3TJTA

Crystal structure analysis of the superoxide dismutase from clostridium difficile
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
202
structure length
202
Chain Sequence
b'NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
molecule tags Oxidoreductase
source organism Clostridium difficile
publication title Crystal Structure of the superoxide dismutase from Clostridium difficile
rcsb
total genus 74
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3tjtA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3tjtA02
1GN3A 1PM9A 3EVKA 1EM1A 1GN2A 2CDYA 1MMMA 1LUVA 1N0JA 3AK3A 1WB8A 1JA8A 1B06A 1GN6A 4F6EA 4JYYA 1LUWA 1Y67A 1AR4A 2AW9A 4YIPA 1GN4A 1AP5A 1AVMA 1KKCA 3BFRA 3K9SA 1PL4A 3C3SA 1I08A 2ADQB 4GUNA 1XUQA 1I0HA 3DC5A 4E4EA 5AG2A 1ZUQA 2CE4A 3RN4A 4YIOA 1QNMA 4C7UA 4FFKA 5A9GA 3MDSA 1ZLZA 1XILA 3C3TA 3AK1A 1N0NA 1VEWA 3TJTA 1P7GA 2P4KA 2ADPA 3KKYA 1ZSPA 1MNGA 3IC9A 1EN4A 1AP6A 3DC6A 1ZTEA 4JZGA 1BS3A 3QVNA 3AK2A 2GDSA 4JZ2A 2QKCA 1WB7A 4BR6A 1XDCA 1EN5A 1MSDA 3OT7A 4X9QA 1XREA 1BT8A 1SZXA 1IDSA 3LSUA 1MA1A 2RCVA 2QKAA 1D5NA 1EN6A 1BSMA 1IXBA 1JR9A 1AR5A 1VARA 3CEIA 1IX9A
chains in the Genus database with same CATH superfamily
3IC7A 1ZL8A 3WB1A 1H2NA 4PA4A 3H1KH 1VQKV 5IY5B 4DUYB 3FAVA 3AK3A 3OMAB 5LMNO 4DV7B 1WB8A 4ZIBA 4HNAB 4DR3B 3SJCC 4JTDB 5EK0A 1BMFG 4PJ0Z 1DF4A 2ITCC 5LHHA 3K0GA 2X6BA 5LXTA 1KKCA 1VIBA 5EC1C 3UKMA 3QF7A 2EIJB 1P49A 2EIKC 3JD3A 2F1MA 2DN9A 2EZOA 1ENVA 5IT9N 1R3KC 3HKEA 4BAYA 4WBNB 2QSAA 3JCZA 3FYEB 1K5QA 4TOIA 1XQ8A 3MD0A 2UXBB 1XNRO 4NR1A 2FL4A 2KSDA 3B77A 3LUTB 4Z1MG 1O9GA 1ORQC 2GHYA 1YXBA 4J7KA 4P9PA 2JGDA 1GTOA 2CGOA 2PY5A 4X20B 4YY3O 3KKYA 4UXNA 4U3FH 4TUYB 4PA9A 1EN4A 1SESA 2JJ1G 2XAGA 3JD4A 2YXYA 1SQVH 1FJGB 5LHGA 3UM7A 4BIUA 1CEZA 5B5EZ 1H2LA 5C93A 2IU3A 4PDVA 2DOSA 1U97A 3OUSA 3JCUZ 4KL1A 3CCRV 2QM7A 3N27A 5EBLC 3FAVB 2DW4A 4B3SO 1DGSA 2RCVA 2K9PA 2QKAA 2WA3A 3LDDA 3PJSK 3SYCA 3U10A 4QNHB 5CBHA 4YJ3B 1K34A 3MHHC 1FFTB 3SR2C 2ZR2A 4UVCA 3EVKA 5JH7A 1SZTA 1VQ9V 4HZ3A 4TQFA 4DV2B 4QPJA 1QCEA 4JI1O 5KMGA 3OEEG 1YCIA 2OYQA 1L1FA 3L9DA 3B09A 3ICXA 3P3PA 1PNKA 1PNMA 4R7CA 1AI4A 3AG3B 4Z2WA 4X1IA 1XMOB 3IAYA 4Z1VA 4K3AA 3SGIA 3BFRA 1DK1A 3C3SA 3O65A 4QJFB 2UU9O 2L35A 3ZHVA 3H01A 4MS2A 2OTJV 3CE2A 3A0RA 4I0XA 1RSOB 2JGUA 2F93B 3H1LH 5J2TA 1KP3A 1Z2GA 2X6CA 1Q8IA 4JV5B 1ZWIC 2GTAA 3X2QB 1XILA 5CB4A 4LF6O 4ASUG 5E79Z 4AQYO 4I9WA 4PDLA 1F23A 4JV5O 3G6BA 1G1XB 1JJOA 1YTFB 1QR9A 2ZDIA 2YIBA 2Q7HA 2Q4PA 3W7XA 4EB6A 4J41A 5L3CA 1K92A 3AG1B 5CMUA 5F2VO 1VQLV 2EILB 2HJDA 3BCCH 3SYAA 1EN5A 2KB1A 1TA8A 2A0LA 5B1AC 2UXBO 1IDSA 1VF6A 3VBBA 1JJ2U 3K04A 5J2UA 4OPAA 1IJGA 1BQZA 4DRXA 5B1BB 4NYKA 3D3QA 3JD0A 3KG2A 1N4CA 3CCQV 3FKSG 4MTGA 1AR5A 2D3OW 3HKDB 3TK1A 1RPRA 2ZE7A 5BR8O 1M56C 1M57B 4HBNA 5CBFA 5KAFZ 1F7YA 1FPOA 3ETGA 2IW5A 4LF9O 2DWEC 3S3WA 4DR3O 3OM3B 1NBMG 2WWWA 2E5LO 4UVBA 2WLLA 2LO1A 5EBWC 3GWKC 1QQCA 1K5SA 3ETEA 2HVKC 1H2GA 2NR5A 5KLVH 5LYJA 3GWOA 2CE4A 1JCHA 3RYFA 5HFMA 3HKDA 3DSQA 3DXRB 1N32O 5LMUO 3K03A 5FNVA 3AK1A 2PTMA 4IGGA 1FD9A 3ZCCA 3RVZA 4LP8A 4CZZA 1I5YA 5J2TB 2KG7A 1OCZB 2KQXA 5JCOC 4LFCO 5JJJB 4YY3B 3N2GA 4WFAV 3IC9A 4GX0A 2UXDO 1N33O 2BSKB 2IM9A 1W59A 1E79G 4FIPC 3QVNA 2E75B 2KG7B 3DGEA 1M9NA 3ZMZA 4LF4B 2P6JA 1FXHA 2PUSA 4UUJC 4U3JB 2LW7A 5BY1A 3W7TA 4UCTA 4WF9V 1Q7YW 4PHZA 4F4LA 2KKWA 3E89A 3A8TA 4JAUA 2ZINA 1H2SB 1QU7A 3B4SA 4U7OA 1Y76A 3SJAC 3ABLC 1YSCA 2Z3YA 1W0JG 4UCVA 3B8NA 2LW1A 3SDLA 1TVKA 2CUGA 4YXWG 3HKCA 4DUYO 2ZR3A 1N34O 4CH6A 4FLZA 1H2MA 3K5LA 1YDXA 3T1YO 1E1RG 3T1CA 4FK5C 2P67A 1COWG 3T1HB 1NH2B 3K08A 1NR1A 1NTMH 1Y67A 2FKXA 3B40A 2Q7GA 1GN4A 1AP5A 1UPGA 4UCRA 1PL0A 1Q90D 2P7TC 2ZM6B 1YITV 4Q6GA 5LA6A 5LP6C 2B1IA 4I55B 1NKDA 2M6YA 2LGWA 2OT5A 3CRCA 4XDJA 2WA4A 3NR7A 5JH7B 1R73A 1F4MA 2HVJC 3AG4C 1NVPB 3BABA 1QNMA 2RMKB 2EILC 4FFKA 2JGDB 2CTWA 4LWSB 4N23A 3J80N 4B3MO 2Q67A 3K3WA 3LNMB 1URFA 1XI1A 2Q6AA 2HR3A 3U0ZA 1XOUA 2ZNIA 2D2CB 5DN6G 4FLUA 2Y69B 4TWKA 3HKEB 1FXKA 2XAQA 1H2KA 2DWDC 5J9PC 3BPZA 3T2MA 3CCMV 5LGNA 2FMLA 3JARA 1FOUA 1IXMA 1AI7A 4FM2A 4UV8A 2VRZA 4F6RB 1L0NH 4O4LA 5EBMC 5B3SB 3F5TA 3GVMA 5JWPA 2QA4V 3CC2V 4LBEC 3OT7A 4X62B 2Q8VA 1JX9A 2UXCB 4CC6A 3CXHF 3FB5C 4DV3B 4R8CA 2BOBC 4DK1A 2HLDG 3OMNB 1Y4MA 2VWJA 1M5IA 2MK3A 1RP3B 3BEHA 2QKSA 4GKJO 3IGAC 1JA8A 2OIEA 2F23A 1JFFB 4CS3A 5CA0A 4L8JA 1TVKB 3IFXA 4DV2O 1SQQH 3ZHRA 3ML0A 4JI8O 3JAMN 4DV1O 4RWUA 3M99B 4J7ZA 4UV9A 1UJWB 2UUAB 4HNAA 3RGBA 3BA9A 2ADQB 2YS8A 3D36A 1M56B 5JJEB 3CMAV 4WFEA 2A06H 2WLKA 4B3SB 4XBFA 2Q9LA 4DW0A 3VOUA 3OE7G 5EC2C 5LMUB 2YI8A 4U3JA 3ZMUA 3ZRXA 2R9AA 1Y76B 3ABMB 1IBKO 2ADPA 3OAAG 4H44B 3P32A 1FXKB 4NB5A 3JASA 3E83A 4PV1B 1TUBA 2DMXA 3T4DA 4UFZA 2V4DA 2MW2B 2N05A 3E86A 2QKCA 1S72V 1NI8A 4TQDA 1Q6IA 1S77D 3CB2A 5C8YA 4NVPA 4DR7B 4CH5A 4FPPA 1Q81W 4RAIA 3IJ4A 4LF5B 4AI8A 5BR8B 1WA8A 3UO3A 1HNZO 1VQNV 3LDEA 5KAIZ 4J9YB 1JOYA 1HNZB 5GTHZ 3CEIA 2C2AA 1GM8A 2CDYA 2RN9A 5B1OA 1CXZB 2ETNA 4P30A 2M7WA 4KHPO 4I50B 5B1NA 1ZL8B 5DM6V 4DR4O 5JQGA 2AW9A 3CCEV 4IHJA 5BMVB 4QE9A 4K8ZA 3L74H 2QGNA 1N36B 2HHHO 1YF2A 4ZI7B 1KMIZ 3FYIB 5J2UB 4AQYB 1HNWO 1SERA 2FTKA 3BY6A 4TV8B 4X1YB 2Q0OC 2JJ2G 4JI7O 3CYOA 3K5MA 1J95A 2AHZA 3OD4A 3J7AU 1RM1B 4PA7A 3C90A 2WLIB 2WAMA 4NXNB 5HFLA 1YVWA 5BXZA 3VQVA 2WLNA 2UU9B 1GAXA 2N74A 2QWQB 4FLVA 2UUAO 1AP6A 1BE3H 1JMKC 5LP6B 1V55C 3QO7A 1OCCB 1Q6UA 3AG2C 3ASOB 4DV5O 4GKKO 1KBHA 1YZBA 4QE7A 4BW9A 5JVDA 2YXLA 5TISZ 1OV9A 1B3QA 1WJZA 4X1IB 3SPGA 1NR7A 3RWRD 4DR1B 3NXSA 4U7NA 4YHHO 3I5DA 3RYIB 1P84F 1HDJA 2QTOA 3VQWA 1Q6HA 3ZIAG 4TV8A 2EINC 1P4RA 2QM8A 3F5WC 1EZVH 2Y48A 3PN1A 3B8MA 1RFYA 4O4JB 1SA0B 5H5NA 3P30A 1W0KG 5JQGB 1PM9A 4AILC 4X62O 1MMMA 3B2EE 1YTFD 4JYYA 3ZRVA 4JTAB 4NXMB 4MSWC 1R3JC 1LUWA 2IBZH 3UQ8A 3W7SA 2HHHB 2GUZB 3LSSA 4K0KB 4N21A 4D6TH 1XL4A 1R3LC 3JD1A 1HNXB 1Q86W 3BAAA 1NT2B 5EYPB 1Q82W 3DC5A 4JI3B 3UCSC 1SS3A 4JI0O 4AHCA 4B3TO 3ZRWA 1THZA 5C8YB 1Z5WA 4EFEA 3L72H 3GB7C 1VMGA 2A3QA 1ROPA 3LNNA 1N0NA 1VEWA 2P90A 3E35A 2P4KA 2F4VO 3CCJV 3BA8A 4MVOA 3JASB 4JYBA 1YJWV 3WG7C 4DR2B 2BOCC 2LJ2A 2H3OA 1BL8A 1FXKC 4WFBV 3ZN0A 2GDSA 2V7QG 2ZE8A 2EINB 3AG2B 1YEWA 3ASOC 4LWSA 5L3EA 4UB6Z 1A32A 4PI0A 1VQMV 2ILMA 4FLWA 2ZE6A 3SPJA 5B66Z 1KD1W 1QHTA 2AZ0A 4PA6A 1S5LZ 2A9HA 4X20A 2FYUH 5B1AB 5LA6B 2VS0A 2Z0AA 2HEPA 1D5NA 1JR9A 5B1BC 1IX9A 2HKOA 4J42A 3LDCA 2Q5ZA 3RYHA 2WSSG 1OCRB 1U96A 1CPYA 3ZX6A 1XMQO 1KC8W 5ITZB 3H9VA 2HG5C 4EKWA 2QWNB 4DXWA 1R3IC 4KP4A 2EIJC 3CC7V 4P9OA 4O2BA 4TV9A 4B7EA 1XEQA 4G2KA 3G6EV 4DV1B 2CK3G 4JI8B 4E2LA 4MVRA 2PI5A 4E4EA 1PPJH 1TGOA 4D7SA 1AR1B 1ZX3A 1FFXB 1H8EG 3ZS8C 4Q20A 4NKGB 1VF7A 1S0VA 1XL6A 2EZPA 4DV3O 4YJ2A 3OEHG 4JI4B 3CRMA 2VQEB 3D8CA 1Q5OA 3AEIA 2JEUA 2UXCO 1PP9H 3ZMSA 4GYCB 1SKVA 1WPXA 1K97A 1AI6A 2OCCB 4BIZA 4MVUA 2DJVA 5KHGA 2W0XA 1Y6XA 4LF9B 2XAJA 1MSDA 4LFAO 1IBMB 3M8AA 3N2KA 1XREA 2QJ1A 4JF3A 4ZI7A 2YSUB 3CCUV 4I4TB 1IZ3A 1MA1A 1S3JA 2DYSB 1BSMA 4K35A 4ZHQB 1VQ4V 1GN3A 2OWOA 3APOA 3ZRWB 4K8XA 2FB5A 3ZJZA 3OW2U 1PKXA 5LBQA 1M57C 1N0JA 3OFNG 5IJ9A 3ABMC 1SQPH 3CP1A 3E8FA 3STZC 1GN6A 5LOVA 3G80A 1IBLB 4JI3O 3JALA 5IDJA 2F43G 3JATA 2GUZA 4GX1A 1VF5B 3P3NA 5FLXN 3CX5F 4X89A 2OTLV 3QO8A 4RO2A 4A5UB 3A2FA 4I4TA 3WG7B 4O4IB 4LFAB 1KQSU 2YI9A 4G28B 2ITDC 2P4VA 4BWAA 5LGTA 5L3GA 1XHZA 3JSLA 4LF6B 1VP7A 4FLYA 4OPHA 2RQ6A 4BW5A 4O2AA 1ZUQA 3MAQA 1H38A 2A79B 4C7UA 5KX5B 3OGCC 4X66B 3Q4HB 3QO5A 4DR6B 4PD4F 5IYBO 2LFRA 4KUMA 1P7GA 2YXHA 3RFRA 3SYPA 3K58A 2PGGA 3L71H 2EJRA 3K9AA 3N2GB 2ARHA 5KHIA 1QLEB 4J7JA 2R9IA 3JAKA 1WN7A 4FM1A 3AK2A 3D36C 2UXXA 1VQ7V 4GX5A 1KP2A 4YHHB 5FL7G 4JZ2A 2PYLA 1NU1H 4GLXA 1BZKA 2CH7A 1DTOA 2P22C 4UB8Z 1M93A 4JI1B 4B7KA 1XDCA 4FZ0A 4LF4O 3JAKB 1YJNV 5EZYB 4CS4A 3I56V 1E1QG 2QTSA 3CCSV 4X1YA 4NTYA 4R50A 4DV0O 4LH6A 2O57A 3ABKB 2Y4TA 4O4HB 4ZHQA 4LFBB 5IWAB 4OGQB 4LF7B 2EJ7A 3CCLV 3CS5A 1LUVA 3EXAA 5E1AC 3RYCB 2JIZG 1K4DC 3E22A 3KCYA 2ZXWC 1V54B 2E3CA 4MTXA 3F7YC 5KHJA 3HPLC 4YJ3A 4DW1A 3FFQA 4YIPA 4H13B 2W6IG 3T4ZA 3H1JH 3JATB 1L8DA 4J11A 3ASNB 3E2EA 3R66A 3MHSC 1YI2V 4LR3A 1Q3EA 5AG2A 1QVGU 3CPWU 5H2FZ 2CTPA 1T5EA 4OXSA 3CRRA 1NJIW 3TETA 3KDRA 3EFFK 1KB9F 2OCHA 4FLXA 2AZ2A 2F4VB 1GO3F 2QDOA 4IIJA 1XBLA 1VQPV 3KCXA 2IJKA 1ZTEA 4LF5O 3SPHA 2XTAA 3JAWA 2P5OA 1FAFA 3FB7C 3FB8C 2YIAA 1GH6A 3E8GA 2EX3A 3HKBB 3W7WA 5LMNB 4DV7O 1TUBB 4DR6O 2NN4A 1S76D 2OCCC 5CA0B 1JFFA 2AHYA 4D7TA 1BT8A 1RSOA 5EYPA 4X65O 5CA3A 4I55A 1MZEA 4DV6B 3RYHB 1F51A 5LXTB 1IBKB 4J80A 4NXMO 2UUBO 1M4UA 2EIMB 1F4NA 4MW3A 1PD3A 4J9ZB 4LH7A 5B3SC 1MZFA 2VQFO 1K73W 1WP7A 3QTCA 4F6EA 3E8HA 1KU9A 3TXSA 4LNUB 2NNUA 1CP9A 1QLNA 4FMTA 1AVMA 1K4CC 4MVMA 3ZBHA 1HWYA 3AG3C 2YUAA 1JVMA 1AROP 4HAMA 2R72A 1AJQA 1AB3A 1I0HA 3I55V 3H1IH 4KFMA 1SQBH 2W6JG 3CWBH 3RN4A 5D5PA 2QWPB 3FD9A 3K57A 1J5EO 3OGIB 2H94A 4GKJB 3G4SV 1W2BU 4GKKB 1H5WA 5JCOA 3MDSA 3BRCA 1WLEA 1LNQA 1OJHA 1FXVA 1VF6C 4OX9O 1FKAO 1AILA 2XUMA 4LC1A 1ZSPA 3APQA 4JAAA 1Y66A 1MNGA 2DYSC 4FLTA 4TUYA 3CSXA 1BS3A 3M7MX 3L73H 3ETQA 4JI4O 4DV4O 1WP8A 2E74B 4O4LB 1WAZA 1G6UA 3O9OA 4JGSA 4JI7B 2JS3A 1NZ6A 2XAHA 4EEQA 4OX9B 1RM1C 2JVDA 2AGAA 3SJQC 5LYJB 3CJHA 4JI6O 5LHIA 1N36O 1SC5B 3A0BZ 1AI5A 2GSMB 4P2ZA 4WFGA 5GTIZ 2XT9A 1AJPA 4DR4B 3ZMTA 3SPCA 2HP8A 4ZOLB 1NVPD 3ZMVA 4KHPB 4MTFA 5GONA 2WLLB 3ZN1A 2BTOA 4H37A 1EM1A 2A7WA 2OIGA 2E76B 2XASA 1XNRB 2F66C 2X6AA 5CN0A 4IT5A 2Y0PA 2JDIG 4UCUA 4CC5A 5IJ0B 3HKCB 1X59A 3HB3B 1P7BA 1AJNA 2F95B 4HYOA 1BHAA 4DRXB 3K9SA 1QLEC 4DR7O 2HFEC 1YJ9V 4X8AA 2ATKC 2Q73A 4X1KB 2XOKG 3G71V 5EIBC 3WU2Z 1OCOC 2P06A 1JPXA 3EHBB 1D5AA 1SQGA 3CCVV 2B9ZA 1B04A 4I7ZB 3WB0A 4JYAO 2BCCH 3SYOA 2VQEO 3DXRA 4TT3G 2B5UA 3VQXA 3AG4B 3CRQA 4ZKIA 3TGUH 4DO2A 4R6ZA 3DC6A 1PNLA 2IJJA 2WLJA 1KKDA 3TXQA 1QBZA 4GT1A 2ZNJA 2PF4E 2CH7B 1D2DA 1HW7A 3U11A 1WB7A 4DR5B 4MW8A 1Y74A 5K1PA 1TUEB 2XNDG 3JALB 3CHXA 4I50A 3RYFB 4I5SA 3RW0A 4X9QA 1GK9A 3OTOB 4DUZB 1UFIA 1VQ5V 3K59A 1XHXA 2UXDB 4JI0B 3ZHTA 5H9CA 4X88A 2QM4A 3Q4HA 3W7UA 3FB6C 5GONB 2GTSA 2Y4UA 2PZSA 1S5JA 2WLMA 1MABG 4K0KO 4XDKA 3SYQA 1GN2A 2ZXWB 4JI6B 4DYLA 2ZDIC 5KMGB 3AG1C 1N8RW 4JAVA 1MG1A 4X1KA 1SQFA 1EZJA 2YEVB 4RUEA 5GW7A 1MSWD 4WCEV 3BHPA 3K5OA 5KA5A 1JNBA 1AR4A 4RQEA 4QPKA 2ZIMA 1KYOF 4DV4B 2CTRA 3OR7C 1XNQO 1BGYH 2QR4A 2ZIOA 1TAEA 2XHBA 2PI4A 3ZHQA 4JTCB 2E5LB 4FFBB 3UO2A 4UCOA 2CAZC 4YJ2B 3ZHUA 4DV0B 3K0DA 1OHHG 4YIOA 1SF9A 5JJNB 2YDEA 1BCCH 4W4KA 4F6RA 5A9GA 1Y74B 2ZT9B 3STLC 1OCZC 2ZCEA 3FX7A 1SQXH 5IY5C 3JD2A 1WA8B 5EIBD 4GCZA 1M1KW 3OMIB 5L3FA 2LGQA 3K5NA 1VQ8V 2Z5UA 4X64B 4MTOA 3QG5A 2Y69C 4EB6B 4LF8O 4BR6A 1K3EA 1OCRC 3L75H 3RVYA 1NTZH 5DEDA 2N04A 3A0HZ 4NXNO 5L3DA 2VQFB 2GBOA 1MOFA 1HNXO 5KA6A 2ZM6O 5LL6Y 4ICGA 1ZAUA 3LSUA 1H8HG 1PV0A 2JS5A 3BVOA 4MVQA 2UUBB 2XAFA 2YIBD 2ZQMA 2UUCO 2CTQA 5H6QA 3OTFA 5CB4B 4MT8A 4FJCC 1R6NA 2UUCB 3CMEV 2ODMA 3E8BA 4IL6Z 4X65B 2EULA 2NLJC 1Z5VA 5DECA 1N34B 1HR0B 1SRYA 5KHKA 2Q7EA 1EFRG 5BZBA 4CS2A 2Y0IA 4LF8B 5KUMA 1R6KA 3K79A 1OCCC 4TV9B 5IE9A 4B3RB 1K9MW 1GKFA 4ZOLA 5K1XA 1PL4A 3SJBC 1V9PA 1I08A 4GUNA 1XUQA 2DYRC 2EIKB 2DQ0A 2LP7A 1B6QA 5IYDO 3ZRSA 3K06A 2UXNA 2QWRB 4H0LB 1ZLZA 3ABLB 4PI2A 1LR1A 2BE3A 3CRAA 2GV9A 1N33B 5KHHA 4ZBMA 1BHBA 3JSNA 2YC0A 1I94O 3TCUA 3X2QC 1XNQB 2ZKOA 1M90W 3HKBA 5A2QN 4CH3A 3JARB 1KECA 3F7VC 1OZ0A 3JAWB 1FFXA 1HNWB 3SPIA 4LCUC 1QR8A 2G38A 1FJGO 2DQ3A 2H8PC 1K7DA 1NTKH 4CBCA 1IVSA 2V1DA 4ABMA 4DK0A 2PYJA 4J10A 4LF7O 2YIDA 5IWAO 4LFBO 1I94B 2WLHA 3H1HH 1DLBA 3ABTA 1EN6A 4O4HA 1VARA 1G8MA 4O4JA 3OR6C 3D3IA 1RPOA 2EBOA 4LNUA 4WFHA 4WBNA 2LFSA 4DUZO 2YEVA 3RBZA 1L0LH 1V55B 5ITZA 3RYCA 3DTUB 4KXRA 4UCSA 3WB2A 1Q43A 1B06A 2QE7G 2BTQA 2X7RB 3CXCU 1FYJA 2DE0X 3HR0A 3VQYA 2Q69A 4BIOA 1SETA 3THOA 2RNBA 4PELA 4B3RO 3ASNC 3LSQA 2JRIA 4QIWF 1GMGA 2JEXA 1BQ0A 4JPRA 2QEXV 4JYAB 4X66O 1YIJV 1HR0O 2ZD9A 5IYZA 4EFBA 4W4LA 1SA0A 4CH4A 1WNSA 4RQFA 3TJTA 2LQTA 1OCOB 1WPBA 4IYHA 4JI2O 1GM7A 2R70A 3OUFA 2B1GA 4UVAA 1DF5A 3ABKC 3RYIA 2IJIA 4IIJB 4MVZA 4JZGA 4WFFA 4DR2O 4JASA 2RDCA 5CA1B 1G4YB 3UT5A 5JVDB 1IBLO 3QNEA 2X0LA 2BSKA 4JI5B 4I0XB 4NTWA 2IJHA 5LGUA 2EIMC 4PA3A 3ZHSA 3RT3C 3CD6V 3JYCA 2L6LA 4O4IA 4B3TB 4X64O 1XMOO 4FFBA 5D5QA 1K33A 2ZE5A 3G67A 3ABUA 2WLIA 5FNVB 4GZRB 2JK5C 4H33A 3S3XA 5KX5A 3KZIZ 2R9RB 2DYRB 5IJ0A 1US6A 4O2AB 5KUKA 5LOVB 1KUQA 1IBMO 2IH3C 3E22B 2WPDG 4QGPA 3T1HO 1R6TA 2HJFC 2YICA 1VQ6V 5L3BA 3T1YB 5IYCO 1I7FA 1X4TA 4IHJB 5BMVA 1EBOA 4PDMA 4FM0A 3R65A 4GX2A 5IJ9B 3J81N 2IH1C 4XDLA 1JQ0A 4L87A 4RUFA 3N2KB 3CJHB 4FVMA 4FZ1A 5EZYA 3WFVA 3CC4V 3ETDA 1VQOV 1NQTA 2RJZA 1IURA 1J5EB 3C3TA 1K8AW 3UT5B 4DR1O 5IYZB 5CA1A 1NH2D 4NTXA 4I9QA 2K1EA 1HP8A 2AXTZ 5LP6A 4B3MB 1GRJA 1I5XA 4DV5B 2VWKA 1R1BA 2CGNA 3OTOO 5FPOA 4JI5O 1O9HA 1QVFU 2QWOB 1YHQV 4LFCB 4B08A 1XMQB 4DR5O 1V54C 2Q68A 2BTQB 1N32B 3AG7A 1SZXA 4MVSA 3ZEDA 5FPRA 4TSFG 1GM9A 4G27B 5CBGA 1FS0G 4JYCA 4JI2B 2Q0AA 4O2BB 2IU0A 5H6RA 1IXBA 1S5HC 1NS1A 2W0FC 4PDRA 4DV6O 4IYIA 3L70H
chains in the Genus database with same CATH topology
1GN3A 1PM9A 3EVKA 1EM1A 1GN2A 2CDYA 1MMMA 1LUVA 1N0JA 3AK3A 1WB8A 1JA8A 1B06A 1GN6A 4F6EA 4JYYA 1LUWA 1Y67A 1AR4A 2AW9A 4YIPA 1GN4A 1AP5A 1AVMA 1KKCA 3BFRA 3K9SA 1PL4A 3C3SA 1I08A 2ADQB 4GUNA 1XUQA 1I0HA 3DC5A 4E4EA 5AG2A 1ZUQA 2CE4A 3RN4A 4YIOA 1QNMA 4C7UA 4FFKA 5A9GA 3MDSA 1ZLZA 1XILA 3C3TA 3AK1A 1N0NA 1VEWA 3TJTA 3KDRA 1P7GA 2P4KA 2ADPA 3KKYA 1ZSPA 1MNGA 3IC9A 1EN4A 1AP6A 3DC6A 1ZTEA 4JZGA 1BS3A 3QVNA 3AK2A 2GDSA 4JZ2A 2QKCA 1WB7A 4BR6A 1XDCA 1EN5A 1MSDA 3OT7A 4X9QA 1XREA 1BT8A 1SZXA 1IDSA 3LSUA 1MA1A 2RCVA 2QKAA 1D5NA 1EN6A 1BSMA 1IXBA 1JR9A 1AR5A 1VARA 3CEIA 1IX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GN3 A;  1PM9 A;  3EVK A;  1EM1 A;  1GN2 A;  2CDY A;  1MMM A;  1LUV A;  1N0J A;  3AK3 A;  1WB8 A;  1JA8 A;  1B06 A;  1GN6 A;  4F6E A;  4JYY A;  1LUW A;  1Y67 A;  1AR4 A;  2AW9 A;  4YIP A;  1GN4 A;  1AP5 A;  1AVM A;  1KKC A;  3BFR A;  3K9S A;  1PL4 A;  3C3S A;  1I08 A;  2ADQ B;  4GUN A;  1XUQ A;  1I0H A;  3DC5 A;  4E4E A;  5AG2 A;  1ZUQ A;  2CE4 A;  3RN4 A;  4YIO A;  1QNM A;  4C7U A;  4FFK A;  5A9G A;  3MDS A;  1ZLZ A;  1XIL A;  3C3T A;  3AK1 A;  1N0N A;  1VEW A;  3TJT A;  1P7G A;  2P4K A;  2ADP A;  3KKY A;  1ZSP A;  1MNG A;  3IC9 A;  1EN4 A;  1AP6 A;  3DC6 A;  1ZTE A;  4JZG A;  1BS3 A;  3QVN A;  3AK2 A;  2GDS A;  4JZ2 A;  2QKC A;  1WB7 A;  4BR6 A;  1XDC A;  1EN5 A;  1MSD A;  3OT7 A;  4X9Q A;  1XRE A;  1BT8 A;  1SZX A;  1IDS A;  3LSU A;  1MA1 A;  2RCV A;  2QKA A;  1D5N A;  1EN6 A;  1BSM A;  1IXB A;  1JR9 A;  1AR5 A;  1VAR A;  3CEI A;  1IX9 A; 
#chains in the Genus database with same CATH topology
 3IC7 A;  1ZL8 A;  3WB1 A;  1H2N A;  4PA4 A;  3H1K H;  1VQK V;  5IY5 B;  4DUY B;  3FAV A;  3AK3 A;  3OMA B;  5LMN O;  4DV7 B;  1WB8 A;  4ZIB A;  4HNA B;  4DR3 B;  3SJC C;  4JTD B;  5EK0 A;  1BMF G;  4PJ0 Z;  1DF4 A;  2ITC C;  5LHH A;  3K0G A;  2X6B A;  5LXT A;  1KKC A;  1VIB A;  5EC1 C;  3UKM A;  3QF7 A;  2EIJ B;  1P49 A;  2EIK C;  3JD3 A;  2F1M A;  2DN9 A;  2EZO A;  1ENV A;  5IT9 N;  1R3K C;  3HKE A;  4BAY A;  4WBN B;  2QSA A;  3JCZ A;  3FYE B;  1K5Q A;  4TOI A;  1XQ8 A;  3MD0 A;  2UXB B;  1XNR O;  4NR1 A;  2FL4 A;  2KSD A;  3B77 A;  3LUT B;  4Z1M G;  1O9G A;  1ORQ C;  2GHY A;  1YXB A;  4J7K A;  4P9P A;  2JGD A;  1GTO A;  2CGO A;  2PY5 A;  4X20 B;  4YY3 O;  3KKY A;  4UXN A;  4U3F H;  4TUY B;  4PA9 A;  1EN4 A;  1SES A;  2JJ1 G;  2XAG A;  3JD4 A;  2YXY A;  1SQV H;  1FJG B;  5LHG A;  3UM7 A;  4BIU A;  1CEZ A;  5B5E Z;  1H2L A;  5C93 A;  2IU3 A;  4PDV A;  2DOS A;  1U97 A;  3OUS A;  3JCU Z;  4KL1 A;  3CCR V;  2QM7 A;  3N27 A;  5EBL C;  3FAV B;  2DW4 A;  4B3S O;  1DGS A;  2RCV A;  2K9P A;  2QKA A;  2WA3 A;  3LDD A;  3PJS K;  3SYC A;  3U10 A;  4QNH B;  5CBH A;  4YJ3 B;  1K34 A;  3MHH C;  1FFT B;  3SR2 C;  2ZR2 A;  4UVC A;  3EVK A;  5JH7 A;  1SZT A;  1VQ9 V;  4HZ3 A;  4TQF A;  4DV2 B;  4QPJ A;  1QCE A;  4JI1 O;  5KMG A;  3OEE G;  1YCI A;  2OYQ A;  1L1F A;  3L9D A;  3B09 A;  3ICX A;  3P3P A;  1PNK A;  1PNM A;  4R7C A;  1AI4 A;  3AG3 B;  4Z2W A;  4X1I A;  1XMO B;  3IAY A;  4Z1V A;  4K3A A;  3SGI A;  3BFR A;  1DK1 A;  3C3S A;  3O65 A;  4QJF B;  2UU9 O;  2L35 A;  3ZHV A;  3H01 A;  4MS2 A;  2OTJ V;  3CE2 A;  3A0R A;  4I0X A;  1RSO B;  2JGU A;  2F93 B;  3H1L H;  5J2T A;  1KP3 A;  1Z2G A;  2X6C A;  1Q8I A;  4JV5 B;  1ZWI C;  2GTA A;  3X2Q B;  1XIL A;  5CB4 A;  4LF6 O;  4ASU G;  5E79 Z;  4AQY O;  4I9W A;  4PDL A;  1F23 A;  4JV5 O;  3G6B A;  1G1X B;  1JJO A;  1YTF B;  1QR9 A;  2ZDI A;  2YIB A;  2Q7H A;  2Q4P A;  3W7X A;  4EB6 A;  4J41 A;  5L3C A;  1K92 A;  3AG1 B;  5CMU A;  5F2V O;  1VQL V;  2EIL B;  2HJD A;  3BCC H;  3SYA A;  1EN5 A;  2KB1 A;  1TA8 A;  2A0L A;  5B1A C;  2UXB O;  1IDS A;  1VF6 A;  3VBB A;  1JJ2 U;  3K04 A;  5J2U A;  4OPA A;  1IJG A;  1BQZ A;  4DRX A;  5B1B B;  4NYK A;  3D3Q A;  3JD0 A;  3KG2 A;  1N4C A;  3CCQ V;  3FKS G;  4MTG A;  1AR5 A;  2D3O W;  3HKD B;  3TK1 A;  1RPR A;  2ZE7 A;  5BR8 O;  1M56 C;  1M57 B;  4HBN A;  5CBF A;  5KAF Z;  1F7Y A;  1FPO A;  3ETG A;  2IW5 A;  4LF9 O;  2DWE C;  3S3W A;  4DR3 O;  3OM3 B;  1NBM G;  2WWW A;  2E5L O;  4UVB A;  2WLL A;  2LO1 A;  5EBW C;  3GWK C;  1QQC A;  1K5S A;  3ETE A;  2HVK C;  1H2G A;  2NR5 A;  5KLV H;  5LYJ A;  3GWO A;  2CE4 A;  1JCH A;  3RYF A;  5HFM A;  3HKD A;  3DSQ A;  3DXR B;  1N32 O;  5LMU O;  3K03 A;  5FNV A;  3AK1 A;  2PTM A;  4IGG A;  1FD9 A;  3ZCC A;  3RVZ A;  4LP8 A;  4CZZ A;  1I5Y A;  5J2T B;  2KG7 A;  1OCZ B;  2KQX A;  5JCO C;  4LFC O;  5JJJ B;  4YY3 B;  3N2G A;  4WFA V;  3IC9 A;  4GX0 A;  2UXD O;  1N33 O;  2BSK B;  2IM9 A;  1W59 A;  1E79 G;  4FIP C;  3QVN A;  2E75 B;  2KG7 B;  3DGE A;  1M9N A;  3ZMZ A;  4LF4 B;  2P6J A;  1FXH A;  2PUS A;  4UUJ C;  4U3J B;  2LW7 A;  5BY1 A;  3W7T A;  4UCT A;  4WF9 V;  1Q7Y W;  4PHZ A;  4F4L A;  2KKW A;  3E89 A;  3A8T A;  4JAU A;  2ZIN A;  1H2S B;  1QU7 A;  3B4S A;  4U7O A;  1Y76 A;  3SJA C;  3ABL C;  1YSC A;  2Z3Y A;  1W0J G;  4UCV A;  3B8N A;  2LW1 A;  3SDL A;  1TVK A;  2CUG A;  4YXW G;  3HKC A;  4DUY O;  2ZR3 A;  1N34 O;  4CH6 A;  4FLZ A;  1H2M A;  3K5L A;  1YDX A;  3T1Y O;  1E1R G;  3T1C A;  4FK5 C;  2P67 A;  1COW G;  3T1H B;  1NH2 B;  3K08 A;  1NR1 A;  1NTM H;  1Y67 A;  2FKX A;  3B40 A;  2Q7G A;  1GN4 A;  1AP5 A;  1UPG A;  4UCR A;  1PL0 A;  1Q90 D;  2P7T C;  2ZM6 B;  1YIT V;  4Q6G A;  5LA6 A;  5LP6 C;  2B1I A;  4I55 B;  1NKD A;  2M6Y A;  2LGW A;  2OT5 A;  3CRC A;  4XDJ A;  2WA4 A;  3NR7 A;  5JH7 B;  1R73 A;  1F4M A;  2HVJ C;  3AG4 C;  1NVP B;  3BAB A;  1QNM A;  2RMK B;  2EIL C;  4FFK A;  2JGD B;  2CTW A;  4LWS B;  4N23 A;  3J80 N;  4B3M O;  2Q67 A;  3K3W A;  3LNM B;  1URF A;  1XI1 A;  2Q6A A;  2HR3 A;  3U0Z A;  1XOU A;  2ZNI A;  2D2C B;  5DN6 G;  4FLU A;  2Y69 B;  4TWK A;  3HKE B;  1FXK A;  2XAQ A;  1H2K A;  2DWD C;  5J9P C;  3BPZ A;  3T2M A;  3CCM V;  5LGN A;  2FML A;  3JAR A;  1FOU A;  1IXM A;  1AI7 A;  4FM2 A;  4UV8 A;  2VRZ A;  4F6R B;  1L0N H;  4O4L A;  5EBM C;  5B3S B;  3F5T A;  3GVM A;  5JWP A;  2QA4 V;  3CC2 V;  4LBE C;  3OT7 A;  4X62 B;  2Q8V A;  1JX9 A;  2UXC B;  4CC6 A;  3CXH F;  3FB5 C;  4DV3 B;  4R8C A;  2BOB C;  4DK1 A;  2HLD G;  3OMN B;  1Y4M A;  2VWJ A;  1M5I A;  2MK3 A;  1RP3 B;  3BEH A;  2QKS A;  4GKJ O;  3IGA C;  1JA8 A;  2OIE A;  2F23 A;  1JFF B;  4CS3 A;  5CA0 A;  4L8J A;  1TVK B;  3IFX A;  4DV2 O;  1SQQ H;  3ZHR A;  3ML0 A;  4JI8 O;  3JAM N;  4DV1 O;  4RWU A;  3M99 B;  4J7Z A;  4UV9 A;  1UJW B;  2UUA B;  4HNA A;  3RGB A;  3BA9 A;  2ADQ B;  2YS8 A;  3D36 A;  1M56 B;  5JJE B;  3CMA V;  4WFE A;  2A06 H;  2WLK A;  4B3S B;  4XBF A;  2Q9L A;  4DW0 A;  3VOU A;  3OE7 G;  5EC2 C;  5LMU B;  2YI8 A;  4U3J A;  3ZMU A;  3ZRX A;  2R9A A;  1Y76 B;  3ABM B;  1IBK O;  2ADP A;  3OAA G;  4H44 B;  3P32 A;  1FXK B;  4NB5 A;  3JAS A;  3E83 A;  4PV1 B;  1TUB A;  2DMX A;  3T4D A;  4UFZ A;  2V4D A;  2MW2 B;  2N05 A;  3E86 A;  2QKC A;  1S72 V;  1NI8 A;  4TQD A;  1Q6I A;  1S77 D;  3CB2 A;  5C8Y A;  4NVP A;  4DR7 B;  4CH5 A;  4FPP A;  1Q81 W;  4RAI A;  3IJ4 A;  4LF5 B;  4AI8 A;  5BR8 B;  1WA8 A;  3UO3 A;  1HNZ O;  1VQN V;  3LDE A;  5KAI Z;  4J9Y B;  1JOY A;  1HNZ B;  5GTH Z;  3CEI A;  2C2A A;  1GM8 A;  2CDY A;  2RN9 A;  5B1O A;  1CXZ B;  2ETN A;  4P30 A;  2M7W A;  4KHP O;  4I50 B;  5B1N A;  1ZL8 B;  5DM6 V;  4DR4 O;  5JQG A;  2AW9 A;  3CCE V;  4IHJ A;  5BMV B;  4QE9 A;  4K8Z A;  3L74 H;  2QGN A;  1N36 B;  2HHH O;  1YF2 A;  4ZI7 B;  1KMI Z;  3FYI B;  5J2U B;  4AQY B;  1HNW O;  1SER A;  2FTK A;  3BY6 A;  4TV8 B;  4X1Y B;  2Q0O C;  2JJ2 G;  4JI7 O;  3CYO A;  3K5M A;  1J95 A;  2AHZ A;  3OD4 A;  3J7A U;  1RM1 B;  4PA7 A;  3C90 A;  2WLI B;  2WAM A;  4NXN B;  5HFL A;  1YVW A;  5BXZ A;  3VQV A;  2WLN A;  2UU9 B;  1GAX A;  2N74 A;  2QWQ B;  4FLV A;  2UUA O;  1AP6 A;  1BE3 H;  1JMK C;  5LP6 B;  1V55 C;  3QO7 A;  1OCC B;  1Q6U A;  3AG2 C;  3ASO B;  4DV5 O;  4GKK O;  1KBH A;  1YZB A;  4QE7 A;  4BW9 A;  5JVD A;  2YXL A;  5TIS Z;  1OV9 A;  1B3Q A;  1WJZ A;  4X1I B;  3SPG A;  1NR7 A;  3RWR D;  4DR1 B;  3NXS A;  4U7N A;  4YHH O;  3I5D A;  3RYI B;  1P84 F;  1HDJ A;  2QTO A;  3VQW A;  1Q6H A;  3ZIA G;  4TV8 A;  2EIN C;  1P4R A;  2QM8 A;  3F5W C;  1EZV H;  2Y48 A;  3PN1 A;  3B8M A;  1RFY A;  4O4J B;  1SA0 B;  5H5N A;  3P30 A;  1W0K G;  5JQG B;  1PM9 A;  4AIL C;  4X62 O;  1MMM A;  3B2E E;  1YTF D;  4JYY A;  3ZRV A;  4JTA B;  4NXM B;  4MSW C;  1R3J C;  1LUW A;  2IBZ H;  3UQ8 A;  3W7S A;  2HHH B;  2GUZ B;  3LSS A;  4K0K B;  4N21 A;  4D6T H;  1XL4 A;  1R3L C;  3JD1 A;  1HNX B;  1Q86 W;  3BAA A;  1NT2 B;  5EYP B;  1Q82 W;  3DC5 A;  4JI3 B;  3UCS C;  1SS3 A;  4JI0 O;  4AHC A;  4B3T O;  3ZRW A;  1THZ A;  5C8Y B;  1Z5W A;  4EFE A;  3L72 H;  3GB7 C;  1VMG A;  2A3Q A;  1ROP A;  3LNN A;  1N0N A;  1VEW A;  2P90 A;  3E35 A;  2P4K A;  2F4V O;  3CCJ V;  3BA8 A;  4MVO A;  3JAS B;  4JYB A;  1YJW V;  3WG7 C;  4DR2 B;  2BOC C;  2LJ2 A;  2H3O A;  1BL8 A;  1FXK C;  4WFB V;  3ZN0 A;  2GDS A;  2V7Q G;  2ZE8 A;  2EIN B;  3AG2 B;  1YEW A;  3ASO C;  4LWS A;  5L3E A;  4UB6 Z;  1A32 A;  4PI0 A;  1VQM V;  2ILM A;  4FLW A;  2ZE6 A;  3SPJ A;  5B66 Z;  1KD1 W;  1QHT A;  2AZ0 A;  4PA6 A;  1S5L Z;  2A9H A;  4X20 A;  2FYU H;  5B1A B;  5LA6 B;  2VS0 A;  2Z0A A;  2HEP A;  1D5N A;  1JR9 A;  5B1B C;  1IX9 A;  2HKO A;  4J42 A;  3LDC A;  2Q5Z A;  3RYH A;  2WSS G;  1OCR B;  1U96 A;  1CPY A;  3ZX6 A;  1XMQ O;  1KC8 W;  5ITZ B;  3H9V A;  2HG5 C;  4EKW A;  2QWN B;  4DXW A;  1R3I C;  4KP4 A;  2EIJ C;  3CC7 V;  4P9O A;  4O2B A;  4TV9 A;  4B7E A;  1XEQ A;  4G2K A;  3G6E V;  4DV1 B;  2CK3 G;  4JI8 B;  4E2L A;  4MVR A;  2PI5 A;  4E4E A;  1PPJ H;  1TGO A;  4D7S A;  1AR1 B;  1ZX3 A;  1FFX B;  1H8E G;  3ZS8 C;  4Q20 A;  4NKG B;  1VF7 A;  1S0V A;  1XL6 A;  2EZP A;  4DV3 O;  4YJ2 A;  3OEH G;  4JI4 B;  3CRM A;  2VQE B;  3D8C A;  1Q5O A;  3AEI A;  2JEU A;  2UXC O;  1PP9 H;  3ZMS A;  4GYC B;  1SKV A;  1WPX A;  1K97 A;  1AI6 A;  2OCC B;  4BIZ A;  4MVU A;  2DJV A;  5KHG A;  2W0X A;  1Y6X A;  4LF9 B;  2XAJ A;  1MSD A;  4LFA O;  1IBM B;  3M8A A;  3N2K A;  1XRE A;  2QJ1 A;  4JF3 A;  4ZI7 A;  2YSU B;  3CCU V;  4I4T B;  1IZ3 A;  1MA1 A;  1S3J A;  2DYS B;  1BSM A;  4K35 A;  4ZHQ B;  1VQ4 V;  1GN3 A;  2OWO A;  3APO A;  3ZRW B;  4K8X A;  2FB5 A;  3ZJZ A;  3OW2 U;  1PKX A;  5LBQ A;  1M57 C;  1N0J A;  3OFN G;  5IJ9 A;  3ABM C;  1SQP H;  3CP1 A;  3E8F A;  3STZ C;  1GN6 A;  5LOV A;  3G80 A;  1IBL B;  4JI3 O;  3JAL A;  5IDJ A;  2F43 G;  3JAT A;  2GUZ A;  4GX1 A;  1VF5 B;  3P3N A;  5FLX N;  3CX5 F;  4X89 A;  2OTL V;  3QO8 A;  4RO2 A;  4A5U B;  3A2F A;  4I4T A;  3WG7 B;  4O4I B;  4LFA B;  1KQS U;  2YI9 A;  4G28 B;  2ITD C;  2P4V A;  4BWA A;  5LGT A;  5L3G A;  1XHZ A;  3JSL A;  4LF6 B;  1VP7 A;  4FLY A;  4OPH A;  2RQ6 A;  4BW5 A;  4O2A A;  1ZUQ A;  3MAQ A;  1H38 A;  2A79 B;  4C7U A;  5KX5 B;  3OGC C;  4X66 B;  3Q4H B;  3QO5 A;  4DR6 B;  4PD4 F;  5IYB O;  2LFR A;  4KUM A;  1P7G A;  2YXH A;  3RFR A;  3SYP A;  3K58 A;  2PGG A;  3L71 H;  2EJR A;  3K9A A;  3N2G B;  2ARH A;  5KHI A;  1QLE B;  4J7J A;  2R9I A;  3JAK A;  1WN7 A;  4FM1 A;  3AK2 A;  3D36 C;  2UXX A;  1VQ7 V;  4GX5 A;  1KP2 A;  4YHH B;  5FL7 G;  4JZ2 A;  2PYL A;  1NU1 H;  4GLX A;  1BZK A;  2CH7 A;  1DTO A;  2P22 C;  4UB8 Z;  1M93 A;  4JI1 B;  4B7K A;  1XDC A;  4FZ0 A;  4LF4 O;  3JAK B;  1YJN V;  5EZY B;  4CS4 A;  3I56 V;  1E1Q G;  2QTS A;  3CCS V;  4X1Y A;  4NTY A;  4R50 A;  4DV0 O;  4LH6 A;  2O57 A;  3ABK B;  2Y4T A;  4O4H B;  4ZHQ A;  4LFB B;  5IWA B;  4OGQ B;  4LF7 B;  2EJ7 A;  3CCL V;  3CS5 A;  1LUV A;  3EXA A;  5E1A C;  3RYC B;  2JIZ G;  1K4D C;  3E22 A;  3KCY A;  2ZXW C;  1V54 B;  2E3C A;  4MTX A;  3F7Y C;  5KHJ A;  3HPL C;  4YJ3 A;  4DW1 A;  3FFQ A;  4YIP A;  4H13 B;  2W6I G;  3T4Z A;  3H1J H;  3JAT B;  1L8D A;  4J11 A;  3ASN B;  3E2E A;  3R66 A;  3MHS C;  1YI2 V;  4LR3 A;  1Q3E A;  5AG2 A;  1QVG U;  3CPW U;  5H2F Z;  2CTP A;  1T5E A;  4OXS A;  3CRR A;  1NJI W;  3TET A;  3KDR A;  3EFF K;  1KB9 F;  2OCH A;  4FLX A;  2AZ2 A;  2F4V B;  1GO3 F;  2QDO A;  4IIJ A;  1XBL A;  1VQP V;  3KCX A;  2IJK A;  1ZTE A;  4LF5 O;  3SPH A;  2XTA A;  3JAW A;  2P5O A;  1FAF A;  3FB7 C;  3FB8 C;  2YIA A;  1GH6 A;  3E8G A;  2EX3 A;  3HKB B;  3W7W A;  5LMN B;  4DV7 O;  1TUB B;  4DR6 O;  2NN4 A;  1S76 D;  2OCC C;  5CA0 B;  1JFF A;  2AHY A;  4D7T A;  1BT8 A;  1RSO A;  5EYP A;  4X65 O;  5CA3 A;  4I55 A;  1MZE A;  4DV6 B;  3RYH B;  1F51 A;  5LXT B;  1IBK B;  4J80 A;  4NXM O;  2UUB O;  1M4U A;  2EIM B;  1F4N A;  4MW3 A;  1PD3 A;  4J9Z B;  4LH7 A;  5B3S C;  1MZF A;  2VQF O;  1K73 W;  1WP7 A;  3QTC A;  4F6E A;  3E8H A;  1KU9 A;  3TXS A;  4LNU B;  2NNU A;  1CP9 A;  1QLN A;  4FMT A;  1AVM A;  1K4C C;  4MVM A;  3ZBH A;  1HWY A;  3AG3 C;  2YUA A;  1JVM A;  1ARO P;  4HAM A;  2R72 A;  1AJQ A;  1AB3 A;  1I0H A;  3I55 V;  3H1I H;  4KFM A;  1SQB H;  2W6J G;  3CWB H;  3RN4 A;  5D5P A;  2QWP B;  3FD9 A;  3K57 A;  1J5E O;  3OGI B;  2H94 A;  4GKJ B;  3G4S V;  1W2B U;  4GKK B;  1H5W A;  5JCO A;  3MDS A;  3BRC A;  1WLE A;  1LNQ A;  1OJH A;  1FXV A;  1VF6 C;  4OX9 O;  1FKA O;  1AIL A;  2XUM A;  4LC1 A;  1ZSP A;  3APQ A;  4JAA A;  1Y66 A;  1MNG A;  2DYS C;  4FLT A;  4TUY A;  3CSX A;  1BS3 A;  3M7M X;  3L73 H;  3ETQ A;  4JI4 O;  4DV4 O;  1WP8 A;  2E74 B;  4O4L B;  1WAZ A;  1G6U A;  3O9O A;  4JGS A;  4JI7 B;  2JS3 A;  1NZ6 A;  2XAH A;  4EEQ A;  4OX9 B;  1RM1 C;  2JVD A;  2AGA A;  3SJQ C;  5LYJ B;  3CJH A;  4JI6 O;  5LHI A;  1N36 O;  1SC5 B;  3A0B Z;  1AI5 A;  2GSM B;  4P2Z A;  4WFG A;  5GTI Z;  2XT9 A;  1AJP A;  4DR4 B;  3ZMT A;  3SPC A;  2HP8 A;  4ZOL B;  1NVP D;  3ZMV A;  4KHP B;  4MTF A;  5GON A;  2WLL B;  3ZN1 A;  2BTO A;  4H37 A;  1EM1 A;  2A7W A;  2OIG A;  2E76 B;  2XAS A;  1XNR B;  2F66 C;  2X6A A;  5CN0 A;  4IT5 A;  2Y0P A;  2JDI G;  4UCU A;  4CC5 A;  5IJ0 B;  3HKC B;  1X59 A;  3HB3 B;  1P7B A;  1AJN A;  2F95 B;  4HYO A;  1BHA A;  4DRX B;  3K9S A;  1QLE C;  4DR7 O;  2HFE C;  1YJ9 V;  4X8A A;  2ATK C;  2Q73 A;  4X1K B;  2XOK G;  3G71 V;  5EIB C;  3WU2 Z;  1OCO C;  2P06 A;  1JPX A;  3EHB B;  1D5A A;  1SQG A;  3CCV V;  2B9Z A;  1B04 A;  4I7Z B;  3WB0 A;  4JYA O;  2BCC H;  3SYO A;  2VQE O;  3DXR A;  4TT3 G;  2B5U A;  3VQX A;  3AG4 B;  3CRQ A;  4ZKI A;  3TGU H;  4DO2 A;  4R6Z A;  3DC6 A;  1PNL A;  2IJJ A;  2WLJ A;  1KKD A;  3TXQ A;  1QBZ A;  4GT1 A;  2ZNJ A;  2PF4 E;  2CH7 B;  1D2D A;  1HW7 A;  3U11 A;  1WB7 A;  4DR5 B;  4MW8 A;  1Y74 A;  5K1P A;  1TUE B;  2XND G;  3JAL B;  3CHX A;  4I50 A;  3RYF B;  4I5S A;  3RW0 A;  4X9Q A;  1GK9 A;  3OTO B;  4DUZ B;  1UFI A;  1VQ5 V;  3K59 A;  1XHX A;  2UXD B;  4JI0 B;  3ZHT A;  5H9C A;  4X88 A;  2QM4 A;  3Q4H A;  3W7U A;  3FB6 C;  5GON B;  2GTS A;  2Y4U A;  2PZS A;  1S5J A;  2WLM A;  1MAB G;  4K0K O;  4XDK A;  3SYQ A;  1GN2 A;  2ZXW B;  4JI6 B;  4DYL A;  2ZDI C;  5KMG B;  3AG1 C;  1N8R W;  4JAV A;  1MG1 A;  4X1K A;  1SQF A;  1EZJ A;  2YEV B;  4RUE A;  5GW7 A;  1MSW D;  4WCE V;  3BHP A;  3K5O A;  5KA5 A;  1JNB A;  1AR4 A;  4RQE A;  4QPK A;  2ZIM A;  1KYO F;  4DV4 B;  2CTR A;  3OR7 C;  1XNQ O;  1BGY H;  2QR4 A;  2ZIO A;  1TAE A;  2XHB A;  2PI4 A;  3ZHQ A;  4JTC B;  2E5L B;  4FFB B;  3UO2 A;  4UCO A;  2CAZ C;  4YJ2 B;  3ZHU A;  4DV0 B;  3K0D A;  1OHH G;  4YIO A;  1SF9 A;  5JJN B;  2YDE A;  1BCC H;  4W4K A;  4F6R A;  5A9G A;  1Y74 B;  2ZT9 B;  3STL C;  1OCZ C;  2ZCE A;  3FX7 A;  1SQX H;  5IY5 C;  3JD2 A;  1WA8 B;  5EIB D;  4GCZ A;  1M1K W;  3OMI B;  5L3F A;  2LGQ A;  3K5N A;  1VQ8 V;  2Z5U A;  4X64 B;  4MTO A;  3QG5 A;  2Y69 C;  4EB6 B;  4LF8 O;  4BR6 A;  1K3E A;  1OCR C;  3L75 H;  3RVY A;  1NTZ H;  5DED A;  2N04 A;  3A0H Z;  4NXN O;  5L3D A;  2VQF B;  2GBO A;  1MOF A;  1HNX O;  5KA6 A;  2ZM6 O;  5LL6 Y;  4ICG A;  1ZAU A;  3LSU A;  1H8H G;  1PV0 A;  2JS5 A;  3BVO A;  4MVQ A;  2UUB B;  2XAF A;  2YIB D;  2ZQM A;  2UUC O;  2CTQ A;  5H6Q A;  3OTF A;  5CB4 B;  4MT8 A;  4FJC C;  1R6N A;  2UUC B;  3CME V;  2ODM A;  3E8B A;  4IL6 Z;  4X65 B;  2EUL A;  2NLJ C;  1Z5V A;  5DEC A;  1N34 B;  1HR0 B;  1SRY A;  5KHK A;  2Q7E A;  1EFR G;  5BZB A;  4CS2 A;  2Y0I A;  4LF8 B;  5KUM A;  1R6K A;  3K79 A;  1OCC C;  4TV9 B;  5IE9 A;  4B3R B;  1K9M W;  1GKF A;  4ZOL A;  5K1X A;  1PL4 A;  3SJB C;  1V9P A;  1I08 A;  4GUN A;  1XUQ A;  2DYR C;  2EIK B;  2DQ0 A;  2LP7 A;  1B6Q A;  5IYD O;  3ZRS A;  3K06 A;  2UXN A;  2QWR B;  4H0L B;  1ZLZ A;  3ABL B;  4PI2 A;  1LR1 A;  2BE3 A;  3CRA A;  2GV9 A;  1N33 B;  5KHH A;  4ZBM A;  1BHB A;  3JSN A;  2YC0 A;  1I94 O;  3TCU A;  3X2Q C;  1XNQ B;  2ZKO A;  1M90 W;  3HKB A;  5A2Q N;  4CH3 A;  3JAR B;  1KEC A;  3F7V C;  1OZ0 A;  3JAW B;  1FFX A;  1HNW B;  3SPI A;  4LCU C;  1QR8 A;  2G38 A;  1FJG O;  2DQ3 A;  2H8P C;  1K7D A;  1NTK H;  4CBC A;  1IVS A;  2V1D A;  4ABM A;  4DK0 A;  2PYJ A;  4J10 A;  4LF7 O;  2YID A;  5IWA O;  4LFB O;  1I94 B;  2WLH A;  3H1H H;  1DLB A;  3ABT A;  1EN6 A;  4O4H A;  1VAR A;  1G8M A;  4O4J A;  3OR6 C;  3D3I A;  1RPO A;  2EBO A;  4LNU A;  4WFH A;  4WBN A;  2LFS A;  4DUZ O;  2YEV A;  3RBZ A;  1L0L H;  1V55 B;  5ITZ A;  3RYC A;  3DTU B;  4KXR A;  4UCS A;  3WB2 A;  1Q43 A;  1B06 A;  2QE7 G;  2BTQ A;  2X7R B;  3CXC U;  1FYJ A;  2DE0 X;  3HR0 A;  3VQY A;  2Q69 A;  4BIO A;  1SET A;  3THO A;  2RNB A;  4PEL A;  4B3R O;  3ASN C;  3LSQ A;  2JRI A;  4QIW F;  1GMG A;  2JEX A;  1BQ0 A;  4JPR A;  2QEX V;  4JYA B;  4X66 O;  1YIJ V;  1HR0 O;  2ZD9 A;  5IYZ A;  4EFB A;  4W4L A;  1SA0 A;  4CH4 A;  1WNS A;  4RQF A;  3TJT A;  2LQT A;  1OCO B;  1WPB A;  4IYH A;  4JI2 O;  1GM7 A;  2R70 A;  3OUF A;  2B1G A;  4UVA A;  1DF5 A;  3ABK C;  3RYI A;  2IJI A;  4IIJ B;  4MVZ A;  4JZG A;  4WFF A;  4DR2 O;  4JAS A;  2RDC A;  5CA1 B;  1G4Y B;  3UT5 A;  5JVD B;  1IBL O;  3QNE A;  2X0L A;  2BSK A;  4JI5 B;  4I0X B;  4NTW A;  2IJH A;  5LGU A;  2EIM C;  4PA3 A;  3ZHS A;  3RT3 C;  3CD6 V;  3JYC A;  2L6L A;  4O4I A;  4B3T B;  4X64 O;  1XMO O;  4FFB A;  5D5Q A;  1K33 A;  2ZE5 A;  3G67 A;  3ABU A;  2WLI A;  5FNV B;  4GZR B;  2JK5 C;  4H33 A;  3S3X A;  5KX5 A;  3KZI Z;  2R9R B;  2DYR B;  5IJ0 A;  1US6 A;  4O2A B;  5KUK A;  5LOV B;  1KUQ A;  1IBM O;  2IH3 C;  3E22 B;  2WPD G;  4QGP A;  3T1H O;  1R6T A;  2HJF C;  2YIC A;  1VQ6 V;  5L3B A;  3T1Y B;  5IYC O;  1I7F A;  1X4T A;  4IHJ B;  5BMV A;  1EBO A;  4PDM A;  4FM0 A;  3R65 A;  4GX2 A;  5IJ9 B;  3J81 N;  2IH1 C;  4XDL A;  1JQ0 A;  4L87 A;  4RUF A;  3N2K B;  3CJH B;  4FVM A;  4FZ1 A;  5EZY A;  3WFV A;  3CC4 V;  3ETD A;  1VQO V;  1NQT A;  2RJZ A;  1IUR A;  1J5E B;  3C3T A;  1K8A W;  3UT5 B;  4DR1 O;  5IYZ B;  5CA1 A;  1NH2 D;  4NTX A;  4I9Q A;  2K1E A;  1HP8 A;  2AXT Z;  5LP6 A;  4B3M B;  1GRJ A;  1I5X A;  4DV5 B;  2VWK A;  1R1B A;  2CGN A;  3OTO O;  5FPO A;  4JI5 O;  1O9H A;  1QVF U;  2QWO B;  1YHQ V;  4LFC B;  4B08 A;  1XMQ B;  4DR5 O;  1V54 C;  2Q68 A;  2BTQ B;  1N32 B;  3AG7 A;  1SZX A;  4MVS A;  3ZED A;  5FPR A;  4TSF G;  1GM9 A;  4G27 B;  5CBG A;  1FS0 G;  4JYC A;  4JI2 B;  2Q0A A;  4O2B B;  2IU0 A;  5H6R A;  1IXB A;  1S5H C;  1NS1 A;  2W0F C;  4PDR A;  4DV6 O;  4IYI A;  3L70 H; 
#chains in the Genus database with same CATH homology
 1GN3 A;  1PM9 A;  3EVK A;  1EM1 A;  1GN2 A;  2CDY A;  1MMM A;  1LUV A;  1N0J A;  3AK3 A;  1WB8 A;  1JA8 A;  1B06 A;  1GN6 A;  4F6E A;  4JYY A;  1LUW A;  1Y67 A;  1AR4 A;  2AW9 A;  4YIP A;  1GN4 A;  1AP5 A;  1AVM A;  1KKC A;  3BFR A;  3K9S A;  1PL4 A;  3C3S A;  1I08 A;  2ADQ B;  4GUN A;  1XUQ A;  1I0H A;  3DC5 A;  4E4E A;  5AG2 A;  1ZUQ A;  2CE4 A;  3RN4 A;  4YIO A;  1QNM A;  4C7U A;  4FFK A;  5A9G A;  3MDS A;  1ZLZ A;  1XIL A;  3C3T A;  3AK1 A;  1N0N A;  1VEW A;  3TJT A;  3KDR A;  1P7G A;  2P4K A;  2ADP A;  3KKY A;  1ZSP A;  1MNG A;  3IC9 A;  1EN4 A;  1AP6 A;  3DC6 A;  1ZTE A;  4JZG A;  1BS3 A;  3QVN A;  3AK2 A;  2GDS A;  4JZ2 A;  2QKC A;  1WB7 A;  4BR6 A;  1XDC A;  1EN5 A;  1MSD A;  3OT7 A;  4X9Q A;  1XRE A;  1BT8 A;  1SZX A;  1IDS A;  3LSU A;  1MA1 A;  2RCV A;  2QKA A;  1D5N A;  1EN6 A;  1BSM A;  1IXB A;  1JR9 A;  1AR5 A;  1VAR A;  3CEI A;  1IX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...