3TJTA

Crystal structure analysis of the superoxide dismutase from clostridium difficile
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
202
structure length
202
Chain Sequence
NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Crystal Structure of the superoxide dismutase from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Oxidoreductase
total genus 74
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3tjtA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3tjtA02
2GDSA 1KKCA 3QVNA 2ADQB 3KKYA 1LUWA 1EN5A 2AW9A 1IXBA 1MMMA 4F6EA 3BFRA 1ZUQA 3EVKA 1PL4A 3IC9A 3K9SA 3AK2A 5A9GA 1GN2A 1XREA 4YIOA 3MDSA 4GUNA 1QNMA 1GN3A 1D5NA 1MSDA 1JA8A 1VEWA 2ADPA 1AP5A 1GN6A 1MA1A 1XDCA 1XUQA 1BT8A 2QKAA 1LUVA 2RCVA 1I0HA 1ZLZA 2CDYA 2QKCA 3TJTA 4JZGA 1P7GA 1ZTEA 1ZSPA 1AP6A 1PM9A 3LSUA 1AR5A 2P4KA 1SZXA 3OT7A 3C3TA 1EN6A 1MNGA 1N0NA 3CEIA 1IDSA 3C3SA 1EN4A 3DC5A 4E4EA 1WB7A 4FFKA 3DC6A 5AG2A 1GN4A 2CE4A 1JR9A 4JYYA 1I08A 1IX9A 1BSMA 1B06A 3AK3A 1XILA 1Y67A 1EM1A 1BS3A 1VARA 3RN4A 1WB8A 3AK1A 1AVMA 1AR4A 4BR6A 4YIPA 4X9QA 4C7UA 1N0JA 4JZ2A
chains in the Genus database with same CATH superfamily
1ZX3A 4CH3A 1JFFA 5L3FA 1ZAUA 1LUWA 3NR7A 1MG1A 2KG7A 3MD0A 2BCCH 2DYSC 3HKCA 3X2QB 4FLTA 2Q0AA 3H1LH 4LFCB 2V1DA 1AI5A 1JVMA 5EZYA 2UXXA 2OCHA 4X8AA 3ZHTA 1RM1B 2ZIMA 2IU3A 4UCUA 3OR7C 2QDOA 3CCRV 1AP5A 3PN1A 1XDCA 2B5UA 3WFVA 4IT5A 4D7SA 3E86A 3K9AA 2DQ0A 1HNXO 4PJ0Z 4HYOA 1ZLZA 1IVSA 5IWAB 3JSNA 2F43G 4PHZA 2ODMA 4O4IA 2Y4UA 3JATA 5KUKA 2RNBA 4FLUA 2AGAA 2PZSA 3CP1A 2P5OA 3CJHB 1V9PA 2R9IA 3UCSC 1B3QA 3JD4A 2FL4A 2GTAA 4IYIA 3GB7C 5B1BB 1Z5WA 2A3QA 3BEHA 4CH6A 4UV9A 4FM2A 3E8FA 2F95B 1XNRO 2ATKC 1VQLV 1VF6A 1EM1A 1VARA 1EFRG 3FB5C 2Q67A 4H44B 2QEXV 4YY3B 4O2AB 4X20A 4XDKA 1V55B 4QGPA 4WFAV 3HKBA 1HNZO 2UXCO 1XBLA 4LH7A 1L8DA 3QTCA 1WA8B 3ETQA 2WLIB 2UUCO 3CE2A 4B3MB 1KQSU 3K06A 1DGSA 4DR4O 3CS5A 1IBLO 5F2VO 4ZOLB 2BOBC 1DTOA 3K03A 2RN9A 4FMTA 4FLZA 5KHJA 3ASOC 5JVDA 2ZR2A 4WCEV 1H8HG 3ZHUA 4LR3A 2Q6AA 2W6IG 4LC1A 1Q8IA 3ABLB 1K7DA 2WLNA 2QR4A 1AILA 4P30A 4X64B 1BZKA 5JWPA 1HP8A 2NN4A 1GN6A 4JI8O 3HKEA 4PA9A 1NZ6A 1KECA 3D36A 3JASA 4I50B 2QKAA 1FD9A 4OPHA 3F5WC 3AG4C 5IYCO 3SGIA 1SQXH 1QLNA 1YSCA 4WFEA 3CPWU 1M5IA 4LF6B 1FKAO 1HDJA 1P7BA 4NB5A 5CA1A 4B7EA 3FB8C 4H13B 4JI2O 2F4VO 4K0KB 4N23A 3LNMB 2PGGA 1CPYA 2WLLB 5EC1C 4JYYA 5B1AC 2HEPA 3LDCA 2LGQA 1IX9A 5LGUA 2GV9A 3OGCC 4G27B 4JAAA 4MS2A 4BWAA 1GAXA 1JNBA 5CA3A 1BS3A 2MW2B 4QIWF 1S0VA 1SKVA 5EK0A 2EIJC 5LBQA 4OPAA 1SERA 3OUFA 4ZBMA 4DV7B 5KAIZ 4J11A 3K08A 4WBNA 2W0XA 2LP7A 4DR7O 1FXKC 1R3LC 3ZX6A 4U3JB 2IJKA 3M99B 1BL8A 3QVNA 2YEVB 4JI5O 5LP6B 1MABG 3QG5A 5KLVH 4B3SO 4CC5A 4DUYB 1EZJA 3OGIB 4F6EA 4TQDA 3CCEV 4B3RO 4LWSB 4JF3A 5CB4A 2GUZB 3SPJA 1I7FA 1ENVA 2LW7A 1JQ0A 5LHHA 4TSFG 2Q7EA 4NYKA 4KUMA 2P4VA 1JJOA 3WB0A 4TQFA 1AROP 1QR9A 2AZ0A 5JJJB 5IE9A 3E8BA 4X88A 2EZPA 2CH7B 2ZKOA 4X1KB 3CXCU 1PV0A 1WLEA 3TCUA 4MVMA 4NKGB 3LSUA 3W7TA 3ZHSA 1W59A 1X4TA 3P32A 3AG2B 1QR8A 3X2QC 4MTXA 2YIBD 1TUBA 4MVOA 1I94B 4YXWG 3N2KB 1XQ8A 1RM1C 1DF4A 1RSOB 4DRXB 3EFFK 4U7OA 3CRQA 2VQEB 4IGGA 4X1IB 5KHGA 4QPKA 2L6LA 1R73A 3OTOB 1WAZA 3WB2A 1SQQH 5KX5A 3OMAB 5LMUB 1P49A 4YJ3B 3ZCCA 1G6UA 3A8TA 4OGQB 1SC5B 5TISZ 4LFAB 4DR5O 2E75B 3G6BA 3N2GB 5LA6B 2QTOA 2HVKC 2IM9A 2EX3A 1XNQO 1KP3A 4GZRB 1OCZB 2F93B 5KAFZ 4DUZO 2CK3G 1G1XB 1VIBA 1R1BA 1AR1B 4FLYA 2OCCB 5B1BC 5JH7B 1M56B 3CC7V 3JCZA 1BGYH 3G67A 3S3XA 4R6ZA 5B1NA 3K9SA 1VQMV 2UUAB 3J81N 1D5NA 4D7TA 4J9ZB 5B5EZ 3UKMA 5GONA 2Q7HA 4TUYB 4GKJB 4JI7O 5C93A 1N8RW 3OUSA 3SDLA 3OR6C 2QM4A 1YCIA 1AB3A 1V55C 2N04A 1I5XA 4X1YB 5A2QN 2LFRA 1Q90D 4ZI7B 2HJFC 2BTQA 4FPPA 5ITZA 1XMOO 3P3NA 2JIZG 2IH3C 3T1HO 3VQWA 5LHGA 3CD6V 2WLKA 1EN6A 4O4LA 3K59A 2BE3A 2MK3A 3TETA 3UQ8A 4E4EA 4CH4A 2ZM6O 3D3QA 1EBOA 2XTAA 2H3OA 3FX7A 3AG7A 3ZHRA 1JJ2U 3ABLC 1Y76B 2PUSA 1NH2D 2UU9O 5L3BA 3G6EV 5EBMC 1R6NA 2HR3A 2OYQA 1HNXB 3IFXA 3FKSG 2YXHA 4JASA 1QBZA 1YVWA 5L3GA 1AI6A 3VOUA 4EFBA 3RFRA 1BMFG 2LGWA 5EBLC 3RYIA 4KP4A 2ZE6A 3N27A 2KQXA 4OXSA 2XT9A 1JPXA 3CSXA 1QLEB 1K5QA 4MSWC 3ETGA 5LXTB 4XDJA 3JD1A 1BHBA 4GYCB 5L3CA 1TVKB 3W7UA 2QA4V 4TOIA 1F4MA 3JARB 3K3WA 2PYLA 3RVYA 4G28B 3ZMZA 1K4DC 4CS2A 2OTJV 1SZTA 2Y69B 1GRJA 4PA3A 1XNRB 5KMGB 1XL6A 3RYHB 3MDSA 1W0KG 2ZIOA 5LGTA 4X89A 3B40A 2ADPA 4KL1A 3FAVB 3M7MX 2UXBO 1GMGA 4JYCA 5H9CA 5CBHA 4DK1A 2IH1C 2UXCB 1R3KC 4FVMA 4JAUA 1GM8A 2KG7B 3SPIA 2QM8A 2UUCB 1VQ4V 1YXBA 4I55A 1Y6XA 3CC4V 5EZYB 1RPRA 1SZXA 3SYAA 1M90W 4DR4B 3G71V 1IBLB 1KBHA 2WPDG 5LP6C 2VQEO 4KHPO 4MTFA 3O65A 1VQ8V 2Y48A 5J2UB 5K1PA 3K0GA 1AI7A 3OEHG 4RWUA 5EC2C 5EIBD 5GW7A 3QF7A 4FFBA 3K0DA 1FFXA 2ETNA 2ITCC 4JI8B 5K1XA 4YHHB 5LGNA 2FMLA 1VQKV 4O4IB 1I5YA 1WN7A 1L1FA 3RN4A 1OCOB 3NXSA 1AJNA 4PA6A 2Q7GA 3SYCA 1KKDA 4H0LB 5IJ0A 2BSKB 4QPJA 3AG2C 5B66Z 4K35A 5FNVB 4BIUA 2DW4A 2F4VB 2YDEA 3I5DA 4W4KA 3SYQA 4P2ZA 2HKOA 3ZMUA 3DXRA 4DYLA 4K8XA 1CP9A 4BW5A 1YJNV 4LF4B 4I4TB 1WJZA 4FLWA 1U97A 1SA0A 3TGUH 2DJVA 5J2TA 3I55V 1XOUA 3RYFA 4ASUG 4DR7B 2P22C 2A0LA 1S5HC 4LF8O 1H2SB 3KDRA 2QE7G 2WWWA 1ZSPA 2IJHA 3RYCB 4X66O 4GX2A 1URFA 5LOVB 1P4RA 1J95A 5BMVB 1L0LH 4JI5B 2KKWA 4E2LA 2EJRA 4B3SB 1N0NA 4RO2A 3M8AA 1OCZC 2YXYA 1IDSA 2WA4A 3OM3B 4B3RB 2OCCC 1M56C 4L8JA 2EJ7A 1WB7A 2N74A 1QQCA 3SPCA 2P90A 3FFQA 3STZC 1NTMH 4QNHB 2ZNIA 5FPRA 1N36O 1KUQA 1YJWV 2M7WA 1PNMA 5D5PA 1FOUA 1FXKA 1AI4A 1NTKH 1RPOA 3ZRWA 3GWKC 4LF5O 3CHXA 5BY1A 2YSUB 5CA1B 5EYPA 3UT5A 1S5JA 4DV1O 5BZBA 1XMQO 2A79B 2GDSA 1D2DA 2ADQB 1DF5A 3ZEDA 1K4CC 3KKYA 5IYZB 1VQOV 4P9PA 4FZ0A 1H2LA 3H1JH 5BR8O 4BW9A 3OMNB 1N32O 1PP9H 2VWJA 1XREA 3ABTA 1MSDA 1S77D 4DV6O 3CCUV 2IJIA 3B2EE 5JCOC 3JAWA 1SQGA 4DR5B 2LJ2A 4PDRA 2CDYA 4PI0A 4MTGA 1ORQC 4IL6Z 3K5OA 4AI8A 1XNQB 1TUEB 5IJ9A 1QLEC 4MVSA 1U96A 1Y74B 1NKDA 4DUZB 4KFMA 4YHHO 1THZA 3J7AU 3TXSA 3RW0A 3FYIB 3KCYA 5AG2A 1MZEA 4L87A 2CE4A 3BVOA 2Y69C 1IZ3A 4TWKA 1OCCB 3JALB 2CTQA 1JR9A 3APOA 3CB2A 4JI7B 1WPXA 1H2NA 1IBKO 1OJHA 2EBOA 4I0XB 4MVRA 4LFBB 1PL0A 3ETEA 3ASNB 4GX1A 1XMOB 2Q5ZA 3T1HB 3CJHA 1TUBB 4YJ2B 2ZD9A 3J80N 2ARHA 5H5NA 2L35A 2GSMB 2KSDA 4NTWA 3L72H 3HPLC 2ZR3A 2ZM6B 4J80A 4LF4O 1X59A 3MHHC 3ZMVA 4CBCA 1EN5A 4R7CA 1Y4MA 5J9PC 2RDCA 4CS3A 2HG5C 2UU9B 4LCUC 1OCRB 1RFYA 2EULA 3U11A 4LH6A 4RUFA 2V7QG 4YIOA 1GM9A 1GM7A 4O2AA 1MSWD 3LSQA 2Y0IA 1CEZA 1OCOC 3CCSV 4NTYA 2IU0A 3JCUZ 3AG1B 3KCXA 1NR7A 2WLIA 1NR1A 2ILMA 1H38A 1K73W 3JSLA 4MT8A 3JD0A 1FJGO 2X6CA 4F6RB 2D2CB 2B1IA 1L0NH 3G80A 2AXTZ 2B9ZA 5GONB 4NTXA 1GN4A 4TT3G 4PELA 1N34B 2HHHO 2W6JG 1GO3F 2P67A 4CS4A 1I08A 4I50A 1BSMA 4O2BB 1H5WA 1B06A 4J9YB 2UXBB 3RWRD 2DN9A 2OIEA 2BTQB 5ITZB 2VQFO 5EBWC 3WB1A 3VQVA 3OAAG 1E1RG 3CYOA 1KD1W 4O4LB 5IDJA 1AJQA 2EINB 3GWOA 1KMIZ 1DLBA 3ZN0A 4C7UA 4UCOA 3OFNG 3E8HA 3ZHQA 3T2MA 1VP7A 2ZCEA 4KHPB 4A5UB 2IBZH 5KA6A 1KKCA 4JTDB 2VS0A 5H2FZ 1ZL8B 1Q81W 1PPJH 5JJEB 2WLLA 4LF9O 4HAMA 3K5LA 2M6YA 4LNUB 1UPGA 3DTUB 1VQ7V 4FJCC 3D36C 1ZUQA 3EVKA 1KP2A 3R65A 4U7NA 5H6QA 3SJQC 4DR1O 3A0RA 3UM7A 5B3SB 3B09A 3CX5F 2DQ3A 4EB6B 1F23A 1NTZH 2CTPA 2JGDB 3HKDB 4OX9O 3RVZA 4Z1VA 3D3IA 4DV5B 4DK0A 4UVCA 2DWEC 3C90A 1NT2B 2XAFA 1ZTEA 3BRCA 3DGEA 2YEVA 3DSQA 5LP6A 5LYJA 3K58A 2RMKB 2F1MA 2P4KA 4UB8Z 2CGNA 1G8MA 4LWSA 3FYEB 2C2AA 2GUZA 2LW1A 3SJAC 2HP8A 3APQA 2QWNB 1R3JC 3A0HZ 4LFBO 5KA5A 4IIJA 1Q7YW 2JJ1G 2F23A 2CAZC 2CTWA 1N4CA 4JPRA 1S5LZ 4JYAO 1XILA 3ZRSA 2P06A 5CBFA 1T5EA 2CH7A 1YI2V 4X1KA 4I55B 1US6A 3JAKA 1YTFD 3SR2C 4LF8B 1VMGA 3SPHA 2R9AA 3AG3B 4X66B 1R6TA 3E22B 3TXQA 4J10A 4R50A 3L70H 5CMUA 1WPBA 3CRMA 4FFBB 4JI4O 3N2KA 2EILB 1RSOA 1F7YA 5DM6V 3E83A 4AQYO 1YJ9V 1IXBA 3CCJV 4X1IA 1G4YB 1Z2GA 4O4JA 4PDMA 5KHKA 4DR3O 1DK1A 1IBMO 3W7WA 2JDIG 1OCCC 3U0ZA 3ICXA 1K3EA 3ABKB 4R8CA 4ZKIA 3SYOA 3HB3B 4H37A 5C8YB 1N36B 1QHTA 4O4HB 4WF9V 1NVPD 4JI1O 1SRYA 1GTOA 2GHYA 4Q6GA 1VQ6V 1Q43A 2XUMA 1HR0O 3N2GA 5LA6A 4LF5B 2OWOA 3VBBA 3ASNC 3ABUA 1SQVH 1RP3B 1MOFA 5CN0A 5KHIA 1KU9A 2JEXA 4DV1B 2E3CA 1XMQB 2LO1A 4TV8B 3WG7B 5E79Z 1N34O 3B77A 4WFHA 4J42A 5JH7A 1IURA 4X62O 3K79A 5GTIZ 1CXZB 4IHJB 4UFZA 2FKXA 5BR8B 3ZIAG 1N32B 4MVQA 3F7VC 3H1KH 1JFFB 1OCRC 4JV5O 2A9HA 2IJJA 1SA0B 2A7WA 4DV6B 3BCCH 3HKCB 2ZINA 2NLJC 1K5SA 2WSSG 3AK3A 2IW5A 3SJCC 4DV0B 1HWYA 4BIOA 4X1YA 3H01A 4ZI7A 3AG1C 5HFMA 1COWG 1WNSA 1H2KA 1WP8A 4FLVA 3MAQA 3LSSA 3Q4HA 3FD9A 1WP7A 3CRAA 3ZN1A 1YDXA 4MTOA 4DV2O 2XNDG 5EIBC 2Q9LA 1W0JG 3JATB 1NI8A 2AZ2A 1Y76A 2AW9A 4I9QA 4JI3O 3EXAA 3ML0A 4DV5O 1K9MW 3RBZA 1QVGU 3IAYA 1Y66A 3BPZA 4J7JA 3AK2A 3W7XA 2JS5A 1O9HA 1IBKB 5JCOA 2LFSA 1QNMA 2HVJC 1GH6A 1MA1A 4ZHQA 3K5NA 3UT5B 1Q3EA 3K04A 3JAMN 1XHZA 5L3DA 1BT8A 2OTLV 4CZZA 2QJ1A 2EINC 3OTFA 2QKCA 5HFLA 4TV9A 4UB6Z 3TJTA 4F4LA 5LXTA 2NNUA 3CCQV 2JK5C 4GT1A 4MVZA 1AR5A 2XAHA 4DV3O 4LBEC 4X20B 3JARA 2OIGA 4PDVA 3F5TA 3SJBC 3HKBB 4RAIA 5FLXN 4U3FH 3E2EA 3C3SA 3ZS8C 1BCCH 5IYBO 4HNAA 2ZE7A 2ZNJA 3JD3A 3ZHVA 3RYHA 2Q4PA 1SS3A 2EIMB 1K92A 4DR6O 1B04A 1NBMG 2F66C 3JAWB 2EIKB 5B3SC 3UO3A 2HLDG 4PA4A 2QKSA 4UVBA 1TGOA 3JD2A 3THOA 5JVDB 2DYRB 2DMXA 5IJ9B 4PV1B 2GTSA 1H2GA 4MW3A 3IGAC 1S3JA 4FM1A 5FPOA 1OHHG 3LDDA 3HKEB 4XDLA 1JMKC 4CH5A 3JASB 1FJGB 1N0JA 5J2UA 2HJDA 4K3AA 2FYUH 5JQGA 3CCLV 3STLC 1FFTB 3ZRVA 2ZT9B 2E76B 1BQZA 3E89A 2QWOB 2PI4A 4EEQA 3A0BZ 1YZBA 1M57B 2YIAA 2HHHB 2D3OW 3BA8A 4J7KA 2YC0A 4B3TO 1OZ0A 2CUGA 3S3WA 2QWPB 1LR1A 4DW1A 1GN3A 1YITV 2VQFB 3O9OA 1VEWA 1J5EO 4UXNA 2ZE5A 5LMNB 1TA8A 5CA0A 4NXNO 1LUVA 3AG3C 1K97A 2BSKA 4EFEA 3BA9A 5FNVA 2CTRA 4GX5A 4GKKO 4UCRA 4HBNA 2EILC 4LF9B 3QO5A 4WBNB 5LL6Y 5DECA 1YHQV 2QM7A 4WFFA 1EN4A 4P9OA 2B1GA 3W7SA 4DR1B 2Q0OC 4DV0O 3OE7G 4J41A 5L3EA 3CMEV 4I4TA 4JTAB 1ZWIC 3ABKC 4IYHA 3L9DA 2UXNA 5GTHZ 4MW8A 2YIDA 4DV4O 4K8ZA 1GKFA 3L73H 4OX9B 2E74B 2HFEC 1YTFB 4NXMO 1M9NA 5CB4B 3AK1A 2R70A 1FXHA 2ZDIC 1PD3A 3RYCA 2AHZA 5LOVA 1NH2B 5BMVA 2EZOA 2YIBA 2DOSA 4B08A 4JI0O 1K8AW 1NS1A 3WG7C 3LUTB 1N33O 4RUEA 2YI9A 3MHSC 2PY5A 2VWKA 4I9WA 4NR1A 1V54B 4X65O 3EHBB 2JJ2G 3T1YO 4UV8A 3HR0A 4CC6A 4DR2B 3E35A 2N05A 5JJNB 4FIPC 1NVPB 4JYAB 3OW2U 3CMAV 2E5LO 4N21A 2Z0AA 1IJGA 4FM0A 1XEQA 1EZVH 2DWDC 4BIZA 3H9VA 1FS0G 1JCHA 2G38A 1VQPV 1XL4A 4Q20A 2RCVA 3T4ZA 1SESA 2DE0X 2NR5A 1H2MA 2UUBO 3CWBH 3ZRXA 2YS8A 5KX5B 1P7GA 5IYZA 3ZJZA 1AP6A 4JI4B 1PM9A 2GBOA 1NU1H 2YI8A 1HNWB 3C3TA 4WFBV 4AQYB 3ETDA 3RT3C 1YF2A 4DR3B 1IBMB 2QWRB 5KUMA 2ZQMA 3IJ4A 1WA8A 2XASA 3DC6A 3VQXA 3H1IH 4JGSA 2JEUA 2QGNA 4LFCO 4UCTA 1ROPA 4MVUA 2BTOA 4JI1B 4ZOLA 3D8CA 1HR0B 1M1KW 1Y67A 5LHIA 4DO2A 2VRZA 5E1AC 2PF4E 5LYJB 5IYDO 3A2FA 2Q69A 4AHCA 3CCVV 5KHHA 4J7ZA 1VF6C 1Y74A 4FK5C 1AVMA 4JTCB 1M4UA 3I56V 4BR6A 1IXMA 2Q68A 2A06H 5IWAO 3UO2A 2XHBA 1D5AA 4I5SA 4X62B 3VQYA 1W2BU 4IIJB 2XAGA 2FB5A 4B7KA 3JALA 3OMIB 4JV5B 2EIMC 2R9RB 4DW0A 2WLHA 5LMNO 2EIKC 2H8PC 2XOKG 1FPOA 1F51A 1SQBH 4LF7B 3JAKB 5A9GA 4I0XA 4G2KA 2ZXWB 4GUNA 2DYRC 1FXVA 1JA8A 3ABMB 2P7TC 2LQTA 1S72V 4RQFA 3BABA 4FLXA 2UXDB 4UVAA 2BOCC 4AILC 4YJ2A 5IY5B 4ICGA 1Q5OA 4YY3O 3CXHF 4GCZA 4DV2B 2X6AA 4O4JB 5D5QA 4KXRA 3CC2V 3OT7A 3RYIB 1F4NA 3CEIA 4JI6B 1LNQA 2FTKA 4JI3B 3OD4A 1SQFA 3DC5A 1M57C 1Z5VA 4B3MO 2DYSB 4UCSA 4U3JA 1VQNV 5BXZA 2P6JA 2OT5A 3ZBHA 1VF5B 3AEIA 4Z1MG 1UFIA 2JRIA 2XAJA 1KYOF 4X64O 3F7YC 3P30A 1WB8A 3SPGA 1OV9A 3LNNA 5FL7G 1KB9F 2R72A 2PI5A 4W4LA 4DR2O 5DN6G 4F6RA 4DV3B 3GVMA 1QCEA 2WLMA 3B4SA 1UJWB 1Q6IA 1I0HA 1XHXA 3K5MA 2K1EA 2ZE8A 4PDLA 1QU7A 3P3PA 3CRRA 2QTSA 2O57A 4LF6O 4DR6B 4GLXA 3PJSK 4O2BA 1FAFA 5IT9N 1BQ0A 2YICA 3SYPA 4UCVA 2PYJA 1PL4A 1E79G 3FB7C 2YUAA 4K0KO 4QE7A 5H6RA 4FZ1A 3E8GA 1NJIW 1PNKA 3Q4HB 2Z5UA 2WAMA 3B8MA 2JS3A 2X0LA 1FFXB 1XUQA 3U10A 4DRXA 1HNWO 2QSAA 3H1HH 3BHPA 3LDEA 4JZGA 1S76D 2WLJA 1ZL8A 1O9GA 4DV7O 1B6QA 2PTMA 4Z2WA 4NVPA 4LNUA 1V54C 1E1QG 1AJPA 4YJ3A 4I7ZB 2WA3A 4HZ3A 3K57A 2RQ6A 1NQTA 3KG2A 5IJ0B 2QWQB 4XBFA 3L75H 4B3TB 1SETA 4EB6A 4GX0A 4FFKA 4ZHQB 3ASOB 4DUYO 1KC8W 2JGDA 3HKDA 1YEWA 2JGUA 3CRCA 2Q8VA 1J5EB 2KB1A 2K9PA 4PD4F 4RQEA 1SQPH 4TV9B 1VQ5V 2ITDC 2JVDA 3DXRB 5DEDA 4ZIBA 4NXNB 3IC7A 2Q73A 1VF7A 3ZMSA 4EKWA 1FYJA 4ABMA 4QE9A 1YIJV 1Q86W 3ZMTA 4GKKB 3AG4B 4YIPA 4HNAB 4X9QA 5CBGA 2Z3YA 1PKXA 4TUYA 3BY6A 5J2TB 1HW7A 2W0FC 3QO8A 4LF7O 2YXLA 3RYFB 1A32A 3L74H 1K33A 1TAEA 3KZIZ 3R66A 2X7RB 4BAYA 1PNLA 1BE3H 1HNZB 1MMMA 4LP8A 1XI1A 2RJZA 3BFRA 2UXDO 4DV4B 4JAVA 3IC9A 2V4DA 1I94O 1VQ9V 4NXMB 1GN2A 5B1AB 2Y4TA 1K34A 1MZFA 4PA7A 1BHAA 3OEEG 1GK9A 3E22A 3OTOO 2Y0PA 3TK1A 4JI0B 3B8NA 4JI6O 2EIJB 5JQGB 1N33B 5B1OA 1Q6UA 1P84F 5LMUO 3BAAA 4UUJC 2X6BA 1QVFU 4D6TH 4DXWA 4X65B 4LFAO 3L71H 1FXKB 3T1YB 3ZRWB 1MNGA 1R3IC 1JOYA 1Q6HA 4H33A 5EYPB 1Q82W 3T4DA 5C8YA 3WU2Z 4O4HA 3QO7A 1JX9A 2CGOA 1SF9A 2E5LB 3FB6C 4WFGA 2ZXWC 3JYCA 4PI2A 5CA0B 2H94A 3ABMC 1TVKA 1M93A 3RGBA 2ZDIA 2UUAO 2AHYA 4JI2B 3T1CA 4QJFB 4TV8A 1R6KA 2UUBB 5IY5C 5KMGA 4GKJO 1AR4A 2XAQA 4JYBA 3CCMV 3FAVA 3QNEA 1H8EG 4IHJA 3G4SV 4JZ2A
chains in the Genus database with same CATH topology
2GDSA 1KKCA 3QVNA 2ADQB 3KKYA 1LUWA 1EN5A 2AW9A 1IXBA 1MMMA 4F6EA 3BFRA 1ZUQA 3EVKA 1PL4A 3IC9A 3K9SA 3AK2A 5A9GA 1GN2A 1XREA 4YIOA 3MDSA 4GUNA 1QNMA 1GN3A 1D5NA 1MSDA 1JA8A 1VEWA 2ADPA 1AP5A 1GN6A 1MA1A 1XDCA 1XUQA 1BT8A 2QKAA 1LUVA 2RCVA 1I0HA 1ZLZA 2CDYA 2QKCA 3TJTA 4JZGA 3KDRA 1P7GA 1ZTEA 1ZSPA 1AP6A 1PM9A 3LSUA 1AR5A 2P4KA 1SZXA 3OT7A 3C3TA 1EN6A 1MNGA 1N0NA 3CEIA 1IDSA 3C3SA 1EN4A 3DC5A 4E4EA 1WB7A 4FFKA 3DC6A 5AG2A 1GN4A 2CE4A 1JR9A 4JYYA 1I08A 1IX9A 1BSMA 1B06A 3AK3A 1XILA 1Y67A 1EM1A 1BS3A 1VARA 3RN4A 1WB8A 3AK1A 1AVMA 1AR4A 4BR6A 4YIPA 4X9QA 4C7UA 1N0JA 4JZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDS A;  1KKC A;  3QVN A;  2ADQ B;  3KKY A;  1LUW A;  1EN5 A;  2AW9 A;  1IXB A;  1MMM A;  4F6E A;  3BFR A;  1ZUQ A;  3EVK A;  1PL4 A;  3IC9 A;  3K9S A;  3AK2 A;  5A9G A;  1GN2 A;  1XRE A;  4YIO A;  3MDS A;  4GUN A;  1QNM A;  1GN3 A;  1D5N A;  1MSD A;  1JA8 A;  1VEW A;  2ADP A;  1AP5 A;  1GN6 A;  1MA1 A;  1XDC A;  1XUQ A;  1BT8 A;  2QKA A;  1LUV A;  2RCV A;  1I0H A;  1ZLZ A;  2CDY A;  2QKC A;  3TJT A;  4JZG A;  1P7G A;  1ZTE A;  1ZSP A;  1AP6 A;  1PM9 A;  3LSU A;  1AR5 A;  2P4K A;  1SZX A;  3OT7 A;  3C3T A;  1EN6 A;  1MNG A;  1N0N A;  3CEI A;  1IDS A;  3C3S A;  1EN4 A;  3DC5 A;  4E4E A;  1WB7 A;  4FFK A;  3DC6 A;  5AG2 A;  1GN4 A;  2CE4 A;  1JR9 A;  4JYY A;  1I08 A;  1IX9 A;  1BSM A;  1B06 A;  3AK3 A;  1XIL A;  1Y67 A;  1EM1 A;  1BS3 A;  1VAR A;  3RN4 A;  1WB8 A;  3AK1 A;  1AVM A;  1AR4 A;  4BR6 A;  4YIP A;  4X9Q A;  4C7U A;  1N0J A;  4JZ2 A; 
#chains in the Genus database with same CATH topology
 1ZX3 A;  4CH3 A;  1JFF A;  5L3F A;  1ZAU A;  1LUW A;  3NR7 A;  1MG1 A;  2KG7 A;  3MD0 A;  2BCC H;  2DYS C;  3HKC A;  3X2Q B;  4FLT A;  2Q0A A;  3H1L H;  4LFC B;  2V1D A;  1AI5 A;  1JVM A;  5EZY A;  2UXX A;  2OCH A;  4X8A A;  3ZHT A;  1RM1 B;  2ZIM A;  2IU3 A;  4UCU A;  3OR7 C;  2QDO A;  3CCR V;  1AP5 A;  3PN1 A;  1XDC A;  2B5U A;  3WFV A;  4IT5 A;  4D7S A;  3E86 A;  3K9A A;  2DQ0 A;  1HNX O;  4PJ0 Z;  4HYO A;  1ZLZ A;  1IVS A;  5IWA B;  3JSN A;  2F43 G;  4PHZ A;  2ODM A;  4O4I A;  2Y4U A;  3JAT A;  5KUK A;  2RNB A;  4FLU A;  2AGA A;  2PZS A;  3CP1 A;  2P5O A;  3CJH B;  1V9P A;  2R9I A;  3UCS C;  1B3Q A;  3JD4 A;  2FL4 A;  2GTA A;  4IYI A;  3GB7 C;  5B1B B;  1Z5W A;  2A3Q A;  3BEH A;  4CH6 A;  4UV9 A;  4FM2 A;  3E8F A;  2F95 B;  1XNR O;  2ATK C;  1VQL V;  1VF6 A;  1EM1 A;  1VAR A;  1EFR G;  3FB5 C;  2Q67 A;  4H44 B;  2QEX V;  4YY3 B;  4O2A B;  4X20 A;  4XDK A;  1V55 B;  4QGP A;  4WFA V;  3HKB A;  1HNZ O;  2UXC O;  1XBL A;  4LH7 A;  1L8D A;  3QTC A;  1WA8 B;  3ETQ A;  2WLI B;  2UUC O;  3CE2 A;  4B3M B;  1KQS U;  3K06 A;  1DGS A;  4DR4 O;  3CS5 A;  1IBL O;  5F2V O;  4ZOL B;  2BOB C;  1DTO A;  3K03 A;  2RN9 A;  4FMT A;  4FLZ A;  5KHJ A;  3ASO C;  5JVD A;  2ZR2 A;  4WCE V;  1H8H G;  3ZHU A;  4LR3 A;  2Q6A A;  2W6I G;  4LC1 A;  1Q8I A;  3ABL B;  1K7D A;  2WLN A;  2QR4 A;  1AIL A;  4P30 A;  4X64 B;  1BZK A;  5JWP A;  1HP8 A;  2NN4 A;  1GN6 A;  4JI8 O;  3HKE A;  4PA9 A;  1NZ6 A;  1KEC A;  3D36 A;  3JAS A;  4I50 B;  2QKA A;  1FD9 A;  4OPH A;  3F5W C;  3AG4 C;  5IYC O;  3SGI A;  1SQX H;  1QLN A;  1YSC A;  4WFE A;  3CPW U;  1M5I A;  4LF6 B;  1FKA O;  1HDJ A;  1P7B A;  4NB5 A;  5CA1 A;  4B7E A;  3FB8 C;  4H13 B;  4JI2 O;  2F4V O;  4K0K B;  4N23 A;  3LNM B;  2PGG A;  1CPY A;  2WLL B;  5EC1 C;  4JYY A;  5B1A C;  2HEP A;  3LDC A;  2LGQ A;  1IX9 A;  5LGU A;  2GV9 A;  3OGC C;  4G27 B;  4JAA A;  4MS2 A;  4BWA A;  1GAX A;  1JNB A;  5CA3 A;  1BS3 A;  2MW2 B;  4QIW F;  1S0V A;  1SKV A;  5EK0 A;  2EIJ C;  5LBQ A;  4OPA A;  1SER A;  3OUF A;  4ZBM A;  4DV7 B;  5KAI Z;  4J11 A;  3K08 A;  4WBN A;  2W0X A;  2LP7 A;  4DR7 O;  1FXK C;  1R3L C;  3ZX6 A;  4U3J B;  2IJK A;  3M99 B;  1BL8 A;  3QVN A;  2YEV B;  4JI5 O;  5LP6 B;  1MAB G;  3QG5 A;  5KLV H;  4B3S O;  4CC5 A;  4DUY B;  1EZJ A;  3OGI B;  4F6E A;  4TQD A;  3CCE V;  4B3R O;  4LWS B;  4JF3 A;  5CB4 A;  2GUZ B;  3SPJ A;  1I7F A;  1ENV A;  2LW7 A;  1JQ0 A;  5LHH A;  4TSF G;  2Q7E A;  4NYK A;  4KUM A;  2P4V A;  1JJO A;  3WB0 A;  4TQF A;  1ARO P;  1QR9 A;  2AZ0 A;  5JJJ B;  5IE9 A;  3E8B A;  4X88 A;  2EZP A;  2CH7 B;  2ZKO A;  4X1K B;  3CXC U;  1PV0 A;  1WLE A;  3TCU A;  4MVM A;  4NKG B;  3LSU A;  3W7T A;  3ZHS A;  1W59 A;  1X4T A;  3P32 A;  3AG2 B;  1QR8 A;  3X2Q C;  4MTX A;  2YIB D;  1TUB A;  4MVO A;  1I94 B;  4YXW G;  3N2K B;  1XQ8 A;  1RM1 C;  1DF4 A;  1RSO B;  4DRX B;  3EFF K;  4U7O A;  3CRQ A;  2VQE B;  4IGG A;  4X1I B;  5KHG A;  4QPK A;  2L6L A;  1R73 A;  3OTO B;  1WAZ A;  3WB2 A;  1SQQ H;  5KX5 A;  3OMA B;  5LMU B;  1P49 A;  4YJ3 B;  3ZCC A;  1G6U A;  3A8T A;  4OGQ B;  1SC5 B;  5TIS Z;  4LFA B;  4DR5 O;  2E75 B;  3G6B A;  3N2G B;  5LA6 B;  2QTO A;  2HVK C;  2IM9 A;  2EX3 A;  1XNQ O;  1KP3 A;  4GZR B;  1OCZ B;  2F93 B;  5KAF Z;  4DUZ O;  2CK3 G;  1G1X B;  1VIB A;  1R1B A;  1AR1 B;  4FLY A;  2OCC B;  5B1B C;  5JH7 B;  1M56 B;  3CC7 V;  3JCZ A;  1BGY H;  3G67 A;  3S3X A;  4R6Z A;  5B1N A;  3K9S A;  1VQM V;  2UUA B;  3J81 N;  1D5N A;  4D7T A;  4J9Z B;  5B5E Z;  3UKM A;  5GON A;  2Q7H A;  4TUY B;  4GKJ B;  4JI7 O;  5C93 A;  1N8R W;  3OUS A;  3SDL A;  3OR6 C;  2QM4 A;  1YCI A;  1AB3 A;  1V55 C;  2N04 A;  1I5X A;  4X1Y B;  5A2Q N;  2LFR A;  1Q90 D;  4ZI7 B;  2HJF C;  2BTQ A;  4FPP A;  5ITZ A;  1XMO O;  3P3N A;  2JIZ G;  2IH3 C;  3T1H O;  3VQW A;  5LHG A;  3CD6 V;  2WLK A;  1EN6 A;  4O4L A;  3K59 A;  2BE3 A;  2MK3 A;  3TET A;  3UQ8 A;  4E4E A;  4CH4 A;  2ZM6 O;  3D3Q A;  1EBO A;  2XTA A;  2H3O A;  3FX7 A;  3AG7 A;  3ZHR A;  1JJ2 U;  3ABL C;  1Y76 B;  2PUS A;  1NH2 D;  2UU9 O;  5L3B A;  3G6E V;  5EBM C;  1R6N A;  2HR3 A;  2OYQ A;  1HNX B;  3IFX A;  3FKS G;  2YXH A;  4JAS A;  1QBZ A;  1YVW A;  5L3G A;  1AI6 A;  3VOU A;  4EFB A;  3RFR A;  1BMF G;  2LGW A;  5EBL C;  3RYI A;  4KP4 A;  2ZE6 A;  3N27 A;  2KQX A;  4OXS A;  2XT9 A;  1JPX A;  3CSX A;  1QLE B;  1K5Q A;  4MSW C;  3ETG A;  5LXT B;  4XDJ A;  3JD1 A;  1BHB A;  4GYC B;  5L3C A;  1TVK B;  3W7U A;  2QA4 V;  4TOI A;  1F4M A;  3JAR B;  3K3W A;  2PYL A;  3RVY A;  4G28 B;  3ZMZ A;  1K4D C;  4CS2 A;  2OTJ V;  1SZT A;  2Y69 B;  1GRJ A;  4PA3 A;  1XNR B;  5KMG B;  1XL6 A;  3RYH B;  3MDS A;  1W0K G;  2ZIO A;  5LGT A;  4X89 A;  3B40 A;  2ADP A;  4KL1 A;  3FAV B;  3M7M X;  2UXB O;  1GMG A;  4JYC A;  5H9C A;  5CBH A;  4DK1 A;  2IH1 C;  2UXC B;  1R3K C;  4FVM A;  4JAU A;  1GM8 A;  2KG7 B;  3SPI A;  2QM8 A;  2UUC B;  1VQ4 V;  1YXB A;  4I55 A;  1Y6X A;  3CC4 V;  5EZY B;  1RPR A;  1SZX A;  3SYA A;  1M90 W;  4DR4 B;  3G71 V;  1IBL B;  1KBH A;  2WPD G;  5LP6 C;  2VQE O;  4KHP O;  4MTF A;  3O65 A;  1VQ8 V;  2Y48 A;  5J2U B;  5K1P A;  3K0G A;  1AI7 A;  3OEH G;  4RWU A;  5EC2 C;  5EIB D;  5GW7 A;  3QF7 A;  4FFB A;  3K0D A;  1FFX A;  2ETN A;  2ITC C;  4JI8 B;  5K1X A;  4YHH B;  5LGN A;  2FML A;  1VQK V;  4O4I B;  1I5Y A;  1WN7 A;  1L1F A;  3RN4 A;  1OCO B;  3NXS A;  1AJN A;  4PA6 A;  2Q7G A;  3SYC A;  1KKD A;  4H0L B;  5IJ0 A;  2BSK B;  4QPJ A;  3AG2 C;  5B66 Z;  4K35 A;  5FNV B;  4BIU A;  2DW4 A;  2F4V B;  2YDE A;  3I5D A;  4W4K A;  3SYQ A;  4P2Z A;  2HKO A;  3ZMU A;  3DXR A;  4DYL A;  4K8X A;  1CP9 A;  4BW5 A;  1YJN V;  4LF4 B;  4I4T B;  1WJZ A;  4FLW A;  1U97 A;  1SA0 A;  3TGU H;  2DJV A;  5J2T A;  3I55 V;  1XOU A;  3RYF A;  4ASU G;  4DR7 B;  2P22 C;  2A0L A;  1S5H C;  4LF8 O;  1H2S B;  3KDR A;  2QE7 G;  2WWW A;  1ZSP A;  2IJH A;  3RYC B;  4X66 O;  4GX2 A;  1URF A;  5LOV B;  1P4R A;  1J95 A;  5BMV B;  1L0L H;  4JI5 B;  2KKW A;  4E2L A;  2EJR A;  4B3S B;  1N0N A;  4RO2 A;  3M8A A;  1OCZ C;  2YXY A;  1IDS A;  2WA4 A;  3OM3 B;  4B3R B;  2OCC C;  1M56 C;  4L8J A;  2EJ7 A;  1WB7 A;  2N74 A;  1QQC A;  3SPC A;  2P90 A;  3FFQ A;  3STZ C;  1NTM H;  4QNH B;  2ZNI A;  5FPR A;  1N36 O;  1KUQ A;  1YJW V;  2M7W A;  1PNM A;  5D5P A;  1FOU A;  1FXK A;  1AI4 A;  1NTK H;  1RPO A;  3ZRW A;  3GWK C;  4LF5 O;  3CHX A;  5BY1 A;  2YSU B;  5CA1 B;  5EYP A;  3UT5 A;  1S5J A;  4DV1 O;  5BZB A;  1XMQ O;  2A79 B;  2GDS A;  1D2D A;  2ADQ B;  1DF5 A;  3ZED A;  1K4C C;  3KKY A;  5IYZ B;  1VQO V;  4P9P A;  4FZ0 A;  1H2L A;  3H1J H;  5BR8 O;  4BW9 A;  3OMN B;  1N32 O;  1PP9 H;  2VWJ A;  1XRE A;  3ABT A;  1MSD A;  1S77 D;  4DV6 O;  3CCU V;  2IJI A;  3B2E E;  5JCO C;  3JAW A;  1SQG A;  4DR5 B;  2LJ2 A;  4PDR A;  2CDY A;  4PI0 A;  4MTG A;  1ORQ C;  4IL6 Z;  3K5O A;  4AI8 A;  1XNQ B;  1TUE B;  5IJ9 A;  1QLE C;  4MVS A;  1U96 A;  1Y74 B;  1NKD A;  4DUZ B;  4KFM A;  4YHH O;  1THZ A;  3J7A U;  3TXS A;  3RW0 A;  3FYI B;  3KCY A;  5AG2 A;  1MZE A;  4L87 A;  2CE4 A;  3BVO A;  2Y69 C;  1IZ3 A;  4TWK A;  1OCC B;  3JAL B;  2CTQ A;  1JR9 A;  3APO A;  3CB2 A;  4JI7 B;  1WPX A;  1H2N A;  1IBK O;  1OJH A;  2EBO A;  4I0X B;  4MVR A;  4LFB B;  1PL0 A;  3ETE A;  3ASN B;  4GX1 A;  1XMO B;  2Q5Z A;  3T1H B;  3CJH A;  1TUB B;  4YJ2 B;  2ZD9 A;  3J80 N;  2ARH A;  5H5N A;  2L35 A;  2GSM B;  2KSD A;  4NTW A;  3L72 H;  3HPL C;  2ZR3 A;  2ZM6 B;  4J80 A;  4LF4 O;  1X59 A;  3MHH C;  3ZMV A;  4CBC A;  1EN5 A;  4R7C A;  1Y4M A;  5J9P C;  2RDC A;  4CS3 A;  2HG5 C;  2UU9 B;  4LCU C;  1OCR B;  1RFY A;  2EUL A;  3U11 A;  4LH6 A;  4RUF A;  2V7Q G;  4YIO A;  1GM9 A;  1GM7 A;  4O2A A;  1MSW D;  3LSQ A;  2Y0I A;  1CEZ A;  1OCO C;  3CCS V;  4NTY A;  2IU0 A;  3JCU Z;  3AG1 B;  3KCX A;  1NR7 A;  2WLI A;  1NR1 A;  2ILM A;  1H38 A;  1K73 W;  3JSL A;  4MT8 A;  3JD0 A;  1FJG O;  2X6C A;  4F6R B;  2D2C B;  2B1I A;  1L0N H;  3G80 A;  2AXT Z;  2B9Z A;  5GON B;  4NTX A;  1GN4 A;  4TT3 G;  4PEL A;  1N34 B;  2HHH O;  2W6J G;  1GO3 F;  2P67 A;  4CS4 A;  1I08 A;  4I50 A;  1BSM A;  4O2B B;  1H5W A;  1B06 A;  4J9Y B;  2UXB B;  3RWR D;  2DN9 A;  2OIE A;  2BTQ B;  5ITZ B;  2VQF O;  5EBW C;  3WB1 A;  3VQV A;  3OAA G;  1E1R G;  3CYO A;  1KD1 W;  4O4L B;  5IDJ A;  1AJQ A;  2EIN B;  3GWO A;  1KMI Z;  1DLB A;  3ZN0 A;  4C7U A;  4UCO A;  3OFN G;  3E8H A;  3ZHQ A;  3T2M A;  1VP7 A;  2ZCE A;  4KHP B;  4A5U B;  2IBZ H;  5KA6 A;  1KKC A;  4JTD B;  2VS0 A;  5H2F Z;  1ZL8 B;  1Q81 W;  1PPJ H;  5JJE B;  2WLL A;  4LF9 O;  4HAM A;  3K5L A;  2M6Y A;  4LNU B;  1UPG A;  3DTU B;  1VQ7 V;  4FJC C;  3D36 C;  1ZUQ A;  3EVK A;  1KP2 A;  3R65 A;  4U7N A;  5H6Q A;  3SJQ C;  4DR1 O;  3A0R A;  3UM7 A;  5B3S B;  3B09 A;  3CX5 F;  2DQ3 A;  4EB6 B;  1F23 A;  1NTZ H;  2CTP A;  2JGD B;  3HKD B;  4OX9 O;  3RVZ A;  4Z1V A;  3D3I A;  4DV5 B;  4DK0 A;  4UVC A;  2DWE C;  3C90 A;  1NT2 B;  2XAF A;  1ZTE A;  3BRC A;  3DGE A;  2YEV A;  3DSQ A;  5LP6 A;  5LYJ A;  3K58 A;  2RMK B;  2F1M A;  2P4K A;  4UB8 Z;  2CGN A;  1G8M A;  4LWS A;  3FYE B;  2C2A A;  2GUZ A;  2LW1 A;  3SJA C;  2HP8 A;  3APQ A;  2QWN B;  1R3J C;  3A0H Z;  4LFB O;  5KA5 A;  4IIJ A;  1Q7Y W;  2JJ1 G;  2F23 A;  2CAZ C;  2CTW A;  1N4C A;  4JPR A;  1S5L Z;  4JYA O;  1XIL A;  3ZRS A;  2P06 A;  5CBF A;  1T5E A;  2CH7 A;  1YI2 V;  4X1K A;  4I55 B;  1US6 A;  3JAK A;  1YTF D;  3SR2 C;  4LF8 B;  1VMG A;  3SPH A;  2R9A A;  3AG3 B;  4X66 B;  1R6T A;  3E22 B;  3TXQ A;  4J10 A;  4R50 A;  3L70 H;  5CMU A;  1WPB A;  3CRM A;  4FFB B;  4JI4 O;  3N2K A;  2EIL B;  1RSO A;  1F7Y A;  5DM6 V;  3E83 A;  4AQY O;  1YJ9 V;  1IXB A;  3CCJ V;  4X1I A;  1G4Y B;  1Z2G A;  4O4J A;  4PDM A;  5KHK A;  4DR3 O;  1DK1 A;  1IBM O;  3W7W A;  2JDI G;  1OCC C;  3U0Z A;  3ICX A;  1K3E A;  3ABK B;  4R8C A;  4ZKI A;  3SYO A;  3HB3 B;  4H37 A;  5C8Y B;  1N36 B;  1QHT A;  4O4H B;  4WF9 V;  1NVP D;  4JI1 O;  1SRY A;  1GTO A;  2GHY A;  4Q6G A;  1VQ6 V;  1Q43 A;  2XUM A;  1HR0 O;  3N2G A;  5LA6 A;  4LF5 B;  2OWO A;  3VBB A;  3ASN C;  3ABU A;  1SQV H;  1RP3 B;  1MOF A;  5CN0 A;  5KHI A;  1KU9 A;  2JEX A;  4DV1 B;  2E3C A;  1XMQ B;  2LO1 A;  4TV8 B;  3WG7 B;  5E79 Z;  1N34 O;  3B77 A;  4WFH A;  4J42 A;  5JH7 A;  1IUR A;  4X62 O;  3K79 A;  5GTI Z;  1CXZ B;  4IHJ B;  4UFZ A;  2FKX A;  5BR8 B;  3ZIA G;  1N32 B;  4MVQ A;  3F7V C;  3H1K H;  1JFF B;  1OCR C;  4JV5 O;  2A9H A;  2IJJ A;  1SA0 B;  2A7W A;  4DV6 B;  3BCC H;  3HKC B;  2ZIN A;  2NLJ C;  1K5S A;  2WSS G;  3AK3 A;  2IW5 A;  3SJC C;  4DV0 B;  1HWY A;  4BIO A;  4X1Y A;  3H01 A;  4ZI7 A;  3AG1 C;  5HFM A;  1COW G;  1WNS A;  1H2K A;  1WP8 A;  4FLV A;  3MAQ A;  3LSS A;  3Q4H A;  3FD9 A;  1WP7 A;  3CRA A;  3ZN1 A;  1YDX A;  4MTO A;  4DV2 O;  2XND G;  5EIB C;  2Q9L A;  1W0J G;  3JAT B;  1NI8 A;  2AZ2 A;  1Y76 A;  2AW9 A;  4I9Q A;  4JI3 O;  3EXA A;  3ML0 A;  4DV5 O;  1K9M W;  3RBZ A;  1QVG U;  3IAY A;  1Y66 A;  3BPZ A;  4J7J A;  3AK2 A;  3W7X A;  2JS5 A;  1O9H A;  1IBK B;  5JCO A;  2LFS A;  1QNM A;  2HVJ C;  1GH6 A;  1MA1 A;  4ZHQ A;  3K5N A;  3UT5 B;  1Q3E A;  3K04 A;  3JAM N;  1XHZ A;  5L3D A;  1BT8 A;  2OTL V;  4CZZ A;  2QJ1 A;  2EIN C;  3OTF A;  2QKC A;  5HFL A;  4TV9 A;  4UB6 Z;  3TJT A;  4F4L A;  5LXT A;  2NNU A;  3CCQ V;  2JK5 C;  4GT1 A;  4MVZ A;  1AR5 A;  2XAH A;  4DV3 O;  4LBE C;  4X20 B;  3JAR A;  2OIG A;  4PDV A;  3F5T A;  3SJB C;  3HKB B;  4RAI A;  5FLX N;  4U3F H;  3E2E A;  3C3S A;  3ZS8 C;  1BCC H;  5IYB O;  4HNA A;  2ZE7 A;  2ZNJ A;  3JD3 A;  3ZHV A;  3RYH A;  2Q4P A;  1SS3 A;  2EIM B;  1K92 A;  4DR6 O;  1B04 A;  1NBM G;  2F66 C;  3JAW B;  2EIK B;  5B3S C;  3UO3 A;  2HLD G;  4PA4 A;  2QKS A;  4UVB A;  1TGO A;  3JD2 A;  3THO A;  5JVD B;  2DYR B;  2DMX A;  5IJ9 B;  4PV1 B;  2GTS A;  1H2G A;  4MW3 A;  3IGA C;  1S3J A;  4FM1 A;  5FPO A;  1OHH G;  3LDD A;  3HKE B;  4XDL A;  1JMK C;  4CH5 A;  3JAS B;  1FJG B;  1N0J A;  5J2U A;  2HJD A;  4K3A A;  2FYU H;  5JQG A;  3CCL V;  3STL C;  1FFT B;  3ZRV A;  2ZT9 B;  2E76 B;  1BQZ A;  3E89 A;  2QWO B;  2PI4 A;  4EEQ A;  3A0B Z;  1YZB A;  1M57 B;  2YIA A;  2HHH B;  2D3O W;  3BA8 A;  4J7K A;  2YC0 A;  4B3T O;  1OZ0 A;  2CUG A;  3S3W A;  2QWP B;  1LR1 A;  4DW1 A;  1GN3 A;  1YIT V;  2VQF B;  3O9O A;  1VEW A;  1J5E O;  4UXN A;  2ZE5 A;  5LMN B;  1TA8 A;  5CA0 A;  4NXN O;  1LUV A;  3AG3 C;  1K97 A;  2BSK A;  4EFE A;  3BA9 A;  5FNV A;  2CTR A;  4GX5 A;  4GKK O;  4UCR A;  4HBN A;  2EIL C;  4LF9 B;  3QO5 A;  4WBN B;  5LL6 Y;  5DEC A;  1YHQ V;  2QM7 A;  4WFF A;  1EN4 A;  4P9O A;  2B1G A;  3W7S A;  4DR1 B;  2Q0O C;  4DV0 O;  3OE7 G;  4J41 A;  5L3E A;  3CME V;  4I4T A;  4JTA B;  1ZWI C;  3ABK C;  4IYH A;  3L9D A;  2UXN A;  5GTH Z;  4MW8 A;  2YID A;  4DV4 O;  4K8Z A;  1GKF A;  3L73 H;  4OX9 B;  2E74 B;  2HFE C;  1YTF B;  4NXM O;  1M9N A;  5CB4 B;  3AK1 A;  2R70 A;  1FXH A;  2ZDI C;  1PD3 A;  3RYC A;  2AHZ A;  5LOV A;  1NH2 B;  5BMV A;  2EZO A;  2YIB A;  2DOS A;  4B08 A;  4JI0 O;  1K8A W;  1NS1 A;  3WG7 C;  3LUT B;  1N33 O;  4RUE A;  2YI9 A;  3MHS C;  2PY5 A;  2VWK A;  4I9W A;  4NR1 A;  1V54 B;  4X65 O;  3EHB B;  2JJ2 G;  3T1Y O;  4UV8 A;  3HR0 A;  4CC6 A;  4DR2 B;  3E35 A;  2N05 A;  5JJN B;  4FIP C;  1NVP B;  4JYA B;  3OW2 U;  3CMA V;  2E5L O;  4N21 A;  2Z0A A;  1IJG A;  4FM0 A;  1XEQ A;  1EZV H;  2DWD C;  4BIZ A;  3H9V A;  1FS0 G;  1JCH A;  2G38 A;  1VQP V;  1XL4 A;  4Q20 A;  2RCV A;  3T4Z A;  1SES A;  2DE0 X;  2NR5 A;  1H2M A;  2UUB O;  3CWB H;  3ZRX A;  2YS8 A;  5KX5 B;  1P7G A;  5IYZ A;  3ZJZ A;  1AP6 A;  4JI4 B;  1PM9 A;  2GBO A;  1NU1 H;  2YI8 A;  1HNW B;  3C3T A;  4WFB V;  4AQY B;  3ETD A;  3RT3 C;  1YF2 A;  4DR3 B;  1IBM B;  2QWR B;  5KUM A;  2ZQM A;  3IJ4 A;  1WA8 A;  2XAS A;  3DC6 A;  3VQX A;  3H1I H;  4JGS A;  2JEU A;  2QGN A;  4LFC O;  4UCT A;  1ROP A;  4MVU A;  2BTO A;  4JI1 B;  4ZOL A;  3D8C A;  1HR0 B;  1M1K W;  1Y67 A;  5LHI A;  4DO2 A;  2VRZ A;  5E1A C;  2PF4 E;  5LYJ B;  5IYD O;  3A2F A;  2Q69 A;  4AHC A;  3CCV V;  5KHH A;  4J7Z A;  1VF6 C;  1Y74 A;  4FK5 C;  1AVM A;  4JTC B;  1M4U A;  3I56 V;  4BR6 A;  1IXM A;  2Q68 A;  2A06 H;  5IWA O;  3UO2 A;  2XHB A;  1D5A A;  4I5S A;  4X62 B;  3VQY A;  1W2B U;  4IIJ B;  2XAG A;  2FB5 A;  4B7K A;  3JAL A;  3OMI B;  4JV5 B;  2EIM C;  2R9R B;  4DW0 A;  2WLH A;  5LMN O;  2EIK C;  2H8P C;  2XOK G;  1FPO A;  1F51 A;  1SQB H;  4LF7 B;  3JAK B;  5A9G A;  4I0X A;  4G2K A;  2ZXW B;  4GUN A;  2DYR C;  1FXV A;  1JA8 A;  3ABM B;  2P7T C;  2LQT A;  1S72 V;  4RQF A;  3BAB A;  4FLX A;  2UXD B;  4UVA A;  2BOC C;  4AIL C;  4YJ2 A;  5IY5 B;  4ICG A;  1Q5O A;  4YY3 O;  3CXH F;  4GCZ A;  4DV2 B;  2X6A A;  4O4J B;  5D5Q A;  4KXR A;  3CC2 V;  3OT7 A;  3RYI B;  1F4N A;  3CEI A;  4JI6 B;  1LNQ A;  2FTK A;  4JI3 B;  3OD4 A;  1SQF A;  3DC5 A;  1M57 C;  1Z5V A;  4B3M O;  2DYS B;  4UCS A;  4U3J A;  1VQN V;  5BXZ A;  2P6J A;  2OT5 A;  3ZBH A;  1VF5 B;  3AEI A;  4Z1M G;  1UFI A;  2JRI A;  2XAJ A;  1KYO F;  4X64 O;  3F7Y C;  3P30 A;  1WB8 A;  3SPG A;  1OV9 A;  3LNN A;  5FL7 G;  1KB9 F;  2R72 A;  2PI5 A;  4W4L A;  4DR2 O;  5DN6 G;  4F6R A;  4DV3 B;  3GVM A;  1QCE A;  2WLM A;  3B4S A;  1UJW B;  1Q6I A;  1I0H A;  1XHX A;  3K5M A;  2K1E A;  2ZE8 A;  4PDL A;  1QU7 A;  3P3P A;  3CRR A;  2QTS A;  2O57 A;  4LF6 O;  4DR6 B;  4GLX A;  3PJS K;  4O2B A;  1FAF A;  5IT9 N;  1BQ0 A;  2YIC A;  3SYP A;  4UCV A;  2PYJ A;  1PL4 A;  1E79 G;  3FB7 C;  2YUA A;  4K0K O;  4QE7 A;  5H6R A;  4FZ1 A;  3E8G A;  1NJI W;  1PNK A;  3Q4H B;  2Z5U A;  2WAM A;  3B8M A;  2JS3 A;  2X0L A;  1FFX B;  1XUQ A;  3U10 A;  4DRX A;  1HNW O;  2QSA A;  3H1H H;  3BHP A;  3LDE A;  4JZG A;  1S76 D;  2WLJ A;  1ZL8 A;  1O9G A;  4DV7 O;  1B6Q A;  2PTM A;  4Z2W A;  4NVP A;  4LNU A;  1V54 C;  1E1Q G;  1AJP A;  4YJ3 A;  4I7Z B;  2WA3 A;  4HZ3 A;  3K57 A;  2RQ6 A;  1NQT A;  3KG2 A;  5IJ0 B;  2QWQ B;  4XBF A;  3L75 H;  4B3T B;  1SET A;  4EB6 A;  4GX0 A;  4FFK A;  4ZHQ B;  3ASO B;  4DUY O;  1KC8 W;  2JGD A;  3HKD A;  1YEW A;  2JGU A;  3CRC A;  2Q8V A;  1J5E B;  2KB1 A;  2K9P A;  4PD4 F;  4RQE A;  1SQP H;  4TV9 B;  1VQ5 V;  2ITD C;  2JVD A;  3DXR B;  5DED A;  4ZIB A;  4NXN B;  3IC7 A;  2Q73 A;  1VF7 A;  3ZMS A;  4EKW A;  1FYJ A;  4ABM A;  4QE9 A;  1YIJ V;  1Q86 W;  3ZMT A;  4GKK B;  3AG4 B;  4YIP A;  4HNA B;  4X9Q A;  5CBG A;  2Z3Y A;  1PKX A;  4TUY A;  3BY6 A;  5J2T B;  1HW7 A;  2W0F C;  3QO8 A;  4LF7 O;  2YXL A;  3RYF B;  1A32 A;  3L74 H;  1K33 A;  1TAE A;  3KZI Z;  3R66 A;  2X7R B;  4BAY A;  1PNL A;  1BE3 H;  1HNZ B;  1MMM A;  4LP8 A;  1XI1 A;  2RJZ A;  3BFR A;  2UXD O;  4DV4 B;  4JAV A;  3IC9 A;  2V4D A;  1I94 O;  1VQ9 V;  4NXM B;  1GN2 A;  5B1A B;  2Y4T A;  1K34 A;  1MZF A;  4PA7 A;  1BHA A;  3OEE G;  1GK9 A;  3E22 A;  3OTO O;  2Y0P A;  3TK1 A;  4JI0 B;  3B8N A;  4JI6 O;  2EIJ B;  5JQG B;  1N33 B;  5B1O A;  1Q6U A;  1P84 F;  5LMU O;  3BAA A;  4UUJ C;  2X6B A;  1QVF U;  4D6T H;  4DXW A;  4X65 B;  4LFA O;  3L71 H;  1FXK B;  3T1Y B;  3ZRW B;  1MNG A;  1R3I C;  1JOY A;  1Q6H A;  4H33 A;  5EYP B;  1Q82 W;  3T4D A;  5C8Y A;  3WU2 Z;  4O4H A;  3QO7 A;  1JX9 A;  2CGO A;  1SF9 A;  2E5L B;  3FB6 C;  4WFG A;  2ZXW C;  3JYC A;  4PI2 A;  5CA0 B;  2H94 A;  3ABM C;  1TVK A;  1M93 A;  3RGB A;  2ZDI A;  2UUA O;  2AHY A;  4JI2 B;  3T1C A;  4QJF B;  4TV8 A;  1R6K A;  2UUB B;  5IY5 C;  5KMG A;  4GKJ O;  1AR4 A;  2XAQ A;  4JYB A;  3CCM V;  3FAV A;  3QNE A;  1H8E G;  4IHJ A;  3G4S V;  4JZ2 A; 
#chains in the Genus database with same CATH homology
 2GDS A;  1KKC A;  3QVN A;  2ADQ B;  3KKY A;  1LUW A;  1EN5 A;  2AW9 A;  1IXB A;  1MMM A;  4F6E A;  3BFR A;  1ZUQ A;  3EVK A;  1PL4 A;  3IC9 A;  3K9S A;  3AK2 A;  5A9G A;  1GN2 A;  1XRE A;  4YIO A;  3MDS A;  4GUN A;  1QNM A;  1GN3 A;  1D5N A;  1MSD A;  1JA8 A;  1VEW A;  2ADP A;  1AP5 A;  1GN6 A;  1MA1 A;  1XDC A;  1XUQ A;  1BT8 A;  2QKA A;  1LUV A;  2RCV A;  1I0H A;  1ZLZ A;  2CDY A;  2QKC A;  3TJT A;  4JZG A;  3KDR A;  1P7G A;  1ZTE A;  1ZSP A;  1AP6 A;  1PM9 A;  3LSU A;  1AR5 A;  2P4K A;  1SZX A;  3OT7 A;  3C3T A;  1EN6 A;  1MNG A;  1N0N A;  3CEI A;  1IDS A;  3C3S A;  1EN4 A;  3DC5 A;  4E4E A;  1WB7 A;  4FFK A;  3DC6 A;  5AG2 A;  1GN4 A;  2CE4 A;  1JR9 A;  4JYY A;  1I08 A;  1IX9 A;  1BSM A;  1B06 A;  3AK3 A;  1XIL A;  1Y67 A;  1EM1 A;  1BS3 A;  1VAR A;  3RN4 A;  1WB8 A;  3AK1 A;  1AVM A;  1AR4 A;  4BR6 A;  4YIP A;  4X9Q A;  4C7U A;  1N0J A;  4JZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...