3CEIA

Crystal structure of superoxide dismutase from helicobacter pylori
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
213
structure length
213
Chain Sequence
MFTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQIYNHDFYWDCLSPKATALSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYGHINWHFVSQCYEWAKKEGLGSVDYYINELVHKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
publication title The crystal structure of the superoxide dismutase from Helicobacter pylori reveals a structured C-terminal extension
pubmed doi rcsb
source organism Helicobacter pylori
total genus 77
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ceiA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ceiA02
1XUQA 1N0JA 4X9QA 3KKYA 1PL4A 4YIOA 5A9GA 1WB8A 3DC5A 1BS3A 4BR6A 1N0NA 1P7GA 1AR5A 1AVMA 1WB7A 4FFKA 1I08A 5AG2A 3AK1A 3C3SA 3AK3A 1VARA 3IC9A 1Y67A 3AK2A 1MSDA 4JYYA 3BFRA 4JZGA 1D5NA 2ADPA 4C7UA 1SZXA 1GN4A 1BT8A 1JR9A 1ZTEA 1MA1A 1I0HA 1ZUQA 3DC6A 1IX9A 4YIPA 1XREA 3C3TA 1XILA 3EVKA 1LUWA 1GN6A 2AW9A 4F6EA 1ZLZA 1AP5A 1IXBA 1EN4A 2P4KA 3OT7A 1VEWA 2GDSA 1MMMA 4GUNA 1EN5A 1MNGA 1XDCA 1B06A 1QNMA 4JZ2A 3QVNA 2CDYA 4E4EA 1JA8A 1AP6A 1BSMA 1PM9A 1IDSA 3MDSA 3K9SA 1KKCA 3LSUA 1ZSPA 3CEIA 2RCVA 3RN4A 2CE4A 1LUVA 1AR4A 2ADQB 1EM1A 2QKAA 3TJTA 1GN3A 2QKCA 1GN2A 1EN6A
chains in the Genus database with same CATH superfamily
5B1NA 2Q9LA 3E86A 5KX5A 2F93B 2IH3C 3E83A 1OCRB 1YTFB 3CS5A 3A0HZ 4FLXA 4P9PA 2ZM6B 2N04A 1TUBB 1Y6XA 2B1GA 1US6A 3SGIA 1M56B 2ILMA 3B2EE 5BR8O 1Y67A 1L0LH 3OR6C 4JI7B 3BHPA 4ZOLA 3EXAA 1MZEA 4JI5B 3PN1A 1GMGA 4U3FH 1KB9F 1GN4A 4U3JB 4DV2B 3CXCU 4K0KO 1S0VA 2KKWA 2A79B 2RJZA 3T4ZA 3I5DA 2KB1A 1Q6UA 2N05A 1J5EB 1IX9A 4CH3A 5CBGA 4YIPA 5BMVB 1XREA 2XAFA 2VQFB 4NVPA 2Q69A 3P3NA 4DK1A 3BAAA 4LF9B 1SERA 2YSUB 2CTQA 2OIGA 1KC8W 1VEWA 4ZI7A 5IJ0B 4DR2O 4TSFG 2YDEA 2CTWA 3ABLC 1Y74A 5GONA 5KUKA 1M4UA 2DQ3A 3SYOA 1FXKC 3LDEA 1KKCA 5KUMA 2JRIA 1QLNA 4F6RA 3N2KA 2RCVA 4O4LB 5LMNO 3BA8A 3ABKC 2QWQB 4O4IA 1Q3EA 4ZKIA 1YXBA 1DGSA 4NXMB 2LFSA 3ZHSA 3STLC 3T1HO 1IXMA 1XUQA 1NQTA 3JAKB 5A9GA 1R6KA 2E75B 3ZEDA 3ZX6A 4X88A 1KYOF 2GV9A 5BY1A 2XASA 2FKXA 4ZHQA 5IE9A 5B1AB 3JD1A 5B1BB 1FD9A 4PA4A 3KDRA 4MVRA 5IWAO 4RUFA 1SRYA 2EILC 1IBKB 3S3WA 1B04A 3S3XA 1WPXA 4GLXA 4PV1B 1BHBA 2YXLA 1EBOA 1M57C 4BW5A 4DV6O 4KUMA 5CB4B 2GSMB 3ZHUA 1GM9A 3HPLC 4DR4B 5B3SB 1SKVA 4I55A 4OXSA 3IGAC 2ZINA 3JATB 4JGSA 4LFAB 4TT3G 5K1XA 4UVBA 3ZRXA 5LXTB 1BHAA 1YDXA 3AG7A 3G6EV 4BWAA 3CE2A 3D36A 1K97A 1WN7A 2YC0A 1L0NH 3H1HH 1NTKH 5CA0A 4EB6A 2V1DA 3B8NA 4IHJA 1EN4A 1AI4A 1KMIZ 2R70A 5KLVH 1MMMA 4GUNA 2ZKOA 1QNMA 1TUEB 4H13B 3FX7A 1PP9H 4L8JA 2RQ6A 3HKBB 4PELA 5EK0A 2IJKA 1NTMH 2YEVB 4JF3A 3J7AU 2AHZA 2O57A 2JEXA 4JI3O 4I0XB 2CH7B 1M90W 4O2BA 4GX2A 4QE9A 4TUYB 2PUSA 2WLHA 1JPXA 1QVGU 2F4VO 1SS3A 1EN6A 1N34B 2ZXWC 3OW2U 1WP8A 3HKDB 4WFHA 4EFEA 5BR8B 3RYIB 1EZJA 1ROPA 2BOCC 4Z2WA 2IU3A 1H2NA 4BR6A 1VQKV 3HB3B 1HNZB 1Y76A 5BZBA 1I94O 2P7TC 1F4NA 1H8HG 1V9PA 4CH5A 3CCJV 3ETDA 5KX5B 2NN4A 1YVWA 2XAGA 1ZL8A 2FYUH 5D5QA 3EFFK 3LSSA 2QWRB 2ODMA 3F7VC 2HKOA 5KHKA 1R3IC 1PNMA 4DV0O 2JGUA 2FTKA 5EZYA 1WPBA 3DGEA 3ABTA 5LGUA 3CCVV 3A0RA 4DV7O 3SPCA 3F5TA 3ABLB 3ZN0A 2AZ0A 2JJ1G 4X62B 1GN6A 1Q5OA 2HEPA 1YJWV 1AP5A 2VRZA 3OR7C 3K5OA 4RUEA 1L1FA 3QVNA 1R3LC 3L9DA 2CK3G 3T1HB 3LSUA 4IYIA 1JCHA 2Q5ZA 4WFEA 3CEIA 1Q43A 5EYPB 1OV9A 2DYSC 4HNAB 2WLLB 4ZI7B 3L73H 1OJHA 3ZJZA 1Y74B 3QNEA 1OZ0A 3ZHTA 2MK3A 4DK0A 2HHHO 1R3JC 2EULA 3CRQA 3IC7A 4DR1O 5JH7A 1M57B 4X64B 4F6RB 3O65A 1S5JA 4D7SA 4LFCO 1WJZA 1S5LZ 2LQTA 3G80A 1EFRG 1XEQA 4H44B 4UVAA 5CA1A 3SPIA 4DUZB 4EEQA 3FB7C 3SR2C 1TUBA 4KHPB 4N21A 5FNVB 4DR5B 4G27B 3CYOA 3UKMA 4J11A 2UXDO 3OM3B 1SZXA 5L3BA 2WA3A 2ZDIC 4FFBB 3SPJA 5LHGA 2H8PC 3SJCC 3TGUH 2Z0AA 4U3JA 5JJJB 1GRJA 1IBMB 1DF5A 3ZMSA 4PDLA 4NB5A 1BZKA 1I5YA 2QTSA 2C2AA 1XILA 3KG2A 3OMIB 1LR1A 3CC4V 4AHCA 4I55B 1V54C 5GW7A 4JI3B 4I9QA 2Q4PA 1H2LA 3JSLA 1QVFU 4RQEA 5JWPA 4TWKA 5IT9N 4B3TO 1K34A 2ZIOA 5IJ0A 5JVDB 4FLTA 4KP4A 4DV5B 5IYBO 4GCZA 2ZXWB 2YI8A 1BSMA 2Y0IA 2DWEC 2OT5A 4JTDB 4XBFA 3AG1C 2Y4TA 1NR7A 4TQDA 4EB6B 5CA0B 3KZIZ 1X4TA 4NR1A 3JSNA 5D5PA 4UV8A 2EZPA 3ABMB 2Y69C 5B1OA 5LOVB 1H38A 4K35A 1NH2D 2EINC 3SYQA 4GKJB 4EKWA 5KA5A 1L8DA 4J7ZA 1N0JA 3CCMV 1RSOB 3FAVB 3ETGA 1K5QA 3JAKA 5EBMC 5GTIZ 5LHHA 5IJ9B 4JV5O 3OUFA 5C93A 3K0GA 1M5IA 1WB7A 1FPOA 2QWNB 5IYDO 1VARA 3M7MX 2ZCEA 2E5LO 2XHBA 1N32B 4TOIA 1U97A 5CB4A 1PKXA 3APOA 1FFXB 4X66O 2KG7B 3W7UA 2P90A 5J9PC 5H6QA 3SDLA 4P9OA 3JATA 3CCSV 1FXHA 3AG4B 4DV1O 3BVOA 4QJFB 3BA9A 2IJJA 3RT3C 1ZL8B 2R72A 4QGPA 5LXTA 1R1BA 4DV4O 2QTOA 2H94A 3D3IA 3AG3B 3U10A 2Y48A 5F2VO 2ZIMA 1VQ8V 4OPHA 1NH2B 3H01A 2UU9O 1EN5A 2F43G 1S5HC 1HNWB 4UV9A 4FIPC 4OX9B 4J7JA 1PNKA 2ETNA 4L87A 4RQFA 1RPRA 2R9RB 4UCTA 4QNHB 1PM9A 3MDSA 2QSAA 2YEVA 2JDIG 2BSKB 1F23A 2VS0A 5J2TB 3THOA 2HR3A 2RNBA 3BPZA 4I0XA 4DUYB 4A5UB 2CH7A 4JI2B 1SQBH 1K4DC 1XOUA 2QM4A 2YS8A 2QR4A 1GN3A 1OCZB 2EIMC 3ASOB 1JFFB 1AJNA 3ZN1A 4YHHO 4X1IB 1XBLA 3ZIAG 3LDDA 4MSWC 1K33A 1AB3A 1V55B 3FB6C 4UCVA 1HDJA 2K1EA 3RYIA 3K58A 3RYFB 2WLIB 4FLVA 3R65A 1XNRO 4JI0B 1NU1H 4TV8A 4WBNB 4PDRA 3ZMZA 2A3QA 3AK3A 3VQXA 3H9VA 3E8BA 1I5XA 1UFIA 4FM0A 1YJNV 1W2BU 2UXCO 3OAAG 3BFRA 4DR3B 3D8CA 2DYRC 2JVDA 2ZR3A 4YY3B 2JS5A 2ADPA 4QE7A 3JD2A 5CA1B 2QE7G 1JVMA 2QM7A 2X6AA 4I50A 4FZ1A 3WG7C 3IAYA 1HR0B 3K57A 3KCYA 5B66Z 1N33O 2EIJC 4P30A 4GKKO 4MVUA 5JJEB 3QO7A 1B3QA 3SYAA 1G8MA 2UUBO 2G38A 4U7NA 1M9NA 3FD9A 4ABMA 4WF9V 1MNGA 4WFAV 2Y69B 1P4RA 2F95B 3CX5F 5JCOC 4J41A 4TQFA 4QPJA 3HR0A 5JQGB 2VWJA 1N36O 4H37A 3JAWB 2AHYA 1IDSA 2XOKG 4CS2A 1ZAUA 3FB8C 1OCOB 3G71V 1VQ9V 2IBZH 2N74A 5EYPA 4DV3B 1Q86W 5H9CA 3QF7A 4HNAA 2WLLA 2ZR2A 4JASA 3AEIA 1PL0A 4MTFA 1GN2A 2EX3A 3VBBA 5B5EZ 5TISZ 1QLEB 1XNQO 1SQPH 3VOUA 5EC2C 1YJ9V 1IURA 4X65O 3DC5A 4O4HB 2AGAA 3U11A 4DRXB 2YXHA 2IM9A 2VQEO 4LF5B 2E76B 4J10A 2OYQA 3OUSA 1SESA 4NTWA 4UB8Z 3RGBA 2UXXA 5CBHA 4DW1A 4JI8O 1MSDA 5FNVA 4FMTA 3UQ8A 1FKAO 3MHSC 5FL7G 4LF7O 1RFYA 4DV4B 4B3SO 4K8XA 1Z5WA 1JQ0A 5KMGB 3W7WA 4FFBA 4QPKA 1WNSA 3ABUA 2UU9B 2WLNA 3TXQA 2UXBO 1B6QA 2JS3A 4LF6B 5LMUB 3EVKA 5DM6V 5LP6C 1AR1B 4LF8B 2PY5A 1R73A 4JI4B 3E8HA 1BL8A 1THZA 2QDOA 4DR6O 4PA3A 1HNXB 4X1KB 1G4YB 3G67A 3SYCA 2GDSA 3F5WC 2W6IG 4JTCB 2OTJV 3AG2C 4O4JB 1W0KG 3RVZA 5LBQA 4E4EA 1FYJA 4LCUC 2XAHA 5JVDA 4JI1O 4LFBO 1DK1A 3RVYA 1EZVH 4YHHB 3UT5B 2FL4A 2UUCO 1U96A 2ZT9B 2EJRA 4GT1A 4D6TH 1EM1A 2QKAA 3B09A 3K5MA 1M1KW 1TVKA 5LOVA 1XNRB 3JCUZ 1VF7A 5EBLC 4LF4O 4FK5C 2X0LA 3KCXA 2D3OW 2ZQMA 1RSOA 3FAVA 4HYOA 2V7QG 2W0FC 3G6BA 5IJ9A 3JCZA 1MSWD 2GHYA 1I08A 2NLJC 1ZX3A 1Q90D 3E22B 3X2QC 4X8AA 3DSQA 3W7SA 2YIDA 3ETEA 1P7BA 2XAJA 2CTRA 3OE7G 5IY5C 4TV8B 1FFXA 1BT8A 2KG7A 1XMQO 3DC6A 3D36C 3MD0A 4K0KB 2IH1C 4JAAA 2P06A 1N36B 4B7EA 5K1PA 2Q67A 2DQ0A 2YIBD 1AJQA 2M6YA 3OT7A 4I50B 1HW7A 2ZE5A 2HG5C 1WAZA 4MW3A 3LNNA 2CDYA 4CBCA 1R6TA 1H2SB 2CTPA 3ZMVA 4CZZA 4DR2B 1A32A 4NKGB 3L70H 1NI8A 1FXKB 2HP8A 4XDJA 1JX9A 3T2MA 3LDCA 2BSKA 1GM8A 5IDJA 5J2TA 1I7FA 3ABKB 1CPYA 1S76D 2ADQB 4PDVA 2H3OA 2BE3A 1GO3F 5LMNB 1ZWIC 1YEWA 1NT2B 3TJTA 3QG5A 5LA6B 5KAFZ 3LUTB 2OCCC 4X9QA 2RDCA 1JFFA 1SQFA 4YIOA 3TXSA 1IZ3A 4X1IA 4MT8A 4UUJC 2LGQA 5KHIA 2JEUA 3OTOO 1AVMA 4B3SB 1KD1W 2DE0X 1JMKC 3RYFA 2WLIA 4CS3A 1RM1C 4G2KA 3I55V 3JD4A 1Q6HA 4WBNA 2BOBC 2ZNJA 2EILB 4O2AB 4IL6Z 1JJOA 5HFLA 1GAXA 5IWAB 2KSDA 4X89A 4ASUG 4YXWG 5LP6B 4LR3A 4DV6B 3ETQA 3E8GA 3CCLV 1P49A 3ZRWB 4J42A 2P22C 1NTZH 5BXZA 1VQPV 1VQLV 2CAZC 2LO1A 1VF6A 2JIZG 4UFZA 5LYJB 2X6CA 2DOSA 2EBOA 4HAMA 1Q82W 3ZMUA 3K04A 4IIJB 3SJBC 3TCUA 2DN9A 3WU2Z 1FJGO 3CJHB 5KHJA 3LNMB 1HP8A 5KAIZ 1JA8A 5JQGA 2LW7A 1SA0B 4RO2A 1SETA 2WSSG 3K9SA 5CMUA 2XUMA 3JAWA 2Q8VA 2UUAO 5IYZA 2ZD9A 1W0JG 2GTAA 2CE4A 4B3RO 4E2LA 1WA8B 3ZRSA 2Q7HA 4LH7A 3BEHA 2DW4A 3CRAA 1IJGA 3ZRVA 1TAEA 2QM8A 3QTCA 5DN6G 1XL6A 3F7YC 3X2QB 2F4VB 1K92A 1OCRC 5L3GA 3JYCA 1FOUA 2EJ7A 1SF9A 4AILC 1K7DA 4MVOA 2CUGA 2PZSA 1N0NA 4O4HA 4DRXA 3OTFA 5J2UB 1CP9A 1TVKB 3UCSC 1VF5B 4JI7O 1KQSU 3HKEB 1O9HA 4NXNO 2W0XA 2DMXA 4JI5O 1I94B 4CH4A 1LNQA 3CCUV 4DV2O 4BIUA 2RMKB 1YSCA 2PF4E 5L3FA 4CC6A 3K5LA 1J5EO 1R6NA 2VQFO 5KHHA 5KMGA 5FPRA 4I9WA 2IJIA 3FB5C 3E35A 4DV0B 4Q6GA 1COWG 4AQYO 1FXVA 3HKCB 5LL6Y 2LFRA 4DV7B 3CMAV 2EIKC 5EIBC 4UCUA 1SQGA 3RFRA 2CGOA 4FM2A 1SQVH 2A9HA 5L3EA 3CWBH 4X1KA 1B06A 1URFA 1GTOA 4WFGA 3B8MA 4WFBV 1QHTA 1Q6IA 4O4JA 2LGWA 1VMGA 3QO8A 1PD3A 1BCCH 2HLDG 2YIAA 4MTGA 4BAYA 4JI6O 4X20B 2IW5A 1XL4A 3JARA 3ML0A 1GK9A 4BIOA 1LUVA 1K3EA 3T1YO 5LHIA 1VQ5V 3UT5A 2DYSB 4NXMO 3PJSK 4MS2A 1YCIA 3OGIB 1RM1B 3OTOB 3W7XA 1FS0G 2JJ2G 2XAQA 1YZBA 4X1YB 1KBHA 2HHHB 3E2EA 4PA6A 3O9OA 4DR1B 2WLJA 5B1BC 1MABG 1F4MA 3K06A 3GWKC 1NKDA 4PI2A 4PJ0Z 1AR5A 4LFCB 3JASA 4YJ3A 4FJCC 3FYEB 1W59A 4RAIA 5LGNA 2LW1A 4F4LA 3IC9A 4JTAB 3SJQC 1S72V 3E22A 2Y4UA 1Y66A 2WLKA 5B3SC 3CHXA 2ZNIA 2L35A 1ORQC 2PI4A 4LFAO 1BQ0A 4DW0A 1H8EG 3N2GA 3CD6V 2UXDB 4ZBMA 3QO5A 2Q7GA 4J9ZB 3RYCA 1MG1A 1ENVA 3MHHC 1NBMG 1SC5B 2X7RB 1X59A 4FLWA 2P6JA 3UO3A 3GB7C 3W7TA 3IJ4A 2IU0A 1Y4MA 3H1JH 1V54B 2WLMA 4UB6Z 2AXTZ 4GX5A 5EIBD 3JAMN 2QA4V 2FB5A 3SJAC 4OPAA 5DECA 3OEEG 4W4KA 2DJVA 3K3WA 2ATKC 2YI9A 4TV9B 1K5SA 1BQZA 4CC5A 3BABA 3K5NA 5CBFA 4B3TB 5ITZA 4B3MO 2UXNA 3JALB 3OD4A 3RYHA 1Q81W 3AG1B 1FXKA 2Q6AA 1KP2A 3LSQA 1PV0A 1DF4A 1N34O 1YI2V 4LP8A 2EINB 1UJWB 2QKCA 1XMOO 2HFEC 1BMFG 5LA6A 1HWYA 1WB8A 5IYZB 4NXNB 3CRCA 3CC7V 3SPGA 3B4SA 1HNZO 2OTLV 3ASNC 2Q68A 1RPOA 3U0ZA 4FLUA 4WFFA 4YJ2B 4JV5B 4U7OA 1QCEA 3AK1A 3C3SA 4B7KA 4W4LA 2P4VA 3ZS8C 1MZFA 5L3CA 1XI1A 4O2AA 5DEDA 4AQYB 3GVMA 4JAUA 4NTXA 2E5LB 1WLEA 2EIKB 5LP6A 2B1IA 2XTAA 1JNBA 2PGGA 2YIBA 3M99B 4BIZA 4FPPA 1P84F 1JR9A 4X66B 1IVSA 4MTXA 2BCCH 2BTQB 3WB1A 4X62O 3ZRWA 4HBNA 3DXRB 3C3TA 5FLXN 3Q4HB 4DV1B 3RWRD 4RWUA 1O9GA 2OCHA 2PYLA 4LC1A 5LYJA 4JI6B 4FLZA 2PI5A 1ZLZA 4MVSA 2Z3YA 4IIJA 1IBLO 1MOFA 3T1YB 4PA7A 1KP3A 1NR1A 4B08A 1E79G 3CJHA 3P30A 2ARHA 4GZRB 5IYCO 4OGQB 4FM1A 1SA0A 3FKSG 1ZSPA 5C8YA 2P5OA 2Q0AA 1SQXH 3ZBHA 1WA8A 3STZC 2HVJC 2YXYA 4X64O 3OFNG 3I56V 2NNUA 5HFMA 2LJ2A 2EIMB 3KKYA 1KU9A 1PL4A 1JJ2U 3K03A 2XNDG 3JARB 4MVQA 1H2KA 4I4TA 4DUZO 5E1AC 2WPDG 4P2ZA 4AI8A 4KHPO 4QIWF 3DTUB 3TETA 2YICA 2CGNA 4DR5O 5AG2A 1Z2GA 1D5AA 5J2UA 1NJIW 1UPGA 3FFQA 2P67A 3HKEA 3K9AA 2DWDC 3AK2A 2OWOA 2V4DA 4JZGA 3J80N 3VQVA 4K8ZA 3K59A 2PYJA 3H1LH 1QBZA 2UXCB 3RW0A 2DYRB 1VIBA 3JASB 4LNUA 1IBMO 4H0LB 4YJ3B 2HJFC 1ZTEA 1NS1A 3WG7B 4GX1A 3BRCA 3CMEV 2EIJB 1S77D 1K4CC 2Q0OC 4WCEV 5EBWC 1N33B 3HKCA 3MAQA 4GKKB 3N2GB 1TA8A 4B3MB 3OMAB 4DV5O 4ICGA 1CEZA 3RYCB 2UUBB 2E74B 2QWOB 5GTHZ 1G6UA 1Q7YW 5CA3A 5JJNB 3UO2A 4BW9A 1AI6A 2GUZB 1XMOB 2JGDB 4LWSB 3JD3A 3M8AA 1K8AW 3OEHG 4X20A 4CH6A 4H33A 3ABMC 3CSXA 3ASNB 4GKJO 3NXSA 1AROP 1E1RG 2F23A 2F1MA 1DLBA 2QJ1A 2EZOA 4JYAO 4D7TA 2ZE6A 5CN0A 3ICXA 4FLYA 1YITV 4IYHA 4UCSA 4I5SA 5ITZB 2B5UA 1OCCC 3P3PA 5KA6A 4K3AA 2IJHA 1KKDA 3L74H 3RYHB 2WAMA 1PPJH 4X1YA 1XNQB 2XT9A 2HJDA 3A0BZ 3OGCC 4JYCA 5H2FZ 4X65B 2Y0PA 4DR7O 4FFKA 4JPRA 2QWPB 3OMNB 1GKFA 2E3CA 1N32O 2VQEB 1H2GA 3E89A 4J80A 2RN9A 4ZOLB 2BTOA 1YHQV 1XQ8A 1D5NA 3ZHVA 3WB2A 4JI8B 2YUAA 2GBOA 3BCCH 5FPOA 4LF7B 2NR5A 3J81N 3B77A 4J9YB 1G1XB 1MA1A 2ZDIA 1PNLA 3AG4C 1AI7A 1IBLB 1WP7A 1GM7A 2W6JG 2JK5C 1LUWA 2VWKA 3AG3C 1XHZA 2A06H 4UCOA 1XHXA 2UXBB 1HNWO 3WB0A 1VQ4V 4PI0A 1F51A 2P4KA 4OX9O 1Q8IA 1H2MA 2ITCC 4JAVA 1QQCA 1XDCA 3E8FA 1NZ6A 4J7KA 4JZ2A 1GH6A 4DR6B 1AILA 5GONB 3A8TA 3AG2B 3H1IH 1NVPD 4MVZA 4Z1VA 5KHGA 4TV9A 1AP6A 1TGOA 3N2KB 2PTMA 4DUYO 4JI2O 1CXZB 3T1CA 2R9AA 4O4IB 3JALA 1KECA 4JI1B 4JYBA 4LFBB 1AJPA 2WWWA 4PD4F 2UUCB 1OCZC 3ASOC 1VQ7V 1QU7A 4PHZA 2Z5UA 3L72H 4G28B 3G4SV 3SPHA 1JOYA 1V55C 2A0LA 3CP1A 5C8YB 4ZHQB 4LF4B 4JI0O 1FFTB 3CXHF 1BS3A 3UM7A 3N27A 3P32A 3ZHQA 2F66C 1P7GA 2FMLA 4R6ZA 1T5EA 1S3JA 4GYCB 4DR3O 4YJ2A 2ZE7A 2WA4A 3CB2A 1VQOV 4YY3O 3CRMA 4MTOA 3NR7A 5BMVA 2QEXV 4NYKA 4I4TB 1BGYH 4DXWA 4HZ3A 4XDLA 5A2QN 2M7WA 2ZM6O 2Q7EA 2OIEA 1H5WA 1HR0O 4PA9A 4DO2A 1K73W 3L71H 2QGNA 5IY5B 4MVMA 1VF6C 1M56C 1BE3H 1NVPB 1KUQA 4R8CA 4UCRA 1VQMV 4PDMA 2HVKC 4GX0A 5L3DA 1N8RW 2BTQA 1XMQB 1VQNV 3DXRA 3K0DA 3IFXA 4IHJB 3Q4HA 4LNUB 4CS4A 3CCRV 1Z5VA 4O4LA 3CCEV 4F6EA 5EC1C 2D2CB 3BY6A 2B9ZA 4UXNA 2A7WA 3EHBB 5H5NA 4LF9O 2QKSA 1RP3B 4JYAB 1YIJV 1OCCB 5E79Z 1QR9A 4O2BB 5LGTA 1FAFA 4DV3O 1OCOC 4FZ0A 3B40A 1AR4A 4FVMA 4IGGA 1VQ6V 3L75H 2LP7A 4DR7B 1QLEC 1YF2A 4R50A 3CC2V 2L6LA 3VQYA 3CPWU 1D2DA 3ZHRA 2OCCB 1N4CA 2Q73A 1SZTA 4LF5O 1M93A 3VQWA 1SQQH 4R7CA 3ZCCA 1Y76B 1DTOA 1K9MW 2ZE8A 2MW2B 3TK1A 3SYPA 4LBEC 3WFVA 4JYYA 3D3QA 3T4DA 4C7UA 5EZYB 5B1AC 1R3KC 1F7YA 2ITDC 1YTFD 3H1KH 1IBKO 2KQXA 3ZMTA 4Z1MG 1I0HA 1ZUQA 1J95A 4LF6O 5LMUO 4XDKA 4N23A 2GTSA 4LF8O 3HKBA 1E1QG 4DR4O 3A2FA 4JI4O 3K08A 1HNXO 4IT5A 2X6BA 2AZ2A 3GWOA 2K9PA 3JD0A 2AW9A 4KXRA 1IXBA 3CCQV 3RBZA 4TUYA 3K79A 3FYIB 4DYLA 4KL1A 4KFMA 4UVCA 3APQA 5JCOA 1FJGB 4NTYA 2R9IA 3CRRA 3C90A 3HKDA 4LH6A 4ZIBA 4Q20A 1AI5A 3RN4A 4I7ZB 2GUZA 2JGDA 4LWSA 4MW8A 1QR8A 4EFBA 2UUAB 4B3RB 5H6RA 1OHHG 3R66A 5JH7B 1VP7A
chains in the Genus database with same CATH topology
1XUQA 1N0JA 4X9QA 3KKYA 1PL4A 4YIOA 5A9GA 1WB8A 3DC5A 1BS3A 4BR6A 1N0NA 1P7GA 1AR5A 3KDRA 1AVMA 1WB7A 4FFKA 1I08A 5AG2A 3AK1A 3C3SA 3AK3A 1VARA 3IC9A 1Y67A 3AK2A 1MSDA 4JYYA 3BFRA 4JZGA 1D5NA 2ADPA 4C7UA 1SZXA 1GN4A 1BT8A 1JR9A 1ZTEA 1MA1A 1I0HA 1ZUQA 3DC6A 1IX9A 4YIPA 1XREA 3C3TA 1XILA 3EVKA 1LUWA 1GN6A 2AW9A 4F6EA 1ZLZA 1AP5A 1IXBA 1EN4A 2P4KA 3OT7A 1VEWA 2GDSA 1MMMA 4GUNA 1EN5A 1MNGA 1XDCA 1B06A 1QNMA 4JZ2A 3QVNA 2CDYA 4E4EA 1JA8A 1AP6A 1BSMA 1PM9A 1IDSA 3MDSA 3K9SA 1KKCA 3LSUA 1ZSPA 3CEIA 2RCVA 3RN4A 2CE4A 1LUVA 1AR4A 2ADQB 1EM1A 2QKAA 3TJTA 1GN3A 2QKCA 1GN2A 1EN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XUQ A;  1N0J A;  4X9Q A;  3KKY A;  1PL4 A;  4YIO A;  5A9G A;  1WB8 A;  3DC5 A;  1BS3 A;  4BR6 A;  1N0N A;  1P7G A;  1AR5 A;  1AVM A;  1WB7 A;  4FFK A;  1I08 A;  5AG2 A;  3AK1 A;  3C3S A;  3AK3 A;  1VAR A;  3IC9 A;  1Y67 A;  3AK2 A;  1MSD A;  4JYY A;  3BFR A;  4JZG A;  1D5N A;  2ADP A;  4C7U A;  1SZX A;  1GN4 A;  1BT8 A;  1JR9 A;  1ZTE A;  1MA1 A;  1I0H A;  1ZUQ A;  3DC6 A;  1IX9 A;  4YIP A;  1XRE A;  3C3T A;  1XIL A;  3EVK A;  1LUW A;  1GN6 A;  2AW9 A;  4F6E A;  1ZLZ A;  1AP5 A;  1IXB A;  1EN4 A;  2P4K A;  3OT7 A;  1VEW A;  2GDS A;  1MMM A;  4GUN A;  1EN5 A;  1MNG A;  1XDC A;  1B06 A;  1QNM A;  4JZ2 A;  3QVN A;  2CDY A;  4E4E A;  1JA8 A;  1AP6 A;  1BSM A;  1PM9 A;  1IDS A;  3MDS A;  3K9S A;  1KKC A;  3LSU A;  1ZSP A;  3CEI A;  2RCV A;  3RN4 A;  2CE4 A;  1LUV A;  1AR4 A;  2ADQ B;  1EM1 A;  2QKA A;  3TJT A;  1GN3 A;  2QKC A;  1GN2 A;  1EN6 A; 
#chains in the Genus database with same CATH topology
 5B1N A;  2Q9L A;  3E86 A;  5KX5 A;  2F93 B;  2IH3 C;  3E83 A;  1OCR B;  1YTF B;  3CS5 A;  3A0H Z;  4FLX A;  4P9P A;  2ZM6 B;  2N04 A;  1TUB B;  1Y6X A;  2B1G A;  1US6 A;  3SGI A;  1M56 B;  2ILM A;  3B2E E;  5BR8 O;  1Y67 A;  1L0L H;  3OR6 C;  4JI7 B;  3BHP A;  4ZOL A;  3EXA A;  1MZE A;  4JI5 B;  3PN1 A;  1GMG A;  4U3F H;  1KB9 F;  1GN4 A;  4U3J B;  4DV2 B;  3CXC U;  4K0K O;  1S0V A;  2KKW A;  2A79 B;  2RJZ A;  3T4Z A;  3I5D A;  2KB1 A;  1Q6U A;  2N05 A;  1J5E B;  1IX9 A;  4CH3 A;  5CBG A;  4YIP A;  5BMV B;  1XRE A;  2XAF A;  2VQF B;  4NVP A;  2Q69 A;  3P3N A;  4DK1 A;  3BAA A;  4LF9 B;  1SER A;  2YSU B;  2CTQ A;  2OIG A;  1KC8 W;  1VEW A;  4ZI7 A;  5IJ0 B;  4DR2 O;  4TSF G;  2YDE A;  2CTW A;  3ABL C;  1Y74 A;  5GON A;  5KUK A;  1M4U A;  2DQ3 A;  3SYO A;  1FXK C;  3LDE A;  1KKC A;  5KUM A;  2JRI A;  1QLN A;  4F6R A;  3N2K A;  2RCV A;  4O4L B;  5LMN O;  3BA8 A;  3ABK C;  2QWQ B;  4O4I A;  1Q3E A;  4ZKI A;  1YXB A;  1DGS A;  4NXM B;  2LFS A;  3ZHS A;  3STL C;  3T1H O;  1IXM A;  1XUQ A;  1NQT A;  3JAK B;  5A9G A;  1R6K A;  2E75 B;  3ZED A;  3ZX6 A;  4X88 A;  1KYO F;  2GV9 A;  5BY1 A;  2XAS A;  2FKX A;  4ZHQ A;  5IE9 A;  5B1A B;  3JD1 A;  5B1B B;  1FD9 A;  4PA4 A;  3KDR A;  4MVR A;  5IWA O;  4RUF A;  1SRY A;  2EIL C;  1IBK B;  3S3W A;  1B04 A;  3S3X A;  1WPX A;  4GLX A;  4PV1 B;  1BHB A;  2YXL A;  1EBO A;  1M57 C;  4BW5 A;  4DV6 O;  4KUM A;  5CB4 B;  2GSM B;  3ZHU A;  1GM9 A;  3HPL C;  4DR4 B;  5B3S B;  1SKV A;  4I55 A;  4OXS A;  3IGA C;  2ZIN A;  3JAT B;  4JGS A;  4LFA B;  4TT3 G;  5K1X A;  4UVB A;  3ZRX A;  5LXT B;  1BHA A;  1YDX A;  3AG7 A;  3G6E V;  4BWA A;  3CE2 A;  3D36 A;  1K97 A;  1WN7 A;  2YC0 A;  1L0N H;  3H1H H;  1NTK H;  5CA0 A;  4EB6 A;  2V1D A;  3B8N A;  4IHJ A;  1EN4 A;  1AI4 A;  1KMI Z;  2R70 A;  5KLV H;  1MMM A;  4GUN A;  2ZKO A;  1QNM A;  1TUE B;  4H13 B;  3FX7 A;  1PP9 H;  4L8J A;  2RQ6 A;  3HKB B;  4PEL A;  5EK0 A;  2IJK A;  1NTM H;  2YEV B;  4JF3 A;  3J7A U;  2AHZ A;  2O57 A;  2JEX A;  4JI3 O;  4I0X B;  2CH7 B;  1M90 W;  4O2B A;  4GX2 A;  4QE9 A;  4TUY B;  2PUS A;  2WLH A;  1JPX A;  1QVG U;  2F4V O;  1SS3 A;  1EN6 A;  1N34 B;  2ZXW C;  3OW2 U;  1WP8 A;  3HKD B;  4WFH A;  4EFE A;  5BR8 B;  3RYI B;  1EZJ A;  1ROP A;  2BOC C;  4Z2W A;  2IU3 A;  1H2N A;  4BR6 A;  1VQK V;  3HB3 B;  1HNZ B;  1Y76 A;  5BZB A;  1I94 O;  2P7T C;  1F4N A;  1H8H G;  1V9P A;  4CH5 A;  3CCJ V;  3ETD A;  5KX5 B;  2NN4 A;  1YVW A;  2XAG A;  1ZL8 A;  2FYU H;  5D5Q A;  3EFF K;  3LSS A;  2QWR B;  2ODM A;  3F7V C;  2HKO A;  5KHK A;  1R3I C;  1PNM A;  4DV0 O;  2JGU A;  2FTK A;  5EZY A;  1WPB A;  3DGE A;  3ABT A;  5LGU A;  3CCV V;  3A0R A;  4DV7 O;  3SPC A;  3F5T A;  3ABL B;  3ZN0 A;  2AZ0 A;  2JJ1 G;  4X62 B;  1GN6 A;  1Q5O A;  2HEP A;  1YJW V;  1AP5 A;  2VRZ A;  3OR7 C;  3K5O A;  4RUE A;  1L1F A;  3QVN A;  1R3L C;  3L9D A;  2CK3 G;  3T1H B;  3LSU A;  4IYI A;  1JCH A;  2Q5Z A;  4WFE A;  3CEI A;  1Q43 A;  5EYP B;  1OV9 A;  2DYS C;  4HNA B;  2WLL B;  4ZI7 B;  3L73 H;  1OJH A;  3ZJZ A;  1Y74 B;  3QNE A;  1OZ0 A;  3ZHT A;  2MK3 A;  4DK0 A;  2HHH O;  1R3J C;  2EUL A;  3CRQ A;  3IC7 A;  4DR1 O;  5JH7 A;  1M57 B;  4X64 B;  4F6R B;  3O65 A;  1S5J A;  4D7S A;  4LFC O;  1WJZ A;  1S5L Z;  2LQT A;  3G80 A;  1EFR G;  1XEQ A;  4H44 B;  4UVA A;  5CA1 A;  3SPI A;  4DUZ B;  4EEQ A;  3FB7 C;  3SR2 C;  1TUB A;  4KHP B;  4N21 A;  5FNV B;  4DR5 B;  4G27 B;  3CYO A;  3UKM A;  4J11 A;  2UXD O;  3OM3 B;  1SZX A;  5L3B A;  2WA3 A;  2ZDI C;  4FFB B;  3SPJ A;  5LHG A;  2H8P C;  3SJC C;  3TGU H;  2Z0A A;  4U3J A;  5JJJ B;  1GRJ A;  1IBM B;  1DF5 A;  3ZMS A;  4PDL A;  4NB5 A;  1BZK A;  1I5Y A;  2QTS A;  2C2A A;  1XIL A;  3KG2 A;  3OMI B;  1LR1 A;  3CC4 V;  4AHC A;  4I55 B;  1V54 C;  5GW7 A;  4JI3 B;  4I9Q A;  2Q4P A;  1H2L A;  3JSL A;  1QVF U;  4RQE A;  5JWP A;  4TWK A;  5IT9 N;  4B3T O;  1K34 A;  2ZIO A;  5IJ0 A;  5JVD B;  4FLT A;  4KP4 A;  4DV5 B;  5IYB O;  4GCZ A;  2ZXW B;  2YI8 A;  1BSM A;  2Y0I A;  2DWE C;  2OT5 A;  4JTD B;  4XBF A;  3AG1 C;  2Y4T A;  1NR7 A;  4TQD A;  4EB6 B;  5CA0 B;  3KZI Z;  1X4T A;  4NR1 A;  3JSN A;  5D5P A;  4UV8 A;  2EZP A;  3ABM B;  2Y69 C;  5B1O A;  5LOV B;  1H38 A;  4K35 A;  1NH2 D;  2EIN C;  3SYQ A;  4GKJ B;  4EKW A;  5KA5 A;  1L8D A;  4J7Z A;  1N0J A;  3CCM V;  1RSO B;  3FAV B;  3ETG A;  1K5Q A;  3JAK A;  5EBM C;  5GTI Z;  5LHH A;  5IJ9 B;  4JV5 O;  3OUF A;  5C93 A;  3K0G A;  1M5I A;  1WB7 A;  1FPO A;  2QWN B;  5IYD O;  1VAR A;  3M7M X;  2ZCE A;  2E5L O;  2XHB A;  1N32 B;  4TOI A;  1U97 A;  5CB4 A;  1PKX A;  3APO A;  1FFX B;  4X66 O;  2KG7 B;  3W7U A;  2P90 A;  5J9P C;  5H6Q A;  3SDL A;  4P9O A;  3JAT A;  3CCS V;  1FXH A;  3AG4 B;  4DV1 O;  3BVO A;  4QJF B;  3BA9 A;  2IJJ A;  3RT3 C;  1ZL8 B;  2R72 A;  4QGP A;  5LXT A;  1R1B A;  4DV4 O;  2QTO A;  2H94 A;  3D3I A;  3AG3 B;  3U10 A;  2Y48 A;  5F2V O;  2ZIM A;  1VQ8 V;  4OPH A;  1NH2 B;  3H01 A;  2UU9 O;  1EN5 A;  2F43 G;  1S5H C;  1HNW B;  4UV9 A;  4FIP C;  4OX9 B;  4J7J A;  1PNK A;  2ETN A;  4L87 A;  4RQF A;  1RPR A;  2R9R B;  4UCT A;  4QNH B;  1PM9 A;  3MDS A;  2QSA A;  2YEV A;  2JDI G;  2BSK B;  1F23 A;  2VS0 A;  5J2T B;  3THO A;  2HR3 A;  2RNB A;  3BPZ A;  4I0X A;  4DUY B;  4A5U B;  2CH7 A;  4JI2 B;  1SQB H;  1K4D C;  1XOU A;  2QM4 A;  2YS8 A;  2QR4 A;  1GN3 A;  1OCZ B;  2EIM C;  3ASO B;  1JFF B;  1AJN A;  3ZN1 A;  4YHH O;  4X1I B;  1XBL A;  3ZIA G;  3LDD A;  4MSW C;  1K33 A;  1AB3 A;  1V55 B;  3FB6 C;  4UCV A;  1HDJ A;  2K1E A;  3RYI A;  3K58 A;  3RYF B;  2WLI B;  4FLV A;  3R65 A;  1XNR O;  4JI0 B;  1NU1 H;  4TV8 A;  4WBN B;  4PDR A;  3ZMZ A;  2A3Q A;  3AK3 A;  3VQX A;  3H9V A;  3E8B A;  1I5X A;  1UFI A;  4FM0 A;  1YJN V;  1W2B U;  2UXC O;  3OAA G;  3BFR A;  4DR3 B;  3D8C A;  2DYR C;  2JVD A;  2ZR3 A;  4YY3 B;  2JS5 A;  2ADP A;  4QE7 A;  3JD2 A;  5CA1 B;  2QE7 G;  1JVM A;  2QM7 A;  2X6A A;  4I50 A;  4FZ1 A;  3WG7 C;  3IAY A;  1HR0 B;  3K57 A;  3KCY A;  5B66 Z;  1N33 O;  2EIJ C;  4P30 A;  4GKK O;  4MVU A;  5JJE B;  3QO7 A;  1B3Q A;  3SYA A;  1G8M A;  2UUB O;  2G38 A;  4U7N A;  1M9N A;  3FD9 A;  4ABM A;  4WF9 V;  1MNG A;  4WFA V;  2Y69 B;  1P4R A;  2F95 B;  3CX5 F;  5JCO C;  4J41 A;  4TQF A;  4QPJ A;  3HR0 A;  5JQG B;  2VWJ A;  1N36 O;  4H37 A;  3JAW B;  2AHY A;  1IDS A;  2XOK G;  4CS2 A;  1ZAU A;  3FB8 C;  1OCO B;  3G71 V;  1VQ9 V;  2IBZ H;  2N74 A;  5EYP A;  4DV3 B;  1Q86 W;  5H9C A;  3QF7 A;  4HNA A;  2WLL A;  2ZR2 A;  4JAS A;  3AEI A;  1PL0 A;  4MTF A;  1GN2 A;  2EX3 A;  3VBB A;  5B5E Z;  5TIS Z;  1QLE B;  1XNQ O;  1SQP H;  3VOU A;  5EC2 C;  1YJ9 V;  1IUR A;  4X65 O;  3DC5 A;  4O4H B;  2AGA A;  3U11 A;  4DRX B;  2YXH A;  2IM9 A;  2VQE O;  4LF5 B;  2E76 B;  4J10 A;  2OYQ A;  3OUS A;  1SES A;  4NTW A;  4UB8 Z;  3RGB A;  2UXX A;  5CBH A;  4DW1 A;  4JI8 O;  1MSD A;  5FNV A;  4FMT A;  3UQ8 A;  1FKA O;  3MHS C;  5FL7 G;  4LF7 O;  1RFY A;  4DV4 B;  4B3S O;  4K8X A;  1Z5W A;  1JQ0 A;  5KMG B;  3W7W A;  4FFB A;  4QPK A;  1WNS A;  3ABU A;  2UU9 B;  2WLN A;  3TXQ A;  2UXB O;  1B6Q A;  2JS3 A;  4LF6 B;  5LMU B;  3EVK A;  5DM6 V;  5LP6 C;  1AR1 B;  4LF8 B;  2PY5 A;  1R73 A;  4JI4 B;  3E8H A;  1BL8 A;  1THZ A;  2QDO A;  4DR6 O;  4PA3 A;  1HNX B;  4X1K B;  1G4Y B;  3G67 A;  3SYC A;  2GDS A;  3F5W C;  2W6I G;  4JTC B;  2OTJ V;  3AG2 C;  4O4J B;  1W0K G;  3RVZ A;  5LBQ A;  4E4E A;  1FYJ A;  4LCU C;  2XAH A;  5JVD A;  4JI1 O;  4LFB O;  1DK1 A;  3RVY A;  1EZV H;  4YHH B;  3UT5 B;  2FL4 A;  2UUC O;  1U96 A;  2ZT9 B;  2EJR A;  4GT1 A;  4D6T H;  1EM1 A;  2QKA A;  3B09 A;  3K5M A;  1M1K W;  1TVK A;  5LOV A;  1XNR B;  3JCU Z;  1VF7 A;  5EBL C;  4LF4 O;  4FK5 C;  2X0L A;  3KCX A;  2D3O W;  2ZQM A;  1RSO A;  3FAV A;  4HYO A;  2V7Q G;  2W0F C;  3G6B A;  5IJ9 A;  3JCZ A;  1MSW D;  2GHY A;  1I08 A;  2NLJ C;  1ZX3 A;  1Q90 D;  3E22 B;  3X2Q C;  4X8A A;  3DSQ A;  3W7S A;  2YID A;  3ETE A;  1P7B A;  2XAJ A;  2CTR A;  3OE7 G;  5IY5 C;  4TV8 B;  1FFX A;  1BT8 A;  2KG7 A;  1XMQ O;  3DC6 A;  3D36 C;  3MD0 A;  4K0K B;  2IH1 C;  4JAA A;  2P06 A;  1N36 B;  4B7E A;  5K1P A;  2Q67 A;  2DQ0 A;  2YIB D;  1AJQ A;  2M6Y A;  3OT7 A;  4I50 B;  1HW7 A;  2ZE5 A;  2HG5 C;  1WAZ A;  4MW3 A;  3LNN A;  2CDY A;  4CBC A;  1R6T A;  1H2S B;  2CTP A;  3ZMV A;  4CZZ A;  4DR2 B;  1A32 A;  4NKG B;  3L70 H;  1NI8 A;  1FXK B;  2HP8 A;  4XDJ A;  1JX9 A;  3T2M A;  3LDC A;  2BSK A;  1GM8 A;  5IDJ A;  5J2T A;  1I7F A;  3ABK B;  1CPY A;  1S76 D;  2ADQ B;  4PDV A;  2H3O A;  2BE3 A;  1GO3 F;  5LMN B;  1ZWI C;  1YEW A;  1NT2 B;  3TJT A;  3QG5 A;  5LA6 B;  5KAF Z;  3LUT B;  2OCC C;  4X9Q A;  2RDC A;  1JFF A;  1SQF A;  4YIO A;  3TXS A;  1IZ3 A;  4X1I A;  4MT8 A;  4UUJ C;  2LGQ A;  5KHI A;  2JEU A;  3OTO O;  1AVM A;  4B3S B;  1KD1 W;  2DE0 X;  1JMK C;  3RYF A;  2WLI A;  4CS3 A;  1RM1 C;  4G2K A;  3I55 V;  3JD4 A;  1Q6H A;  4WBN A;  2BOB C;  2ZNJ A;  2EIL B;  4O2A B;  4IL6 Z;  1JJO A;  5HFL A;  1GAX A;  5IWA B;  2KSD A;  4X89 A;  4ASU G;  4YXW G;  5LP6 B;  4LR3 A;  4DV6 B;  3ETQ A;  3E8G A;  3CCL V;  1P49 A;  3ZRW B;  4J42 A;  2P22 C;  1NTZ H;  5BXZ A;  1VQP V;  1VQL V;  2CAZ C;  2LO1 A;  1VF6 A;  2JIZ G;  4UFZ A;  5LYJ B;  2X6C A;  2DOS A;  2EBO A;  4HAM A;  1Q82 W;  3ZMU A;  3K04 A;  4IIJ B;  3SJB C;  3TCU A;  2DN9 A;  3WU2 Z;  1FJG O;  3CJH B;  5KHJ A;  3LNM B;  1HP8 A;  5KAI Z;  1JA8 A;  5JQG A;  2LW7 A;  1SA0 B;  4RO2 A;  1SET A;  2WSS G;  3K9S A;  5CMU A;  2XUM A;  3JAW A;  2Q8V A;  2UUA O;  5IYZ A;  2ZD9 A;  1W0J G;  2GTA A;  2CE4 A;  4B3R O;  4E2L A;  1WA8 B;  3ZRS A;  2Q7H A;  4LH7 A;  3BEH A;  2DW4 A;  3CRA A;  1IJG A;  3ZRV A;  1TAE A;  2QM8 A;  3QTC A;  5DN6 G;  1XL6 A;  3F7Y C;  3X2Q B;  2F4V B;  1K92 A;  1OCR C;  5L3G A;  3JYC A;  1FOU A;  2EJ7 A;  1SF9 A;  4AIL C;  1K7D A;  4MVO A;  2CUG A;  2PZS A;  1N0N A;  4O4H A;  4DRX A;  3OTF A;  5J2U B;  1CP9 A;  1TVK B;  3UCS C;  1VF5 B;  4JI7 O;  1KQS U;  3HKE B;  1O9H A;  4NXN O;  2W0X A;  2DMX A;  4JI5 O;  1I94 B;  4CH4 A;  1LNQ A;  3CCU V;  4DV2 O;  4BIU A;  2RMK B;  1YSC A;  2PF4 E;  5L3F A;  4CC6 A;  3K5L A;  1J5E O;  1R6N A;  2VQF O;  5KHH A;  5KMG A;  5FPR A;  4I9W A;  2IJI A;  3FB5 C;  3E35 A;  4DV0 B;  4Q6G A;  1COW G;  4AQY O;  1FXV A;  3HKC B;  5LL6 Y;  2LFR A;  4DV7 B;  3CMA V;  2EIK C;  5EIB C;  4UCU A;  1SQG A;  3RFR A;  2CGO A;  4FM2 A;  1SQV H;  2A9H A;  5L3E A;  3CWB H;  4X1K A;  1B06 A;  1URF A;  1GTO A;  4WFG A;  3B8M A;  4WFB V;  1QHT A;  1Q6I A;  4O4J A;  2LGW A;  1VMG A;  3QO8 A;  1PD3 A;  1BCC H;  2HLD G;  2YIA A;  4MTG A;  4BAY A;  4JI6 O;  4X20 B;  2IW5 A;  1XL4 A;  3JAR A;  3ML0 A;  1GK9 A;  4BIO A;  1LUV A;  1K3E A;  3T1Y O;  5LHI A;  1VQ5 V;  3UT5 A;  2DYS B;  4NXM O;  3PJS K;  4MS2 A;  1YCI A;  3OGI B;  1RM1 B;  3OTO B;  3W7X A;  1FS0 G;  2JJ2 G;  2XAQ A;  1YZB A;  4X1Y B;  1KBH A;  2HHH B;  3E2E A;  4PA6 A;  3O9O A;  4DR1 B;  2WLJ A;  5B1B C;  1MAB G;  1F4M A;  3K06 A;  3GWK C;  1NKD A;  4PI2 A;  4PJ0 Z;  1AR5 A;  4LFC B;  3JAS A;  4YJ3 A;  4FJC C;  3FYE B;  1W59 A;  4RAI A;  5LGN A;  2LW1 A;  4F4L A;  3IC9 A;  4JTA B;  3SJQ C;  1S72 V;  3E22 A;  2Y4U A;  1Y66 A;  2WLK A;  5B3S C;  3CHX A;  2ZNI A;  2L35 A;  1ORQ C;  2PI4 A;  4LFA O;  1BQ0 A;  4DW0 A;  1H8E G;  3N2G A;  3CD6 V;  2UXD B;  4ZBM A;  3QO5 A;  2Q7G A;  4J9Z B;  3RYC A;  1MG1 A;  1ENV A;  3MHH C;  1NBM G;  1SC5 B;  2X7R B;  1X59 A;  4FLW A;  2P6J A;  3UO3 A;  3GB7 C;  3W7T A;  3IJ4 A;  2IU0 A;  1Y4M A;  3H1J H;  1V54 B;  2WLM A;  4UB6 Z;  2AXT Z;  4GX5 A;  5EIB D;  3JAM N;  2QA4 V;  2FB5 A;  3SJA C;  4OPA A;  5DEC A;  3OEE G;  4W4K A;  2DJV A;  3K3W A;  2ATK C;  2YI9 A;  4TV9 B;  1K5S A;  1BQZ A;  4CC5 A;  3BAB A;  3K5N A;  5CBF A;  4B3T B;  5ITZ A;  4B3M O;  2UXN A;  3JAL B;  3OD4 A;  3RYH A;  1Q81 W;  3AG1 B;  1FXK A;  2Q6A A;  1KP2 A;  3LSQ A;  1PV0 A;  1DF4 A;  1N34 O;  1YI2 V;  4LP8 A;  2EIN B;  1UJW B;  2QKC A;  1XMO O;  2HFE C;  1BMF G;  5LA6 A;  1HWY A;  1WB8 A;  5IYZ B;  4NXN B;  3CRC A;  3CC7 V;  3SPG A;  3B4S A;  1HNZ O;  2OTL V;  3ASN C;  2Q68 A;  1RPO A;  3U0Z A;  4FLU A;  4WFF A;  4YJ2 B;  4JV5 B;  4U7O A;  1QCE A;  3AK1 A;  3C3S A;  4B7K A;  4W4L A;  2P4V A;  3ZS8 C;  1MZF A;  5L3C A;  1XI1 A;  4O2A A;  5DED A;  4AQY B;  3GVM A;  4JAU A;  4NTX A;  2E5L B;  1WLE A;  2EIK B;  5LP6 A;  2B1I A;  2XTA A;  1JNB A;  2PGG A;  2YIB A;  3M99 B;  4BIZ A;  4FPP A;  1P84 F;  1JR9 A;  4X66 B;  1IVS A;  4MTX A;  2BCC H;  2BTQ B;  3WB1 A;  4X62 O;  3ZRW A;  4HBN A;  3DXR B;  3C3T A;  5FLX N;  3Q4H B;  4DV1 B;  3RWR D;  4RWU A;  1O9G A;  2OCH A;  2PYL A;  4LC1 A;  5LYJ A;  4JI6 B;  4FLZ A;  2PI5 A;  1ZLZ A;  4MVS A;  2Z3Y A;  4IIJ A;  1IBL O;  1MOF A;  3T1Y B;  4PA7 A;  1KP3 A;  1NR1 A;  4B08 A;  1E79 G;  3CJH A;  3P30 A;  2ARH A;  4GZR B;  5IYC O;  4OGQ B;  4FM1 A;  1SA0 A;  3FKS G;  1ZSP A;  5C8Y A;  2P5O A;  2Q0A A;  1SQX H;  3ZBH A;  1WA8 A;  3STZ C;  2HVJ C;  2YXY A;  4X64 O;  3OFN G;  3I56 V;  2NNU A;  5HFM A;  2LJ2 A;  2EIM B;  3KKY A;  1KU9 A;  1PL4 A;  1JJ2 U;  3K03 A;  2XND G;  3JAR B;  4MVQ A;  1H2K A;  4I4T A;  4DUZ O;  5E1A C;  2WPD G;  4P2Z A;  4AI8 A;  4KHP O;  4QIW F;  3DTU B;  3TET A;  2YIC A;  2CGN A;  4DR5 O;  5AG2 A;  1Z2G A;  1D5A A;  5J2U A;  1NJI W;  1UPG A;  3FFQ A;  2P67 A;  3HKE A;  3K9A A;  2DWD C;  3AK2 A;  2OWO A;  2V4D A;  4JZG A;  3J80 N;  3VQV A;  4K8Z A;  3K59 A;  2PYJ A;  3H1L H;  1QBZ A;  2UXC B;  3RW0 A;  2DYR B;  1VIB A;  3JAS B;  4LNU A;  1IBM O;  4H0L B;  4YJ3 B;  2HJF C;  1ZTE A;  1NS1 A;  3WG7 B;  4GX1 A;  3BRC A;  3CME V;  2EIJ B;  1S77 D;  1K4C C;  2Q0O C;  4WCE V;  5EBW C;  1N33 B;  3HKC A;  3MAQ A;  4GKK B;  3N2G B;  1TA8 A;  4B3M B;  3OMA B;  4DV5 O;  4ICG A;  1CEZ A;  3RYC B;  2UUB B;  2E74 B;  2QWO B;  5GTH Z;  1G6U A;  1Q7Y W;  5CA3 A;  5JJN B;  3UO2 A;  4BW9 A;  1AI6 A;  2GUZ B;  1XMO B;  2JGD B;  4LWS B;  3JD3 A;  3M8A A;  1K8A W;  3OEH G;  4X20 A;  4CH6 A;  4H33 A;  3ABM C;  3CSX A;  3ASN B;  4GKJ O;  3NXS A;  1ARO P;  1E1R G;  2F23 A;  2F1M A;  1DLB A;  2QJ1 A;  2EZO A;  4JYA O;  4D7T A;  2ZE6 A;  5CN0 A;  3ICX A;  4FLY A;  1YIT V;  4IYH A;  4UCS A;  4I5S A;  5ITZ B;  2B5U A;  1OCC C;  3P3P A;  5KA6 A;  4K3A A;  2IJH A;  1KKD A;  3L74 H;  3RYH B;  2WAM A;  1PPJ H;  4X1Y A;  1XNQ B;  2XT9 A;  2HJD A;  3A0B Z;  3OGC C;  4JYC A;  5H2F Z;  4X65 B;  2Y0P A;  4DR7 O;  4FFK A;  4JPR A;  2QWP B;  3OMN B;  1GKF A;  2E3C A;  1N32 O;  2VQE B;  1H2G A;  3E89 A;  4J80 A;  2RN9 A;  4ZOL B;  2BTO A;  1YHQ V;  1XQ8 A;  1D5N A;  3ZHV A;  3WB2 A;  4JI8 B;  2YUA A;  2GBO A;  3BCC H;  5FPO A;  4LF7 B;  2NR5 A;  3J81 N;  3B77 A;  4J9Y B;  1G1X B;  1MA1 A;  2ZDI A;  1PNL A;  3AG4 C;  1AI7 A;  1IBL B;  1WP7 A;  1GM7 A;  2W6J G;  2JK5 C;  1LUW A;  2VWK A;  3AG3 C;  1XHZ A;  2A06 H;  4UCO A;  1XHX A;  2UXB B;  1HNW O;  3WB0 A;  1VQ4 V;  4PI0 A;  1F51 A;  2P4K A;  4OX9 O;  1Q8I A;  1H2M A;  2ITC C;  4JAV A;  1QQC A;  1XDC A;  3E8F A;  1NZ6 A;  4J7K A;  4JZ2 A;  1GH6 A;  4DR6 B;  1AIL A;  5GON B;  3A8T A;  3AG2 B;  3H1I H;  1NVP D;  4MVZ A;  4Z1V A;  5KHG A;  4TV9 A;  1AP6 A;  1TGO A;  3N2K B;  2PTM A;  4DUY O;  4JI2 O;  1CXZ B;  3T1C A;  2R9A A;  4O4I B;  3JAL A;  1KEC A;  4JI1 B;  4JYB A;  4LFB B;  1AJP A;  2WWW A;  4PD4 F;  2UUC B;  1OCZ C;  3ASO C;  1VQ7 V;  1QU7 A;  4PHZ A;  2Z5U A;  3L72 H;  4G28 B;  3G4S V;  3SPH A;  1JOY A;  1V55 C;  2A0L A;  3CP1 A;  5C8Y B;  4ZHQ B;  4LF4 B;  4JI0 O;  1FFT B;  3CXH F;  1BS3 A;  3UM7 A;  3N27 A;  3P32 A;  3ZHQ A;  2F66 C;  1P7G A;  2FML A;  4R6Z A;  1T5E A;  1S3J A;  4GYC B;  4DR3 O;  4YJ2 A;  2ZE7 A;  2WA4 A;  3CB2 A;  1VQO V;  4YY3 O;  3CRM A;  4MTO A;  3NR7 A;  5BMV A;  2QEX V;  4NYK A;  4I4T B;  1BGY H;  4DXW A;  4HZ3 A;  4XDL A;  5A2Q N;  2M7W A;  2ZM6 O;  2Q7E A;  2OIE A;  1H5W A;  1HR0 O;  4PA9 A;  4DO2 A;  1K73 W;  3L71 H;  2QGN A;  5IY5 B;  4MVM A;  1VF6 C;  1M56 C;  1BE3 H;  1NVP B;  1KUQ A;  4R8C A;  4UCR A;  1VQM V;  4PDM A;  2HVK C;  4GX0 A;  5L3D A;  1N8R W;  2BTQ A;  1XMQ B;  1VQN V;  3DXR A;  3K0D A;  3IFX A;  4IHJ B;  3Q4H A;  4LNU B;  4CS4 A;  3CCR V;  1Z5V A;  4O4L A;  3CCE V;  4F6E A;  5EC1 C;  2D2C B;  3BY6 A;  2B9Z A;  4UXN A;  2A7W A;  3EHB B;  5H5N A;  4LF9 O;  2QKS A;  1RP3 B;  4JYA B;  1YIJ V;  1OCC B;  5E79 Z;  1QR9 A;  4O2B B;  5LGT A;  1FAF A;  4DV3 O;  1OCO C;  4FZ0 A;  3B40 A;  1AR4 A;  4FVM A;  4IGG A;  1VQ6 V;  3L75 H;  2LP7 A;  4DR7 B;  1QLE C;  1YF2 A;  4R50 A;  3CC2 V;  2L6L A;  3VQY A;  3CPW U;  1D2D A;  3ZHR A;  2OCC B;  1N4C A;  2Q73 A;  1SZT A;  4LF5 O;  1M93 A;  3VQW A;  1SQQ H;  4R7C A;  3ZCC A;  1Y76 B;  1DTO A;  1K9M W;  2ZE8 A;  2MW2 B;  3TK1 A;  3SYP A;  4LBE C;  3WFV A;  4JYY A;  3D3Q A;  3T4D A;  4C7U A;  5EZY B;  5B1A C;  1R3K C;  1F7Y A;  2ITD C;  1YTF D;  3H1K H;  1IBK O;  2KQX A;  3ZMT A;  4Z1M G;  1I0H A;  1ZUQ A;  1J95 A;  4LF6 O;  5LMU O;  4XDK A;  4N23 A;  2GTS A;  4LF8 O;  3HKB A;  1E1Q G;  4DR4 O;  3A2F A;  4JI4 O;  3K08 A;  1HNX O;  4IT5 A;  2X6B A;  2AZ2 A;  3GWO A;  2K9P A;  3JD0 A;  2AW9 A;  4KXR A;  1IXB A;  3CCQ V;  3RBZ A;  4TUY A;  3K79 A;  3FYI B;  4DYL A;  4KL1 A;  4KFM A;  4UVC A;  3APQ A;  5JCO A;  1FJG B;  4NTY A;  2R9I A;  3CRR A;  3C90 A;  3HKD A;  4LH6 A;  4ZIB A;  4Q20 A;  1AI5 A;  3RN4 A;  4I7Z B;  2GUZ A;  2JGD A;  4LWS A;  4MW8 A;  1QR8 A;  4EFB A;  2UUA B;  4B3R B;  5H6R A;  1OHH G;  3R66 A;  5JH7 B;  1VP7 A; 
#chains in the Genus database with same CATH homology
 1XUQ A;  1N0J A;  4X9Q A;  3KKY A;  1PL4 A;  4YIO A;  5A9G A;  1WB8 A;  3DC5 A;  1BS3 A;  4BR6 A;  1N0N A;  1P7G A;  1AR5 A;  3KDR A;  1AVM A;  1WB7 A;  4FFK A;  1I08 A;  5AG2 A;  3AK1 A;  3C3S A;  3AK3 A;  1VAR A;  3IC9 A;  1Y67 A;  3AK2 A;  1MSD A;  4JYY A;  3BFR A;  4JZG A;  1D5N A;  2ADP A;  4C7U A;  1SZX A;  1GN4 A;  1BT8 A;  1JR9 A;  1ZTE A;  1MA1 A;  1I0H A;  1ZUQ A;  3DC6 A;  1IX9 A;  4YIP A;  1XRE A;  3C3T A;  1XIL A;  3EVK A;  1LUW A;  1GN6 A;  2AW9 A;  4F6E A;  1ZLZ A;  1AP5 A;  1IXB A;  1EN4 A;  2P4K A;  3OT7 A;  1VEW A;  2GDS A;  1MMM A;  4GUN A;  1EN5 A;  1MNG A;  1XDC A;  1B06 A;  1QNM A;  4JZ2 A;  3QVN A;  2CDY A;  4E4E A;  1JA8 A;  1AP6 A;  1BSM A;  1PM9 A;  1IDS A;  3MDS A;  3K9S A;  1KKC A;  3LSU A;  1ZSP A;  3CEI A;  2RCV A;  3RN4 A;  2CE4 A;  1LUV A;  1AR4 A;  2ADQ B;  1EM1 A;  2QKA A;  3TJT A;  1GN3 A;  2QKC A;  1GN2 A;  1EN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...