3TJTA

Crystal structure analysis of the superoxide dismutase from clostridium difficile
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
202
structure length
202
Chain Sequence
NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the superoxide dismutase from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
total genus 74
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3tjtA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3tjtA02
1BS3A 3AK3A 1XUQA 1PM9A 5A9GA 3C3SA 1JA8A 1I08A 4E4EA 2CDYA 1LUWA 3IC9A 4F6EA 4X9QA 2CE4A 1MNGA 3LSUA 2P4KA 3KKYA 3TJTA 1IDSA 1AVMA 3AK2A 1EN6A 3CEIA 1N0JA 2ADQB 4YIPA 2QKAA 2ADPA 1XILA 1AR5A 3OT7A 1WB7A 2AW9A 1Y67A 1MA1A 1P7GA 1AP6A 1IX9A 1IXBA 1AP5A 1D5NA 1B06A 1LUVA 3DC6A 4JZGA 3EVKA 1MSDA 3MDSA 3BFRA 1ZSPA 1WB8A 2RCVA 1BT8A 3C3TA 1GN4A 1PL4A 3RN4A 3AK1A 4FFKA 4GUNA 1KKCA 1ZLZA 1GN3A 3K9SA 1ZUQA 4C7UA 1BSMA 1QNMA 1VEWA 4BR6A 1ZTEA 1EN5A 1MMMA 1GN2A 1XREA 2GDSA 1N0NA 1AR4A 5AG2A 1VARA 3QVNA 1XDCA 1EM1A 1EN4A 3DC5A 4JYYA 1I0HA 1SZXA 2QKCA 1JR9A 4YIOA 1GN6A 4JZ2A
chains in the Genus database with same CATH superfamily
1BS3A 3I5DA 3SJQC 3WU2Z 4J9YB 1VQ9V 3ZN0A 1NTZH 2EIMC 3OUSA 4IHJA 5JVDA 4DUYO 2N74A 2QR4A 4HAMA 1F51A 4LWSA 4X66B 1MNGA 3OMIB 4I55B 4NB5A 1JVMA 2IU3A 4DV1O 2P22C 3ZS8C 4JI6O 1VQ7V 4LF9O 3BABA 1SERA 1YEWA 1YJ9V 1K7DA 2AW9A 5EZYA 3TCUA 1XBLA 1IX9A 3SDLA 1VQLV 4WFGA 1RPOA 1YDXA 5CA0A 3GWOA 5GW7A 5JH7B 3CRAA 3X2QC 4Z2WA 5JJEB 1S3JA 4ASUG 1K5QA 4NYKA 5KA5A 4W4LA 1GKFA 3JAMN 3ZCCA 1KUQA 4FIPC 4TQDA 5KHIA 3IGAC 3K5LA 2F4VO 2WLNA 3K5MA 2UUBO 5LOVB 4GUNA 1JFFB 1ZLZA 4PELA 4XDJA 3GWKC 5EIBC 1SQBH 1OCZC 4X62O 1IXMA 2IJIA 5KAFZ 1IURA 3L70H 2PI4A 3RT3C 2GSMB 1PNLA 4G27B 1N4CA 1R3KC 2UXCB 4LF9B 3W7XA 2ITDC 3NXSA 2DYSB 2B1GA 5C8YA 1YTFD 3NR7A 4DV1B 4JZ2A 4X20A 2M7WA 1HNZO 4PJ0Z 5CB4A 1WN7A 1VF6C 4DR4O 1TUBB 4K0KO 1S77D 1QVFU 1YZBA 5LP6B 2Q7GA 4JI4B 3CCUV 4ABMA 1FAFA 3FX7A 4K3AA 1DLBA 4X9QA 2ZQMA 2ZR2A 2CE4A 3N2KB 1FYJA 3SGIA 4HYOA 4CH4A 3L74H 4JI2B 3E89A 4TQFA 5CA1A 3ABLC 1M57C 3TETA 5IYDO 4DR1O 4UCTA 4O4LA 3ABKB 2QWRB 1XILA 3MHHC 2ITCC 2AXTZ 2UU9B 1Q90D 4DV2O 3ABTA 2A9HA 2W0XA 4FM1A 1TGOA 1B06A 1TUEB 2YUAA 4I0XB 5EK0A 3RYHA 3CCQV 1RSOB 2JJ1G 2X6AA 1WB8A 2EIKB 3T1HB 1XEQA 2X7RB 1WA8A 4FFKA 4X8AA 1MZEA 1YHQV 1Q86W 2Y69B 1NKDA 2QJ1A 1GH6A 2YC0A 1RP3B 4FZ1A 1XMQB 5J2TB 5EC1C 5KMGA 3UO2A 3H1IH 1R73A 1Q7YW 3KCYA 2UXNA 4O4JB 3C90A 3G80A 4QNHB 4X65B 4MTGA 1QLEB 3W7WA 4LF5B 4X65O 5FNVA 1O9GA 2ZIMA 3JATB 4FMTA 5IYBO 1XDCA 2DYRC 5LA6A 3ZHTA 1TVKB 1AI4A 4J7KA 4MSWC 1SZXA 3JD2A 1F7YA 4UVAA 4LF7O 2HJDA 2EJRA 3N27A 3HKCB 2DW4A 1FFXB 4O4HB 2HR3A 4BIZA 3QG5A 3KG2A 2HHHB 3H01A 1QLNA 3W7TA 1AJPA 3P3PA 3O9OA 2ODMA 1OJHA 3ZHRA 2F66C 2RN9A 1M5IA 3AG1C 4DUZB 3LNNA 3D36C 5E79Z 4B3TB 1ORQC 1MZFA 3VQXA 1QBZA 2ZE6A 3AG1B 2Z5UA 1BQZA 4X89A 2ADPA 2FL4A 2R72A 3OM3B 1ROPA 4FFBB 2YEVA 1VQNV 1JJ2U 3RWRD 4I4TA 3H1LH 1IXBA 2OCCB 3K5NA 3QTCA 4JYBA 3ASOC 4OX9O 5EBLC 1V54C 1OCOC 4TV9B 1JPXA 1FJGO 3AK1A 2GBOA 4EB6A 4FLUA 4LFBO 3RYFA 1HNZB 2XAJA 3L73H 3J81N 3T2MA 3CCMV 1XMOB 2IW5A 4JI3O 2P6JA 5L3BA 5J9PC 5F2VO 2O57A 3AG4C 1JCHA 3X2QB 5AG2A 3FD9A 5IY5C 4TOIA 3HKEA 1WP7A 4U7OA 1EM1A 3WB0A 4RUFA 4DR1B 3R65A 5B5EZ 4B7EA 4LFCB 1OHHG 2VRZA 4O4IB 3PN1A 2UUBB 1L8DA 4WFBV 1K34A 3N2GB 2AZ2A 4CZZA 3OEEG 4D7SA 3ZJZA 4FM2A 2VQFO 4DW0A 1N34O 4D7TA 1COWG 2ZR3A 2QM7A 2LQTA 3JAWA 2HJFC 3BA9A 4I9WA 4Q20A 1F4MA 1KB9F 3SPCA 4DV7B 2UXBO 4O4IA 4B3SB 4PA3A 2Z0AA 3CRQA 1RFYA 5KA6A 1QQCA 1THZA 1NQTA 5BXZA 4YJ2A 2GUZB 4R50A 3AG3C 5IYZB 4UB6Z 4IL6Z 2JS3A 4YIPA 2EINB 2B1IA 3UT5A 2ZXWC 3CMAV 1K4CC 1XNQB 5L3DA 2WA3A 1LUVA 4LH6A 1Q3EA 3DTUB 3U11A 2HFEC 4TV8A 4JF3A 3MDSA 1ZSPA 5K1PA 3K0DA 4NXMB 2WSSG 4DR6B 4P9OA 3A0BZ 1GN4A 1NJIW 2QA4V 1N33O 2PUSA 4G28B 4DO2A 4KFMA 4GT1A 1VF7A 1FXKC 3QO7A 3J80N 1GN2A 1QHTA 4DR4B 4GX5A 1SA0A 1I7FA 3CSXA 3CX5F 4I4TB 4MVRA 2YEVB 1VF5B 3QVNA 2QM4A 4YY3O 3LDDA 3ASNB 4DV4B 2EX3A 4JYYA 4IIJB 1XNQO 4YXWG 1H2KA 2E5LB 2ZNJA 4UUJC 5JQGB 5JCOC 1SQFA 3E8BA 1PNMA 4RAIA 2B5UA 4X1IB 3ZMTA 1KKDA 4E4EA 2CDYA 4DV6B 2JVDA 2JEXA 2VQFB 1Z5WA 5L3EA 3KDRA 3TJTA 4JI7B 1DGSA 2OIGA 3HKCA 3BRCA 1RM1C 4LF4O 2EBOA 4TT3G 5A2QN 4JI8B 3M8AA 5LA6B 3CMEV 1N0JA 1Y6XA 4ZIBA 1FFTB 3IC7A 1H8EG 1WNSA 3SJBC 2Q7EA 3A8TA 2FKXA 3APQA 3H1JH 4UFZA 2P06A 2NN4A 5H5NA 5DN6G 1VQ6V 3T4DA 1F23A 4L87A 2X0LA 1NTKH 2VQEO 2ZE8A 3RVYA 3B8MA 3ABLB 1KP3A 2ZIOA 3OGIB 5KX5A 4XDKA 2YIAA 1S5JA 5CMUA 1H2MA 1Q82W 4LF8O 2JGDA 1DF5A 1XL4A 5CN0A 5CBGA 2DN9A 5LMUO 3K9SA 4LR3A 3AG2B 3RYHB 3LDCA 4I0XA 2JS5A 2RMKB 2PZSA 1Y66A 1FJGB 4R7CA 1D2DA 2H8PC 1H2LA 1N0NA 4JAUA 1H5WA 2QM8A 5BR8O 2XNDG 3SPJA 3O65A 1AI5A 3CJHB 4JYAO 3OUFA 5DM6V 2IJKA 4JPRA 4F6RA 5HFLA 3KCXA 2ZM6B 2UXXA 1GN6A 2RJZA 3LDEA 2Q73A 4EKWA 2EINC 1M56C 2F23A 2V4DA 1YVWA 2MK3A 2UXDB 2XAFA 1VQPV 1S5LZ 2B9ZA 4FVMA 2AZ0A 1JA8A 5LP6A 4X1IA 1QR9A 4JGSA 4IGGA 4F6EA 1TUBA 4UV8A 1M1KW 3E8GA 5CB4B 5KHJA 1G8MA 4DR2B 4JAAA 1P7BA 2QE7G 1V55B 4IIJA 1YJWV 5LBQA 2ETNA 3Q4HB 3F5WC 4MVSA 2CAZC 4CH3A 2QKAA 3BY6A 4ZOLB 5FLXN 4HNAA 3K0GA 2CGOA 1GRJA 1OZ0A 1SA0B 1AB3A 5LHIA 2VS0A 2ZCEA 2NLJC 1SF9A 1FXVA 2IJHA 2A79B 1XMQO 2BOCC 2RNBA 5IWAO 1NH2D 1PD3A 4FLVA 3C3TA 4LF6O 1GO3F 1V55C 4YHHB 1GN3A 3I55V 4AHCA 4DV6O 4TV8B 2PYLA 3E35A 1Q6IA 4B3TO 1CEZA 1HDJA 5EBWC 2KG7A 5CA0B 4LF8B 4I50A 1MSWD 3STLC 1U96A 4AI8A 5CBFA 5KUMA 3ZMVA 1AILA 1CP9A 1R3JC 2A06H 3G71V 2UUAO 2FTKA 4KUMA 3ABMB 1XHZA 2JRIA 3TK1A 2OT5A 4X88A 1VQ8V 4YY3B 2R9AA 3JASA 3CXCU 3AG2C 3K08A 1VQKV 2DMXA 4QGPA 3CHXA 5A9GA 4LWSB 3JAWB 1D5AA 3JD0A 3JCZA 4JASA 5C93A 4LF4B 1XI1A 3N2GA 1N32O 1NZ6A 5K1XA 5LMNO 3SJCC 1S72V 5LYJB 3D3IA 3AK2A 4OPHA 3JAKA 1KC8W 4PDVA 1I94B 3QO5A 3JD3A 2EZPA 3ETDA 3I56V 3OE7G 1YITV 4WFEA 1MA1A 3ZX6A 5JJJB 4MTFA 3H1KH 4GYCB 3E8FA 4PDMA 2QTOA 3BPZA 1MOFA 1EBOA 1PV0A 2CTPA 1OCCB 1OCRC 4ZHQA 3CC7V 2EILB 2XAHA 3RYFB 4BAYA 3R66A 3E22B 1X4TA 4TV9A 3UCSC 1B04A 2EIJB 4DV7O 3OEHG 3CB2A 4UVBA 1EFRG 1Z5VA 1QNMA 4L8JA 3L71H 3HB3B 1NR7A 2OCHA 5FPOA 2QTSA 4AILC 5BR8B 2R9IA 2HVKC 3W7UA 4PDLA 3D3QA 3QNEA 4FFBA 4DV0O 1Q5OA 2EJ7A 3FFQA 5H6QA 3Q4HA 4JYCA 1EN4A 2WA4A 4FZ0A 1QVGU 4K0KB 3RVZA 4H0LB 1NT2B 2G38A 1GM9A 1I0HA 1HNXB 3OR7C 1NR1A 2A0LA 1SQPH 1XUQA 4TUYB 2CUGA 3S3WA 2Q68A 1WPXA 2Q4PA 3TXQA 4NTWA 3WFVA 1IJGA 3K5OA 4JV5O 4FPPA 1N8RW 2OCCC 4B3MB 2QWPB 4LFAO 1FXKB 1LR1A 1BHBA 3B2EE 4PI0A 2LGWA 3JALB 3OMNB 1BCCH 1WJZA 3JATA 4CBCA 4QPJA 4ZI7A 4DR3O 3CJHA 3CCLV 1VQOV 1FD9A 5HFMA 2VWJA 1P7GA 1AP6A 4O4JA 3THOA 3BAAA 5DECA 1G6UA 4NXMO 2ZDIC 5J2TA 1I5XA 1GAXA 4JZGA 3FKSG 2WPDG 3EVKA 1MSDA 4MVUA 3RYCA 4QE7A 3AG7A 3FYIB 2JGDB 3JCUZ 1BT8A 3A0HZ 1GK9A 1IBMO 1R6KA 1DF4A 5KX5B 2YXYA 3RN4A 4UVCA 3JYCA 2FMLA 3L75H 2GTAA 1J5EO 4WFFA 1O9HA 5KUKA 4PHZA 1ZTEA 1FS0G 3GVMA 2CTQA 1AR4A 2Q9LA 1NVPD 4J7JA 4ZI7B 3HPLC 5J2UB 4DR7O 4B3RO 2ZD9A 3H9VA 4J10A 3JALA 5LXTB 2DQ0A 1JX9A 1JR9A 5LHHA 4GZRB 2GHYA 1QCEA 2LW7A 2Q5ZA 2WWWA 2AHZA 3C3SA 3E83A 4JI1B 1WPBA 3P30A 3VQYA 4CC6A 4I9QA 3ZHSA 5LGNA 3KKYA 5JQGA 3LNMB 2ARHA 2QWQB 1K33A 1NI8A 3OMAB 3SPGA 3ZRXA 4D6TH 5GTIZ 1ZX3A 4MW8A 3JSLA 4P2ZA 3UO3A 1H2NA 1CXZB 3IFXA 1K5SA 3CE2A 4H33A 2BSKA 2IJJA 3H1HH 2DOSA 4JTAB 4DK0A 3CP1A 3WB1A 3SR2C 1K3EA 5D5QA 4KHPO 4I7ZB 3U10A 4LF6B 2NNUA 4GCZA 4CS3A 2Q8VA 5LOVA 2DE0X 3WG7B 2JK5C 2QDOA 4J11A 2XT9A 4JI2O 4FK5C 4N21A 2L35A 5FPRA 4F4LA 4LCUC 4AQYB 4GKJO 5IDJA 1E1QG 1K92A 2R9RB 2PF4E 4ZHQB 3OR6C 3ZHQA 2HLDG 1YF2A 2YICA 4JTCB 5JWPA 1MMMA 4JI4O 3MHSC 3EFFK 4J9ZB 1R3IC 2IU0A 2F93B 5LMUB 1GMGA 2ZKOA 3ICXA 1AJNA 2DYRB 1KP2A 4A5UB 5FL7G 5IT9N 2HHHO 2GUZA 4B7KA 2LFSA 2EIJC 3RBZA 3ABUA 1Y76B 4JI0O 3A0RA 1S5HC 1P84F 5B3SC 4QE9A 2QSAA 2NR5A 4R6ZA 4IHJB 4ZKIA 5IYCO 2ZDIA 4JI8O 3ZIAG 3VBBA 4GX2A 3JASB 4N23A 2WLIA 1WP8A 4DR3B 1EZJA 3TGUH 2YXLA 3ETQA 4CC5A 2LFRA 2ADQB 3T1YB 1XNRO 1WB7A 3HKEB 3T1CA 3PJSK 5LL6Y 1ZAUA 2M6YA 4NTYA 1W2BU 1W59A 4I50B 4UCOA 3B77A 2Y0IA 5KHKA 1M9NA 2ZE7A 3SJAC 5BMVB 1M57B 2YIDA 2KG7B 2OYQA 3STZC 2UXCO 2JJ2G 4GX1A 2VQEB 1KBHA 4J80A 2PTMA 4X64B 4ZBMA 2F95B 4EB6B 4UCRA 5GONA 4DYLA 4O2BA 4Z1MG 4DV2B 3ML0A 2N05A 4LBEC 4LC1A 4DRXB 2DQ3A 4WCEV 4Q6GA 2ZXWB 4XDLA 2OTLV 2F1MA 4LH7A 2CH7A 5KAIZ 2H94A 3DSQA 4WF9V 1VQMV 3S3XA 2HVJC 2DJVA 4JI5B 4RQEA 4H37A 1JMKC 2EZOA 2GDSA 4JAVA 1R1BA 1OV9A 5CBHA 5LP6C 1F4NA 2Y48A 4GLXA 3G6EV 4H13B 4HNAB 4ZOLA 3RYIA 1IBLO 2ZT9B 4MTXA 3RFRA 4JI5O 2LGQA 3W7SA 3E86A 2A3QA 3K9AA 4IYHA 2XTAA 1SQQH 3HKBA 4JI7O 5B1AB 4LP8A 1X59A 4YIOA 4LFAB 3UKMA 5CA3A 3SYCA 4JV5B 1XL6A 3OTOO 5JJNB 5EYPA 1BQ0A 4UCUA 3U0ZA 4RWUA 3M7MX 3IC9A 1SQVH 1CPYA 3LSUA 5B3SB 2EULA 3BCCH 4NVPA 4CH5A 1E1RG 5L3CA 1ZWIC 2YSUB 5IJ9B 4DV4O 4X62B 2BTQA 4OXSA 3CC4V 3OAAG 4X66O 2WLMA 1KYOF 1SKVA 4F6RB 4X1YA 4CS2A 2KB1A 4WFAV 2V7QG 3K04A 3EXAA 1NVPB 4DV0B 1JNBA 3K57A 1AR5A 3G4SV 1IBLB 1OCCC 1OCRB 2BE3A 3ZBHA 2EILC 2MW2B 4XBFA 3GB7C 2Q67A 1BZKA 5KLVH 1EZVH 2WAMA 1YCIA 5IY5B 1NH2B 2K1EA 1MABG 1R6TA 4DR6O 4LFCO 3CRMA 1L1FA 3HKDB 1PPJH 1JQ0A 2F43G 1K9MW 1WA8B 3ZMUA 1W0JG 1LNQA 4DXWA 2WLKA 1KKCA 2EIMB 4X64O 1HP8A 1XOUA 1IVSA 4C7UA 1BSMA 4BR6A 2KSDA 5B1OA 3TXSA 1GM8A 4EEQA 5IE9A 2YS8A 1HNXO 4LNUB 1VARA 3K3WA 1UFIA 4MTOA 2BOBC 2WLHA 2Q7HA 4O4LB 1H8HG 3DC5A 2VWKA 2OIEA 2X6BA 5LHGA 4B3SO 2IM9A 3AEIA 3P32A 2YIBD 3ABMC 2F4VB 3VQVA 1W0KG 3CCVV 3N2KA 3AK3A 1U97A 3WB2A 1PM9A 1OCZB 2QWNB 3CWBH 3CPWU 1SZTA 2LP7A 4QJFB 4R8CA 3BEHA 4K8ZA 3SPHA 1HNWO 4DK1A 5C8YB 3ZN1A 1HW7A 1EN6A 1KECA 3OTFA 4NXNB 2HKOA 3ZMZA 1RPRA 3G67A 4QIWF 4LFBB 4CH6A 1IBKB 1AP5A 3ZRWB 4WFHA 2YIBA 5B1NA 4FM0A 3LSQA 2JDIG 5EBMC 2KQXA 4DUYB 4X1KB 2UUCO 3BFRA 1YTFB 4PD4F 1L0NH 1SETA 1JFFA 1T5EA 2W6IG 1YI2V 5LMNB 3FB8C 4J7ZA 2DWEC 4DV5O 4GKKB 2WLJA 1AJQA 5LGTA 4MVOA 2XUMA 2V1DA 1R6NA 3F7YC 4KP4A 5JH7A 4DR7B 4B3RB 4G2KA 5GTHZ 4OGQB 4PV1B 5BZBA 1VQ4V 2PY5A 2GTSA 4NTXA 3ZRSA 2LO1A 3UT5B 1NTMH 4IT5A 4P9PA 3QO8A 3CRCA 4X1YB 5IYZA 3ETGA 5TISZ 4YJ2B 2GV9A 1P49A 4NXNO 1AR1B 2RDCA 4NKGB 3CCRV 3UM7A 1TAEA 3DXRA 1URFA 1BL8A 1PP9H 2OWOA 2WLLA 5JVDB 5EC2C 2L6LA 2IH3C 3HR0A 3OD4A 5B66Z 4GKJB 2JGUA 3FB6C 2AGAA 4LF5O 2ZM6O 1B6QA 1DK1A 1NS1A 1ENVA 3HKBB 4QPKA 4GKKO 4DV5B 2XOKG 3CXHF 2PGGA 2CGNA 2E76B 4MW3A 3SYPA 3DC6A 1H2SB 3CC2V 5H6RA 1Q81W 4DV3B 1Y74B 4FLTA 3CCEV 1IBKO 1J5EB 2LJ2A 4ICGA 1AROP 2Q6AA 3F5TA 3SPIA 4E2LA 3JARB 4TWKA 3BA8A 4PI2A 1VP7A 3G6BA 1Z2GA 1Y74A 1HR0O 1BMFG 1IZ3A 2A7WA 1SRYA 1NU1H 1EN5A 4BIOA 1KQSU 1PL0A 3CS5A 4MVZA 2FB5A 2JEUA 3L9DA 5BMVA 2ATKC 2UU9O 4HZ3A 2FYUH 1YIJV 3E8HA 4FLZA 4NR1A 2KKWA 3LSSA 3AG4B 4UV9A 4WBNA 1YJNV 3EHBB 3B8NA 4PA7A 4W4KA 5KHHA 1TA8A 2JIZG 3DGEA 3VQWA 1QR8A 4BWAA 3ASNC 1VF6A 5E1AC 2Q0OC 3MAQA 2IBZH 4B3MO 3OGCC 4BW5A 3SYAA 3ETEA 5DEDA 1I08A 2WLLB 1V54B 3JD4A 2Y4UA 1HWYA 3ZRVA 2IH1C 5D5PA 3DXRB 1M93A 1Y76A 2R70A 1IDSA 1FFXA 1YXBA 3F7VC 4O4HA 3UQ8A 1IBMB 2E5LO 4U3JA 1OCOB 2P4VA 1KU9A 1B3QA 1P4RA 1TVKA 4BW9A 3CEIA 1MG1A 4EFBA 4HBNA 1S76D 3OT7A 4RUEA 5FNVB 3JSNA 3OW2U 3FYEB 5KMGB 3APOA 3SYOA 1N32B 3OFNG 4MVMA 5KHGA 2CTRA 4PDRA 3ZHUA 4UB8Z 2LW1A 2RCVA 4MT8A 2QWOB 3BVOA 1PKXA 5H9CA 1QU7A 5L3FA 3AG3B 2D2CB 2Q0AA 1GM7A 1RSOA 1SC5B 1BHAA 4YJ3A 1RM1B 4X1KA 3T4ZA 3CCSV 3D36A 2UUAB 1XREA 3ZRWA 3P3NA 3A2FA 1BE3H 2Y0PA 2BSKB 1NBMG 3IAYA 5LGUA 1YSCA 4Z1VA 3K03A 4RQFA 4UCVA 4PA4A 4JI6B 3OTOB 1XMOO 3CCJV 5CA1B 2K9PA 1XQ8A 1JOYA 3B09A 1SQXH 1US6A 2E75B 2QKSA 1QLEC 4H44B 4DW1A 2ZE5A 1K97A 3KZIZ 4J42A 4P30A 1KMIZ 4OPAA 4OX9B 1N33B 2QGNA 2P5OA 2W6JG 2P4KA 4FLXA 4X20B 1AVMA 1JJOA 4PA9A 5LXTA 4BIUA 3WG7C 1M4UA 1HR0B 5J2UA 1Q8IA 1XHXA 3B4SA 4DR5B 2X6CA 1N36O 2XHBA 4JI0B 3K58A 2HP8A 4LNUA 3ASOB 5B1AC 4K35A 1M56B 1D5NA 2BTOA 1AI6A 4FLYA 4JI3B 4FJCC 2AHYA 4DV3O 3SYQA 1M90W 4YJ3B 1Q6HA 1V9PA 1I94O 4UCSA 2Q69A 2UXBB 1WAZA 2CTWA 2N04A 2UXDO 1HNWB 2XAQA 3CYOA 1KD1W 3T1YO 1XNRB 4AQYO 1VIBA 3FB7C 2DYSC 1ZUQA 1FPOA 3HKDA 3RYCB 1N34B 1VEWA 2C2AA 3VOUA 2HG5C 2CK3G 1BGYH 2E3CA 4B08A 5EZYB 5EIBD 1R3LC 2E74B 1UJWB 2UUCB 3JD1A 3RGBA 4MS2A 2BTQB 2QKCA 5B1BC 4CS4A 4U3JB 5IJ9A 1FXKA 4DUZO 2P7TC 2Y69C 3M99B 4J41A 4I55A 2YI9A 2W0FC 5H2FZ 4FLWA 1GTOA 1FOUA 1A32A 3CRRA 2XAGA 2DWDC 1LUWA 1SQGA 4TSFG 1H2GA 4JI1O 5EYPB 4YHHO 4TUYA 2XASA 3B40A 2YDEA 4UXNA 5BY1A 2P90A 3BHPA 2Y4TA 5ITZB 4K8XA 1FXHA 2OTJV 3K79A 5IWAB 1AI7A 2EIKC 3ZEDA 1Y4MA 1UPGA 2Z3YA 3MD0A 1Q43A 2RQ6A 5IJ0B 2D3OW 4WBNB 2YI8A 3RYIB 1Y67A 3ABKC 3K06A 4KXRA 5B1BB 3CD6V 2HEPA 3J7AU 4U7NA 4KL1A 4PA6A 1ZL8A 1K73W 1VMGA 4KHPB 5L3GA 2CH7B 4I5SA 1Q6UA 3ZMSA 4O2AB 2QEXV 1S0VA 2PYJA 4JTDB 2PI5A 3E2EA 2ZINA 4DRXA 3FAVB 1E79G 3JARA 4U3FH 4DR2O 4O2BB 3T1HO 1I5YA 1PL4A 2P67A 5GONB 3E22A 1G1XB 1SESA 3FAVA 3RW0A 3K59A 1G4YB 1SS3A 4O2AA 2BCCH 1K8AW 3IJ4A 4RO2A 1J95A 3QF7A 1ZL8B 1K4DC 1H38A 2ZNIA 1WLEA 3L72H 4DR5O 1N36B 4IYIA 4GX0A 4LF7B 5IJ0A 1L0LH 3D8CA 3LUTB 1DTOA 1PNKA 3FB5C 3ZHVA 5ITZA 2ILMA 3JAKB 4EFEA 4JYAB 2H3OA 5JCOA 2YXHA 5LYJA 1FKAO 1VQ5V 2WLIB 4MVQA
chains in the Genus database with same CATH topology
1BS3A 3AK3A 1XUQA 1PM9A 5A9GA 3C3SA 1JA8A 1I08A 4E4EA 2CDYA 1LUWA 3IC9A 4F6EA 4X9QA 2CE4A 1MNGA 3LSUA 2P4KA 3KKYA 3KDRA 3TJTA 1IDSA 1AVMA 3AK2A 1EN6A 3CEIA 1N0JA 2ADQB 4YIPA 2QKAA 2ADPA 1XILA 1AR5A 3OT7A 1WB7A 2AW9A 1Y67A 1MA1A 1P7GA 1AP6A 1IX9A 1IXBA 1AP5A 1D5NA 1B06A 1LUVA 3DC6A 4JZGA 3EVKA 1MSDA 3MDSA 3BFRA 1ZSPA 1WB8A 2RCVA 1BT8A 3C3TA 1GN4A 1PL4A 3RN4A 3AK1A 4FFKA 4GUNA 1KKCA 1ZLZA 1GN3A 3K9SA 1ZUQA 4C7UA 1BSMA 1QNMA 1VEWA 4BR6A 1ZTEA 1EN5A 1MMMA 1GN2A 1XREA 2GDSA 1N0NA 1AR4A 5AG2A 1VARA 3QVNA 1XDCA 1EM1A 1EN4A 3DC5A 4JYYA 1I0HA 1SZXA 2QKCA 1JR9A 4YIOA 1GN6A 4JZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BS3 A;  3AK3 A;  1XUQ A;  1PM9 A;  5A9G A;  3C3S A;  1JA8 A;  1I08 A;  4E4E A;  2CDY A;  1LUW A;  3IC9 A;  4F6E A;  4X9Q A;  2CE4 A;  1MNG A;  3LSU A;  2P4K A;  3KKY A;  3TJT A;  1IDS A;  1AVM A;  3AK2 A;  1EN6 A;  3CEI A;  1N0J A;  2ADQ B;  4YIP A;  2QKA A;  2ADP A;  1XIL A;  1AR5 A;  3OT7 A;  1WB7 A;  2AW9 A;  1Y67 A;  1MA1 A;  1P7G A;  1AP6 A;  1IX9 A;  1IXB A;  1AP5 A;  1D5N A;  1B06 A;  1LUV A;  3DC6 A;  4JZG A;  3EVK A;  1MSD A;  3MDS A;  3BFR A;  1ZSP A;  1WB8 A;  2RCV A;  1BT8 A;  3C3T A;  1GN4 A;  1PL4 A;  3RN4 A;  3AK1 A;  4FFK A;  4GUN A;  1KKC A;  1ZLZ A;  1GN3 A;  3K9S A;  1ZUQ A;  4C7U A;  1BSM A;  1QNM A;  1VEW A;  4BR6 A;  1ZTE A;  1EN5 A;  1MMM A;  1GN2 A;  1XRE A;  2GDS A;  1N0N A;  1AR4 A;  5AG2 A;  1VAR A;  3QVN A;  1XDC A;  1EM1 A;  1EN4 A;  3DC5 A;  4JYY A;  1I0H A;  1SZX A;  2QKC A;  1JR9 A;  4YIO A;  1GN6 A;  4JZ2 A; 
#chains in the Genus database with same CATH topology
 1BS3 A;  3I5D A;  3SJQ C;  3WU2 Z;  4J9Y B;  1VQ9 V;  3ZN0 A;  1NTZ H;  2EIM C;  3OUS A;  4IHJ A;  5JVD A;  4DUY O;  2N74 A;  2QR4 A;  4HAM A;  1F51 A;  4LWS A;  4X66 B;  1MNG A;  3OMI B;  4I55 B;  4NB5 A;  1JVM A;  2IU3 A;  4DV1 O;  2P22 C;  3ZS8 C;  4JI6 O;  1VQ7 V;  4LF9 O;  3BAB A;  1SER A;  1YEW A;  1YJ9 V;  1K7D A;  2AW9 A;  5EZY A;  3TCU A;  1XBL A;  1IX9 A;  3SDL A;  1VQL V;  4WFG A;  1RPO A;  1YDX A;  5CA0 A;  3GWO A;  5GW7 A;  5JH7 B;  3CRA A;  3X2Q C;  4Z2W A;  5JJE B;  1S3J A;  4ASU G;  1K5Q A;  4NYK A;  5KA5 A;  4W4L A;  1GKF A;  3JAM N;  3ZCC A;  1KUQ A;  4FIP C;  4TQD A;  5KHI A;  3IGA C;  3K5L A;  2F4V O;  2WLN A;  3K5M A;  2UUB O;  5LOV B;  4GUN A;  1JFF B;  1ZLZ A;  4PEL A;  4XDJ A;  3GWK C;  5EIB C;  1SQB H;  1OCZ C;  4X62 O;  1IXM A;  2IJI A;  5KAF Z;  1IUR A;  3L70 H;  2PI4 A;  3RT3 C;  2GSM B;  1PNL A;  4G27 B;  1N4C A;  1R3K C;  2UXC B;  4LF9 B;  3W7X A;  2ITD C;  3NXS A;  2DYS B;  2B1G A;  5C8Y A;  1YTF D;  3NR7 A;  4DV1 B;  4JZ2 A;  4X20 A;  2M7W A;  1HNZ O;  4PJ0 Z;  5CB4 A;  1WN7 A;  1VF6 C;  4DR4 O;  1TUB B;  4K0K O;  1S77 D;  1QVF U;  1YZB A;  5LP6 B;  2Q7G A;  4JI4 B;  3CCU V;  4ABM A;  1FAF A;  3FX7 A;  4K3A A;  1DLB A;  4X9Q A;  2ZQM A;  2ZR2 A;  2CE4 A;  3N2K B;  1FYJ A;  3SGI A;  4HYO A;  4CH4 A;  3L74 H;  4JI2 B;  3E89 A;  4TQF A;  5CA1 A;  3ABL C;  1M57 C;  3TET A;  5IYD O;  4DR1 O;  4UCT A;  4O4L A;  3ABK B;  2QWR B;  1XIL A;  3MHH C;  2ITC C;  2AXT Z;  2UU9 B;  1Q90 D;  4DV2 O;  3ABT A;  2A9H A;  2W0X A;  4FM1 A;  1TGO A;  1B06 A;  1TUE B;  2YUA A;  4I0X B;  5EK0 A;  3RYH A;  3CCQ V;  1RSO B;  2JJ1 G;  2X6A A;  1WB8 A;  2EIK B;  3T1H B;  1XEQ A;  2X7R B;  1WA8 A;  4FFK A;  4X8A A;  1MZE A;  1YHQ V;  1Q86 W;  2Y69 B;  1NKD A;  2QJ1 A;  1GH6 A;  2YC0 A;  1RP3 B;  4FZ1 A;  1XMQ B;  5J2T B;  5EC1 C;  5KMG A;  3UO2 A;  3H1I H;  1R73 A;  1Q7Y W;  3KCY A;  2UXN A;  4O4J B;  3C90 A;  3G80 A;  4QNH B;  4X65 B;  4MTG A;  1QLE B;  3W7W A;  4LF5 B;  4X65 O;  5FNV A;  1O9G A;  2ZIM A;  3JAT B;  4FMT A;  5IYB O;  1XDC A;  2DYR C;  5LA6 A;  3ZHT A;  1TVK B;  1AI4 A;  4J7K A;  4MSW C;  1SZX A;  3JD2 A;  1F7Y A;  4UVA A;  4LF7 O;  2HJD A;  2EJR A;  3N27 A;  3HKC B;  2DW4 A;  1FFX B;  4O4H B;  2HR3 A;  4BIZ A;  3QG5 A;  3KG2 A;  2HHH B;  3H01 A;  1QLN A;  3W7T A;  1AJP A;  3P3P A;  3O9O A;  2ODM A;  1OJH A;  3ZHR A;  2F66 C;  2RN9 A;  1M5I A;  3AG1 C;  4DUZ B;  3LNN A;  3D36 C;  5E79 Z;  4B3T B;  1ORQ C;  1MZF A;  3VQX A;  1QBZ A;  2ZE6 A;  3AG1 B;  2Z5U A;  1BQZ A;  4X89 A;  2ADP A;  2FL4 A;  2R72 A;  3OM3 B;  1ROP A;  4FFB B;  2YEV A;  1VQN V;  1JJ2 U;  3RWR D;  4I4T A;  3H1L H;  1IXB A;  2OCC B;  3K5N A;  3QTC A;  4JYB A;  3ASO C;  4OX9 O;  5EBL C;  1V54 C;  1OCO C;  4TV9 B;  1JPX A;  1FJG O;  3AK1 A;  2GBO A;  4EB6 A;  4FLU A;  4LFB O;  3RYF A;  1HNZ B;  2XAJ A;  3L73 H;  3J81 N;  3T2M A;  3CCM V;  1XMO B;  2IW5 A;  4JI3 O;  2P6J A;  5L3B A;  5J9P C;  5F2V O;  2O57 A;  3AG4 C;  1JCH A;  3X2Q B;  5AG2 A;  3FD9 A;  5IY5 C;  4TOI A;  3HKE A;  1WP7 A;  4U7O A;  1EM1 A;  3WB0 A;  4RUF A;  4DR1 B;  3R65 A;  5B5E Z;  4B7E A;  4LFC B;  1OHH G;  2VRZ A;  4O4I B;  3PN1 A;  2UUB B;  1L8D A;  4WFB V;  1K34 A;  3N2G B;  2AZ2 A;  4CZZ A;  3OEE G;  4D7S A;  3ZJZ A;  4FM2 A;  2VQF O;  4DW0 A;  1N34 O;  4D7T A;  1COW G;  2ZR3 A;  2QM7 A;  2LQT A;  3JAW A;  2HJF C;  3BA9 A;  4I9W A;  4Q20 A;  1F4M A;  1KB9 F;  3SPC A;  4DV7 B;  2UXB O;  4O4I A;  4B3S B;  4PA3 A;  2Z0A A;  3CRQ A;  1RFY A;  5KA6 A;  1QQC A;  1THZ A;  1NQT A;  5BXZ A;  4YJ2 A;  2GUZ B;  4R50 A;  3AG3 C;  5IYZ B;  4UB6 Z;  4IL6 Z;  2JS3 A;  4YIP A;  2EIN B;  2B1I A;  3UT5 A;  2ZXW C;  3CMA V;  1K4C C;  1XNQ B;  5L3D A;  2WA3 A;  1LUV A;  4LH6 A;  1Q3E A;  3DTU B;  3U11 A;  2HFE C;  4TV8 A;  4JF3 A;  3MDS A;  1ZSP A;  5K1P A;  3K0D A;  4NXM B;  2WSS G;  4DR6 B;  4P9O A;  3A0B Z;  1GN4 A;  1NJI W;  2QA4 V;  1N33 O;  2PUS A;  4G28 B;  4DO2 A;  4KFM A;  4GT1 A;  1VF7 A;  1FXK C;  3QO7 A;  3J80 N;  1GN2 A;  1QHT A;  4DR4 B;  4GX5 A;  1SA0 A;  1I7F A;  3CSX A;  3CX5 F;  4I4T B;  4MVR A;  2YEV B;  1VF5 B;  3QVN A;  2QM4 A;  4YY3 O;  3LDD A;  3ASN B;  4DV4 B;  2EX3 A;  4JYY A;  4IIJ B;  1XNQ O;  4YXW G;  1H2K A;  2E5L B;  2ZNJ A;  4UUJ C;  5JQG B;  5JCO C;  1SQF A;  3E8B A;  1PNM A;  4RAI A;  2B5U A;  4X1I B;  3ZMT A;  1KKD A;  4E4E A;  2CDY A;  4DV6 B;  2JVD A;  2JEX A;  2VQF B;  1Z5W A;  5L3E A;  3KDR A;  3TJT A;  4JI7 B;  1DGS A;  2OIG A;  3HKC A;  3BRC A;  1RM1 C;  4LF4 O;  2EBO A;  4TT3 G;  5A2Q N;  4JI8 B;  3M8A A;  5LA6 B;  3CME V;  1N0J A;  1Y6X A;  4ZIB A;  1FFT B;  3IC7 A;  1H8E G;  1WNS A;  3SJB C;  2Q7E A;  3A8T A;  2FKX A;  3APQ A;  3H1J H;  4UFZ A;  2P06 A;  2NN4 A;  5H5N A;  5DN6 G;  1VQ6 V;  3T4D A;  1F23 A;  4L87 A;  2X0L A;  1NTK H;  2VQE O;  2ZE8 A;  3RVY A;  3B8M A;  3ABL B;  1KP3 A;  2ZIO A;  3OGI B;  5KX5 A;  4XDK A;  2YIA A;  1S5J A;  5CMU A;  1H2M A;  1Q82 W;  4LF8 O;  2JGD A;  1DF5 A;  1XL4 A;  5CN0 A;  5CBG A;  2DN9 A;  5LMU O;  3K9S A;  4LR3 A;  3AG2 B;  3RYH B;  3LDC A;  4I0X A;  2JS5 A;  2RMK B;  2PZS A;  1Y66 A;  1FJG B;  4R7C A;  1D2D A;  2H8P C;  1H2L A;  1N0N A;  4JAU A;  1H5W A;  2QM8 A;  5BR8 O;  2XND G;  3SPJ A;  3O65 A;  1AI5 A;  3CJH B;  4JYA O;  3OUF A;  5DM6 V;  2IJK A;  4JPR A;  4F6R A;  5HFL A;  3KCX A;  2ZM6 B;  2UXX A;  1GN6 A;  2RJZ A;  3LDE A;  2Q73 A;  4EKW A;  2EIN C;  1M56 C;  2F23 A;  2V4D A;  1YVW A;  2MK3 A;  2UXD B;  2XAF A;  1VQP V;  1S5L Z;  2B9Z A;  4FVM A;  2AZ0 A;  1JA8 A;  5LP6 A;  4X1I A;  1QR9 A;  4JGS A;  4IGG A;  4F6E A;  1TUB A;  4UV8 A;  1M1K W;  3E8G A;  5CB4 B;  5KHJ A;  1G8M A;  4DR2 B;  4JAA A;  1P7B A;  2QE7 G;  1V55 B;  4IIJ A;  1YJW V;  5LBQ A;  2ETN A;  3Q4H B;  3F5W C;  4MVS A;  2CAZ C;  4CH3 A;  2QKA A;  3BY6 A;  4ZOL B;  5FLX N;  4HNA A;  3K0G A;  2CGO A;  1GRJ A;  1OZ0 A;  1SA0 B;  1AB3 A;  5LHI A;  2VS0 A;  2ZCE A;  2NLJ C;  1SF9 A;  1FXV A;  2IJH A;  2A79 B;  1XMQ O;  2BOC C;  2RNB A;  5IWA O;  1NH2 D;  1PD3 A;  4FLV A;  3C3T A;  4LF6 O;  1GO3 F;  1V55 C;  4YHH B;  1GN3 A;  3I55 V;  4AHC A;  4DV6 O;  4TV8 B;  2PYL A;  3E35 A;  1Q6I A;  4B3T O;  1CEZ A;  1HDJ A;  5EBW C;  2KG7 A;  5CA0 B;  4LF8 B;  4I50 A;  1MSW D;  3STL C;  1U96 A;  4AI8 A;  5CBF A;  5KUM A;  3ZMV A;  1AIL A;  1CP9 A;  1R3J C;  2A06 H;  3G71 V;  2UUA O;  2FTK A;  4KUM A;  3ABM B;  1XHZ A;  2JRI A;  3TK1 A;  2OT5 A;  4X88 A;  1VQ8 V;  4YY3 B;  2R9A A;  3JAS A;  3CXC U;  3AG2 C;  3K08 A;  1VQK V;  2DMX A;  4QGP A;  3CHX A;  5A9G A;  4LWS B;  3JAW B;  1D5A A;  3JD0 A;  3JCZ A;  4JAS A;  5C93 A;  4LF4 B;  1XI1 A;  3N2G A;  1N32 O;  1NZ6 A;  5K1X A;  5LMN O;  3SJC C;  1S72 V;  5LYJ B;  3D3I A;  3AK2 A;  4OPH A;  3JAK A;  1KC8 W;  4PDV A;  1I94 B;  3QO5 A;  3JD3 A;  2EZP A;  3ETD A;  3I56 V;  3OE7 G;  1YIT V;  4WFE A;  1MA1 A;  3ZX6 A;  5JJJ B;  4MTF A;  3H1K H;  4GYC B;  3E8F A;  4PDM A;  2QTO A;  3BPZ A;  1MOF A;  1EBO A;  1PV0 A;  2CTP A;  1OCC B;  1OCR C;  4ZHQ A;  3CC7 V;  2EIL B;  2XAH A;  3RYF B;  4BAY A;  3R66 A;  3E22 B;  1X4T A;  4TV9 A;  3UCS C;  1B04 A;  2EIJ B;  4DV7 O;  3OEH G;  3CB2 A;  4UVB A;  1EFR G;  1Z5V A;  1QNM A;  4L8J A;  3L71 H;  3HB3 B;  1NR7 A;  2OCH A;  5FPO A;  2QTS A;  4AIL C;  5BR8 B;  2R9I A;  2HVK C;  3W7U A;  4PDL A;  3D3Q A;  3QNE A;  4FFB A;  4DV0 O;  1Q5O A;  2EJ7 A;  3FFQ A;  5H6Q A;  3Q4H A;  4JYC A;  1EN4 A;  2WA4 A;  4FZ0 A;  1QVG U;  4K0K B;  3RVZ A;  4H0L B;  1NT2 B;  2G38 A;  1GM9 A;  1I0H A;  1HNX B;  3OR7 C;  1NR1 A;  2A0L A;  1SQP H;  1XUQ A;  4TUY B;  2CUG A;  3S3W A;  2Q68 A;  1WPX A;  2Q4P A;  3TXQ A;  4NTW A;  3WFV A;  1IJG A;  3K5O A;  4JV5 O;  4FPP A;  1N8R W;  2OCC C;  4B3M B;  2QWP B;  4LFA O;  1FXK B;  1LR1 A;  1BHB A;  3B2E E;  4PI0 A;  2LGW A;  3JAL B;  3OMN B;  1BCC H;  1WJZ A;  3JAT A;  4CBC A;  4QPJ A;  4ZI7 A;  4DR3 O;  3CJH A;  3CCL V;  1VQO V;  1FD9 A;  5HFM A;  2VWJ A;  1P7G A;  1AP6 A;  4O4J A;  3THO A;  3BAA A;  5DEC A;  1G6U A;  4NXM O;  2ZDI C;  5J2T A;  1I5X A;  1GAX A;  4JZG A;  3FKS G;  2WPD G;  3EVK A;  1MSD A;  4MVU A;  3RYC A;  4QE7 A;  3AG7 A;  3FYI B;  2JGD B;  3JCU Z;  1BT8 A;  3A0H Z;  1GK9 A;  1IBM O;  1R6K A;  1DF4 A;  5KX5 B;  2YXY A;  3RN4 A;  4UVC A;  3JYC A;  2FML A;  3L75 H;  2GTA A;  1J5E O;  4WFF A;  1O9H A;  5KUK A;  4PHZ A;  1ZTE A;  1FS0 G;  3GVM A;  2CTQ A;  1AR4 A;  2Q9L A;  1NVP D;  4J7J A;  4ZI7 B;  3HPL C;  5J2U B;  4DR7 O;  4B3R O;  2ZD9 A;  3H9V A;  4J10 A;  3JAL A;  5LXT B;  2DQ0 A;  1JX9 A;  1JR9 A;  5LHH A;  4GZR B;  2GHY A;  1QCE A;  2LW7 A;  2Q5Z A;  2WWW A;  2AHZ A;  3C3S A;  3E83 A;  4JI1 B;  1WPB A;  3P30 A;  3VQY A;  4CC6 A;  4I9Q A;  3ZHS A;  5LGN A;  3KKY A;  5JQG A;  3LNM B;  2ARH A;  2QWQ B;  1K33 A;  1NI8 A;  3OMA B;  3SPG A;  3ZRX A;  4D6T H;  5GTI Z;  1ZX3 A;  4MW8 A;  3JSL A;  4P2Z A;  3UO3 A;  1H2N A;  1CXZ B;  3IFX A;  1K5S A;  3CE2 A;  4H33 A;  2BSK A;  2IJJ A;  3H1H H;  2DOS A;  4JTA B;  4DK0 A;  3CP1 A;  3WB1 A;  3SR2 C;  1K3E A;  5D5Q A;  4KHP O;  4I7Z B;  3U10 A;  4LF6 B;  2NNU A;  4GCZ A;  4CS3 A;  2Q8V A;  5LOV A;  2DE0 X;  3WG7 B;  2JK5 C;  2QDO A;  4J11 A;  2XT9 A;  4JI2 O;  4FK5 C;  4N21 A;  2L35 A;  5FPR A;  4F4L A;  4LCU C;  4AQY B;  4GKJ O;  5IDJ A;  1E1Q G;  1K92 A;  2R9R B;  2PF4 E;  4ZHQ B;  3OR6 C;  3ZHQ A;  2HLD G;  1YF2 A;  2YIC A;  4JTC B;  5JWP A;  1MMM A;  4JI4 O;  3MHS C;  3EFF K;  4J9Z B;  1R3I C;  2IU0 A;  2F93 B;  5LMU B;  1GMG A;  2ZKO A;  3ICX A;  1AJN A;  2DYR B;  1KP2 A;  4A5U B;  5FL7 G;  5IT9 N;  2HHH O;  2GUZ A;  4B7K A;  2LFS A;  2EIJ C;  3RBZ A;  3ABU A;  1Y76 B;  4JI0 O;  3A0R A;  1S5H C;  1P84 F;  5B3S C;  4QE9 A;  2QSA A;  2NR5 A;  4R6Z A;  4IHJ B;  4ZKI A;  5IYC O;  2ZDI A;  4JI8 O;  3ZIA G;  3VBB A;  4GX2 A;  3JAS B;  4N23 A;  2WLI A;  1WP8 A;  4DR3 B;  1EZJ A;  3TGU H;  2YXL A;  3ETQ A;  4CC5 A;  2LFR A;  2ADQ B;  3T1Y B;  1XNR O;  1WB7 A;  3HKE B;  3T1C A;  3PJS K;  5LL6 Y;  1ZAU A;  2M6Y A;  4NTY A;  1W2B U;  1W59 A;  4I50 B;  4UCO A;  3B77 A;  2Y0I A;  5KHK A;  1M9N A;  2ZE7 A;  3SJA C;  5BMV B;  1M57 B;  2YID A;  2KG7 B;  2OYQ A;  3STZ C;  2UXC O;  2JJ2 G;  4GX1 A;  2VQE B;  1KBH A;  4J80 A;  2PTM A;  4X64 B;  4ZBM A;  2F95 B;  4EB6 B;  4UCR A;  5GON A;  4DYL A;  4O2B A;  4Z1M G;  4DV2 B;  3ML0 A;  2N05 A;  4LBE C;  4LC1 A;  4DRX B;  2DQ3 A;  4WCE V;  4Q6G A;  2ZXW B;  4XDL A;  2OTL V;  2F1M A;  4LH7 A;  2CH7 A;  5KAI Z;  2H94 A;  3DSQ A;  4WF9 V;  1VQM V;  3S3X A;  2HVJ C;  2DJV A;  4JI5 B;  4RQE A;  4H37 A;  1JMK C;  2EZO A;  2GDS A;  4JAV A;  1R1B A;  1OV9 A;  5CBH A;  5LP6 C;  1F4N A;  2Y48 A;  4GLX A;  3G6E V;  4H13 B;  4HNA B;  4ZOL A;  3RYI A;  1IBL O;  2ZT9 B;  4MTX A;  3RFR A;  4JI5 O;  2LGQ A;  3W7S A;  3E86 A;  2A3Q A;  3K9A A;  4IYH A;  2XTA A;  1SQQ H;  3HKB A;  4JI7 O;  5B1A B;  4LP8 A;  1X59 A;  4YIO A;  4LFA B;  3UKM A;  5CA3 A;  3SYC A;  4JV5 B;  1XL6 A;  3OTO O;  5JJN B;  5EYP A;  1BQ0 A;  4UCU A;  3U0Z A;  4RWU A;  3M7M X;  3IC9 A;  1SQV H;  1CPY A;  3LSU A;  5B3S B;  2EUL A;  3BCC H;  4NVP A;  4CH5 A;  1E1R G;  5L3C A;  1ZWI C;  2YSU B;  5IJ9 B;  4DV4 O;  4X62 B;  2BTQ A;  4OXS A;  3CC4 V;  3OAA G;  4X66 O;  2WLM A;  1KYO F;  1SKV A;  4F6R B;  4X1Y A;  4CS2 A;  2KB1 A;  4WFA V;  2V7Q G;  3K04 A;  3EXA A;  1NVP B;  4DV0 B;  1JNB A;  3K57 A;  1AR5 A;  3G4S V;  1IBL B;  1OCC C;  1OCR B;  2BE3 A;  3ZBH A;  2EIL C;  2MW2 B;  4XBF A;  3GB7 C;  2Q67 A;  1BZK A;  5KLV H;  1EZV H;  2WAM A;  1YCI A;  5IY5 B;  1NH2 B;  2K1E A;  1MAB G;  1R6T A;  4DR6 O;  4LFC O;  3CRM A;  1L1F A;  3HKD B;  1PPJ H;  1JQ0 A;  2F43 G;  1K9M W;  1WA8 B;  3ZMU A;  1W0J G;  1LNQ A;  4DXW A;  2WLK A;  1KKC A;  2EIM B;  4X64 O;  1HP8 A;  1XOU A;  1IVS A;  4C7U A;  1BSM A;  4BR6 A;  2KSD A;  5B1O A;  3TXS A;  1GM8 A;  4EEQ A;  5IE9 A;  2YS8 A;  1HNX O;  4LNU B;  1VAR A;  3K3W A;  1UFI A;  4MTO A;  2BOB C;  2WLH A;  2Q7H A;  4O4L B;  1H8H G;  3DC5 A;  2VWK A;  2OIE A;  2X6B A;  5LHG A;  4B3S O;  2IM9 A;  3AEI A;  3P32 A;  2YIB D;  3ABM C;  2F4V B;  3VQV A;  1W0K G;  3CCV V;  3N2K A;  3AK3 A;  1U97 A;  3WB2 A;  1PM9 A;  1OCZ B;  2QWN B;  3CWB H;  3CPW U;  1SZT A;  2LP7 A;  4QJF B;  4R8C A;  3BEH A;  4K8Z A;  3SPH A;  1HNW O;  4DK1 A;  5C8Y B;  3ZN1 A;  1HW7 A;  1EN6 A;  1KEC A;  3OTF A;  4NXN B;  2HKO A;  3ZMZ A;  1RPR A;  3G67 A;  4QIW F;  4LFB B;  4CH6 A;  1IBK B;  1AP5 A;  3ZRW B;  4WFH A;  2YIB A;  5B1N A;  4FM0 A;  3LSQ A;  2JDI G;  5EBM C;  2KQX A;  4DUY B;  4X1K B;  2UUC O;  3BFR A;  1YTF B;  4PD4 F;  1L0N H;  1SET A;  1JFF A;  1T5E A;  2W6I G;  1YI2 V;  5LMN B;  3FB8 C;  4J7Z A;  2DWE C;  4DV5 O;  4GKK B;  2WLJ A;  1AJQ A;  5LGT A;  4MVO A;  2XUM A;  2V1D A;  1R6N A;  3F7Y C;  4KP4 A;  5JH7 A;  4DR7 B;  4B3R B;  4G2K A;  5GTH Z;  4OGQ B;  4PV1 B;  5BZB A;  1VQ4 V;  2PY5 A;  2GTS A;  4NTX A;  3ZRS A;  2LO1 A;  3UT5 B;  1NTM H;  4IT5 A;  4P9P A;  3QO8 A;  3CRC A;  4X1Y B;  5IYZ A;  3ETG A;  5TIS Z;  4YJ2 B;  2GV9 A;  1P49 A;  4NXN O;  1AR1 B;  2RDC A;  4NKG B;  3CCR V;  3UM7 A;  1TAE A;  3DXR A;  1URF A;  1BL8 A;  1PP9 H;  2OWO A;  2WLL A;  5JVD B;  5EC2 C;  2L6L A;  2IH3 C;  3HR0 A;  3OD4 A;  5B66 Z;  4GKJ B;  2JGU A;  3FB6 C;  2AGA A;  4LF5 O;  2ZM6 O;  1B6Q A;  1DK1 A;  1NS1 A;  1ENV A;  3HKB B;  4QPK A;  4GKK O;  4DV5 B;  2XOK G;  3CXH F;  2PGG A;  2CGN A;  2E76 B;  4MW3 A;  3SYP A;  3DC6 A;  1H2S B;  3CC2 V;  5H6R A;  1Q81 W;  4DV3 B;  1Y74 B;  4FLT A;  3CCE V;  1IBK O;  1J5E B;  2LJ2 A;  4ICG A;  1ARO P;  2Q6A A;  3F5T A;  3SPI A;  4E2L A;  3JAR B;  4TWK A;  3BA8 A;  4PI2 A;  1VP7 A;  3G6B A;  1Z2G A;  1Y74 A;  1HR0 O;  1BMF G;  1IZ3 A;  2A7W A;  1SRY A;  1NU1 H;  1EN5 A;  4BIO A;  1KQS U;  1PL0 A;  3CS5 A;  4MVZ A;  2FB5 A;  2JEU A;  3L9D A;  5BMV A;  2ATK C;  2UU9 O;  4HZ3 A;  2FYU H;  1YIJ V;  3E8H A;  4FLZ A;  4NR1 A;  2KKW A;  3LSS A;  3AG4 B;  4UV9 A;  4WBN A;  1YJN V;  3EHB B;  3B8N A;  4PA7 A;  4W4K A;  5KHH A;  1TA8 A;  2JIZ G;  3DGE A;  3VQW A;  1QR8 A;  4BWA A;  3ASN C;  1VF6 A;  5E1A C;  2Q0O C;  3MAQ A;  2IBZ H;  4B3M O;  3OGC C;  4BW5 A;  3SYA A;  3ETE A;  5DED A;  1I08 A;  2WLL B;  1V54 B;  3JD4 A;  2Y4U A;  1HWY A;  3ZRV A;  2IH1 C;  5D5P A;  3DXR B;  1M93 A;  1Y76 A;  2R70 A;  1IDS A;  1FFX A;  1YXB A;  3F7V C;  4O4H A;  3UQ8 A;  1IBM B;  2E5L O;  4U3J A;  1OCO B;  2P4V A;  1KU9 A;  1B3Q A;  1P4R A;  1TVK A;  4BW9 A;  3CEI A;  1MG1 A;  4EFB A;  4HBN A;  1S76 D;  3OT7 A;  4RUE A;  5FNV B;  3JSN A;  3OW2 U;  3FYE B;  5KMG B;  3APO A;  3SYO A;  1N32 B;  3OFN G;  4MVM A;  5KHG A;  2CTR A;  4PDR A;  3ZHU A;  4UB8 Z;  2LW1 A;  2RCV A;  4MT8 A;  2QWO B;  3BVO A;  1PKX A;  5H9C A;  1QU7 A;  5L3F A;  3AG3 B;  2D2C B;  2Q0A A;  1GM7 A;  1RSO A;  1SC5 B;  1BHA A;  4YJ3 A;  1RM1 B;  4X1K A;  3T4Z A;  3CCS V;  3D36 A;  2UUA B;  1XRE A;  3ZRW A;  3P3N A;  3A2F A;  1BE3 H;  2Y0P A;  2BSK B;  1NBM G;  3IAY A;  5LGU A;  1YSC A;  4Z1V A;  3K03 A;  4RQF A;  4UCV A;  4PA4 A;  4JI6 B;  3OTO B;  1XMO O;  3CCJ V;  5CA1 B;  2K9P A;  1XQ8 A;  1JOY A;  3B09 A;  1SQX H;  1US6 A;  2E75 B;  2QKS A;  1QLE C;  4H44 B;  4DW1 A;  2ZE5 A;  1K97 A;  3KZI Z;  4J42 A;  4P30 A;  1KMI Z;  4OPA A;  4OX9 B;  1N33 B;  2QGN A;  2P5O A;  2W6J G;  2P4K A;  4FLX A;  4X20 B;  1AVM A;  1JJO A;  4PA9 A;  5LXT A;  4BIU A;  3WG7 C;  1M4U A;  1HR0 B;  5J2U A;  1Q8I A;  1XHX A;  3B4S A;  4DR5 B;  2X6C A;  1N36 O;  2XHB A;  4JI0 B;  3K58 A;  2HP8 A;  4LNU A;  3ASO B;  5B1A C;  4K35 A;  1M56 B;  1D5N A;  2BTO A;  1AI6 A;  4FLY A;  4JI3 B;  4FJC C;  2AHY A;  4DV3 O;  3SYQ A;  1M90 W;  4YJ3 B;  1Q6H A;  1V9P A;  1I94 O;  4UCS A;  2Q69 A;  2UXB B;  1WAZ A;  2CTW A;  2N04 A;  2UXD O;  1HNW B;  2XAQ A;  3CYO A;  1KD1 W;  3T1Y O;  1XNR B;  4AQY O;  1VIB A;  3FB7 C;  2DYS C;  1ZUQ A;  1FPO A;  3HKD A;  3RYC B;  1N34 B;  1VEW A;  2C2A A;  3VOU A;  2HG5 C;  2CK3 G;  1BGY H;  2E3C A;  4B08 A;  5EZY B;  5EIB D;  1R3L C;  2E74 B;  1UJW B;  2UUC B;  3JD1 A;  3RGB A;  4MS2 A;  2BTQ B;  2QKC A;  5B1B C;  4CS4 A;  4U3J B;  5IJ9 A;  1FXK A;  4DUZ O;  2P7T C;  2Y69 C;  3M99 B;  4J41 A;  4I55 A;  2YI9 A;  2W0F C;  5H2F Z;  4FLW A;  1GTO A;  1FOU A;  1A32 A;  3CRR A;  2XAG A;  2DWD C;  1LUW A;  1SQG A;  4TSF G;  1H2G A;  4JI1 O;  5EYP B;  4YHH O;  4TUY A;  2XAS A;  3B40 A;  2YDE A;  4UXN A;  5BY1 A;  2P90 A;  3BHP A;  2Y4T A;  5ITZ B;  4K8X A;  1FXH A;  2OTJ V;  3K79 A;  5IWA B;  1AI7 A;  2EIK C;  3ZED A;  1Y4M A;  1UPG A;  2Z3Y A;  3MD0 A;  1Q43 A;  2RQ6 A;  5IJ0 B;  2D3O W;  4WBN B;  2YI8 A;  3RYI B;  1Y67 A;  3ABK C;  3K06 A;  4KXR A;  5B1B B;  3CD6 V;  2HEP A;  3J7A U;  4U7N A;  4KL1 A;  4PA6 A;  1ZL8 A;  1K73 W;  1VMG A;  4KHP B;  5L3G A;  2CH7 B;  4I5S A;  1Q6U A;  3ZMS A;  4O2A B;  2QEX V;  1S0V A;  2PYJ A;  4JTD B;  2PI5 A;  3E2E A;  2ZIN A;  4DRX A;  3FAV B;  1E79 G;  3JAR A;  4U3F H;  4DR2 O;  4O2B B;  3T1H O;  1I5Y A;  1PL4 A;  2P67 A;  5GON B;  3E22 A;  1G1X B;  1SES A;  3FAV A;  3RW0 A;  3K59 A;  1G4Y B;  1SS3 A;  4O2A A;  2BCC H;  1K8A W;  3IJ4 A;  4RO2 A;  1J95 A;  3QF7 A;  1ZL8 B;  1K4D C;  1H38 A;  2ZNI A;  1WLE A;  3L72 H;  4DR5 O;  1N36 B;  4IYI A;  4GX0 A;  4LF7 B;  5IJ0 A;  1L0L H;  3D8C A;  3LUT B;  1DTO A;  1PNK A;  3FB5 C;  3ZHV A;  5ITZ A;  2ILM A;  3JAK B;  4EFE A;  4JYA B;  2H3O A;  5JCO A;  2YXH A;  5LYJ A;  1FKA O;  1VQ5 V;  2WLI B;  4MVQ A; 
#chains in the Genus database with same CATH homology
 1BS3 A;  3AK3 A;  1XUQ A;  1PM9 A;  5A9G A;  3C3S A;  1JA8 A;  1I08 A;  4E4E A;  2CDY A;  1LUW A;  3IC9 A;  4F6E A;  4X9Q A;  2CE4 A;  1MNG A;  3LSU A;  2P4K A;  3KKY A;  3KDR A;  3TJT A;  1IDS A;  1AVM A;  3AK2 A;  1EN6 A;  3CEI A;  1N0J A;  2ADQ B;  4YIP A;  2QKA A;  2ADP A;  1XIL A;  1AR5 A;  3OT7 A;  1WB7 A;  2AW9 A;  1Y67 A;  1MA1 A;  1P7G A;  1AP6 A;  1IX9 A;  1IXB A;  1AP5 A;  1D5N A;  1B06 A;  1LUV A;  3DC6 A;  4JZG A;  3EVK A;  1MSD A;  3MDS A;  3BFR A;  1ZSP A;  1WB8 A;  2RCV A;  1BT8 A;  3C3T A;  1GN4 A;  1PL4 A;  3RN4 A;  3AK1 A;  4FFK A;  4GUN A;  1KKC A;  1ZLZ A;  1GN3 A;  3K9S A;  1ZUQ A;  4C7U A;  1BSM A;  1QNM A;  1VEW A;  4BR6 A;  1ZTE A;  1EN5 A;  1MMM A;  1GN2 A;  1XRE A;  2GDS A;  1N0N A;  1AR4 A;  5AG2 A;  1VAR A;  3QVN A;  1XDC A;  1EM1 A;  1EN4 A;  3DC5 A;  4JYY A;  1I0H A;  1SZX A;  2QKC A;  1JR9 A;  4YIO A;  1GN6 A;  4JZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...