;  3ASO B;  1P49 A;  4TUY A;  1FKA O;  1I08 A;  4UB6 Z;  3K79 A;  4DV2 B;  1S3J A;  3E8H A;  5A2Q N;  4L87 A;  2OWO A;  2IW5 A;  3T4D A;  4RO2 A;  2FL4 A;  2QA4 V;  3SPG A;  4DYL A;  1X59 A;  1OV9 A;  2A7W A;  1J5E O;  1IX9 A;  3RGB A;  4H37 A;  5EYP B;  5BR8 B;  4DV4 B;  3K04 A;  2XAF A;  4FM2 A;  2LFS A;  5H2F Z;  3JYC A;  4ZHQ A;  2RN9 A;  1JNB A;  1KC8 W;  3ZHV A;  3E83 A;  4F6R B;  3DXR A;  1ZLZ A;  5KHG A;  3ZHS A;  4YHH O;  3M7M X;  1ZSP A;  1QHT A;  1HR0 B;  2DQ0 A;  4QGP A;  2JJ1 G;  1SQB H;  4DK0 A;  3JCU Z;  3SYQ A;  3JAM N;  3UQ8 A;  3CME V;  2OYQ A;  2BOB C;  1OCC C;  2PF4 E;  3TCU A;  2QTS A;  2ZQM A;  2ZE6 A;  5LMN B;  5IYB O;  1GN2 A;  3RYI A;  2VQE O;  3UT5 B;  1WAZ A;  1BT8 A;  4IIJ A;  4LCU C;  4MSW C;  4I0X A;  2NN4 A;  3SJC C;  2BE3 A;  1FFX B;  1ZL8 B;  3AG7 A;  1GMG A;  2B5U A;  4G27 B;  3H1J H;  4JI8 O;  4MTX A;  2VS0 A;  4J11 A;  4DXW A;  1Z5W A;  5DEC A;  3EXA A;  4YJ2 A;  3U0Z A;  2YIB A;  3OR6 C;  1GTO A;  5F2V O;  1PL0 A;  4EEQ A;  4K8Z A;  2P7T C;  3TJT A;  3ZED A;  3IGA C;  2DMX A;  1F4N A;  3NXS A;  1W0K G;  3APO A;  4J7J A;  1QLE C;  1JFF A;  1TA8 A;  4ZI7 A;  3F7V C;  1O9H A;  2JGU A;  4LC1 A;  4JTD B;  2CTQ A;  4JI0 B;  3CRQ A;  4PDM A;  2IJJ A;  2CTP A;  5E79 Z;  2ARH A;  1TAE A;  4I55 A;  4X9Q A;  4WFH A;  3AG4 C;  3JAT A;  4CC5 A;  2YXH A;  5BR8 O;  5EK0 A;  1KKC A;  1BL8 A;  1MMM A;  2EIM C;  2IH1 C;  5FPO A;  3P3P A;  4GX2 A;  4H33 A;  2EJR A;  3JAW B;  3RYF A;  4UCV A;  4RUE A;  2KSD A;  5LMU B;  3ETE A;  4DV5 B;  1TGO A;  1OCC B;  1L0L H;  1WA8 B;  2WPD G;  1FFT B;  2GHY A;  2PI4 A;  4CZZ A;  1EN6 A;  3ZS8 C;  3L73 H;  4QE9 A;  1EBO A;  1S77 D;  3PN1 A;  4J10 A;  3CCU V;  2QKC A;  1M90 W;  4BIZ A;  3ETD A;  4DR3 B;  2HEP A;  1HNX O;  3F5W C;  2E5L O;  4HBN A;  4MT8 A;  1XL6 A;  3T1C A;  1XRE A;  5J2T B;  3W7S A;  3M8A A;  4ZBM A;  5JJE B;  2IJK A;  4I4T A;  4JYB A;  1PV0 A;  3CCV V;  1HP8 A;  1KB9 F;  3RYH B;  3K0G A;  3FB8 C;  1WB8 A;  3QF7 A;  2Q69 A;  1R3K C;  1D5N A;  3CWB H;  5C93 A;  2UUA B;  3ZX6 A;  4TOI A;  1GM7 A;  2JVD A;  3N2G A;  1DF4 A;  1YF2 A;  4WFG A;  5BMV B;  3FAV B;  1SF9 A;  4PA9 A;  5JCO C;  5FLX N;  1S5H C;  1XNR O;  1QLE B;  3CCJ V;  2ILM A;  3K5L A;  2EZO A;  3IC7 A;  1X4T A;  2PYL A;  1YTF D;  4J9Z B;  5L3G A;  3KKY A;  3OGC C;  4LF4 B;  1XMQ O;  4X64 O;  3SGI A;  4GZR B;  4P9O A;  4RUF A;  3AG4 B;  2JDI G;  1AJN A;  4P9P A;  4Z2W A;  3B09 A;  4OXS A;  2CTW A;  2EIM B;  2BOC C;  3STL C;  3ZN1 A;  4GKK O;  5LGU A;  5FNV A;  4YY3 B;  1EZV H;  3BA9 A;  3G71 V;  3CJH B;  3N27 A;  1BSM A;  5J9P C;  2EIK C;  4ZOL B;  3ZRW B;  2YI8 A;  3T1H B;  4CH4 A;  4O2A A;  1Q5O A;  1NVP B;  2DYS C;  2AHZ A;  3H1H H;  3QG5 A;  1AI7 A;  4MVO A;  2AXT Z;  3BFR A;  2JIZ G;  1D2D A;  3CCE V;  2WLH A;  1US6 A;  2XND G;  1PP9 H;  4ABM A;  3AK3 A;  1AR5 A;  2V4D A;  2JS3 A;  1VQL V;  1IBK B;  3P32 A;  2GDS A;  1PNK A;  1QQC A;  4DR1 O;  5EZY A;  4JI6 B;  4DR7 O;  3K03 A;  3TET A;  5L3F A;  1PD3 A;  3F7Y C;  3HR0 A;  4ZIB A;  4DO2 A;  3HKB B;  2B9Z A;  3R65 A;  3O65 A;  3OD4 A;  3CRC A;  1Y67 A;  2EIJ C;  4JI4 B;  3D8C A;  4JI7 O;  5H6Q A;  4QE7 A;  4IGG A;  3K5O A;  3R66 A;  2QWQ B;  3FKS G;  2GSM B;  2EUL A;  2ZIO A;  4FJC C;  1JCH A;  2F23 A;  4TSF G;  4LH6 A;  1Q6I A;  3OTF A;  5KHJ A;  1H8E G;  1TUB A;  2AHY A;  4IHJ B;  2GBO A;  4F6R A;  3QO5 A;  2PZS A;  3K5N A;  4X1K B;  5IDJ A;  2LW1 A;  2YXL A;  4J7K A;  1K73 W;  2HJF C;  3AG1 C;  1N4C A;  3LUT B;  1JPX A;  4JI1 O;  2BTQ A;  2W6J G;  3RBZ A;  2VQF O;  1R1B A;  1I94 O;  5JJJ B;  1K92 A;  1XEQ A;  4K0K O;  3OGI B;  4W4K A;  2F4V O;  2HHH O;  1IUR A;  4F4L A;  2A0L A;  4DR4 B;  3FD9 A;  3SDL A;  3JAS B;  3SJQ C;  2QKS A;  2EIK B;  3L70 H;  2LGQ A;  3UT5 A;  1S5J A;  4CH3 A;  4X62 O;  5HFM A;  4X66 O;  1FFX A;  2DYS B;  4PJ0 Z;  3CCS V;  3BAB A;  1NQT A;  1RPO A;  2EX3 A;  4LP8 A;  4DR5 B;  2WSS G;  4LFB B;  2Q7E A;  4NXM B;  1R3I C;  1SER A;  2GTA A;  2IJI A;  1YEW A;  2N05 A;  2YUA A;  3LSS A;  1ARO P;  5C8Y B;  1XDC A;  4JV5 B;  3SYC A;  4LF7 B;  4BAY A;  2N74 A;  1DGS A;  2DOS A;  1JFF B;  3FYE B;  1Y74 B;  2EIJ B;  3PJS K;  2W6I G;  2Q73 A;  1IBK O;  4UV8 A;  4W4L A;  3ABK C;  1VP7 A;  1SZX A;  4JI6 O;  4JYA B;  1COW G;  3B2E E;  4X65 O;  1IBL O;  1WNS A;  5L3B A;  2YID A;  4JF3 A;  4DV7 B;  5CBF A;  1P7G A;  1L1F A;  1IXM A;  2ZR2 A;  1YIT V;  4FLV A;  5KX5 B;  4DUZ O;  1Y6X A;  5K1P A;  4RAI A;  4B3R B;  3AG1 B;  2XHB A;  3S3W A;  1YCI A;  3F5T A;  2OTJ V;  1URF A;  3GWO A;  3VQY A;  4H13 B;  3LNN A;  3UM7 A;  1N8R W;  4H0L B;  4LR3 A;  2NR5 A;  3CCQ V;  1WA8 A;  1YXB A;  5L3C A;  1ZWI C;  2Q6A A;  1BZK A;  1WLE A;  4PEL A;  1R6K A;  4UCT A;  2KB1 A;  2LO1 A;  1LR1 A;  1H2S B;  1VEW A;  3CCM V;  3AG3 C;  1YSC A;  2BSK A;  1Q8I A;  4NKG B;  1EN5 A;  4I4T B;  1KUQ A;  3CRR A;  4PV1 B; 
#chains in the Genus database with same CATH homology
 5AG2 A;  1KKC A;  1MMM A;  1AR4 A;  1ZLZ A;  1WB7 A;  1BSM A;  3MDS A;  3RN4 A;  1MSD A;  1ZSP A;  2QKA A;  1IDS A;  3AK1 A;  1JR9 A;  1EN6 A;  1IXB A;  3BFR A;  4FFK A;  4YIP A;  2QKC A;  3OT7 A;  3AK3 A;  1AR5 A;  1GN2 A;  1VAR A;  4YIO A;  2CE4 A;  1XRE A;  1XDC A;  2GDS A;  4JZG A;  3DC5 A;  3EVK A;  1BT8 A;  1JA8 A;  1LUV A;  1I0H A;  4BR6 A;  5A9G A;  3C3T A;  1PL4 A;  1WB8 A;  1MA1 A;  2ADQ B;  1GN6 A;  3DC6 A;  1GN3 A;  1SZX A;  1B06 A;  1Y67 A;  1PM9 A;  1AP5 A;  3IC9 A;  4E4E A;  1D5N A;  4JYY A;  2AW9 A;  1P7G A;  1ZTE A;  2P4K A;  3C3S A;  1N0J A;  3LSU A;  4C7U A;  4GUN A;  1ZUQ A;  1QNM A;  1XIL A;  3CEI A;  1BS3 A;  2ADP A;  3K9S A;  2CDY A;  1GN4 A;  3TJT A;  1I08 A;  1EN4 A;  4F6E A;  3KKY A;  1AP6 A;  1LUW A;  3QVN A;  4JZ2 A;  1MNG A;  1N0N A;  1IX9 A;  3AK2 A;  2RCV A;  1VEW A;  4X9Q A;  1AVM A;  1EN5 A;  1XUQ A;  3KDR A;  1EM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...