3CEIA

Crystal structure of superoxide dismutase from helicobacter pylori
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
213
structure length
213
Chain Sequence
b'MFTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQIYNHDFYWDCLSPKATALSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYGHINWHFVSQCYEWAKKEGLGSVDYYINELVHKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
molecule tags Oxidoreductase
source organism Helicobacter pylori
publication title The crystal structure of the superoxide dismutase from Helicobacter pylori reveals a structured C-terminal extension
pubmed doi rcsb
total genus 77
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ceiA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ceiA02
2QKCA 3AK1A 1WB7A 3QVNA 4F6EA 1GN3A 2CE4A 1AP6A 1PL4A 2CDYA 3AK2A 1VARA 1N0JA 1I08A 3DC6A 2AW9A 1MNGA 1GN4A 1ZLZA 3BFRA 3K9SA 1MSDA 1BSMA 3AK3A 1MA1A 3CEIA 4JZ2A 1QNMA 1JR9A 1Y67A 1KKCA 4JYYA 1EN5A 1XUQA 3DC5A 1BS3A 1IXBA 1IDSA 4E4EA 1N0NA 1I0HA 1ZUQA 5A9GA 3RN4A 1JA8A 3OT7A 4X9QA 1D5NA 1AP5A 1XDCA 1P7GA 1AVMA 1IX9A 2RCVA 3C3TA 5AG2A 1EN6A 4BR6A 3KKYA 4YIOA 3LSUA 2ADQB 3IC9A 3EVKA 1ZSPA 4FFKA 1XILA 1LUWA 1PM9A 4GUNA 1LUVA 2QKAA 1AR5A 4JZGA 2GDSA 1VEWA 1B06A 1BT8A 3TJTA 1EN4A 4YIPA 3C3SA 2ADPA 1SZXA 1MMMA 1ZTEA 3MDSA 1GN6A 4C7UA 1GN2A 1AR4A 2P4KA 1EM1A 1WB8A 1XREA
chains in the Genus database with same CATH superfamily
1PNLA 3L74H 2ZR3A 1EBOA 2ZDIA 1RM1C 5LOVA 4DR4O 1ZL8A 4YHHO 3RVYA 2RNBA 3QNEA 1H2NA 5TISZ 1RSOB 2Y0IA 2WLIA 3GVMA 3JARA 1I94O 4U7OA 1V55B 2YIAA 1K9MW 2XAQA 4KFMA 2CTQA 4J9ZB 2UUCO 3SR2C 2Q7HA 4EB6A 3G71V 4FJCC 3W7SA 3SJCC 2A7WA 2B5UA 4I9WA 2LW1A 3E8HA 1QR9A 4E4EA 5LYJB 5BMVA 2EJ7A 4I55A 4BW5A 3OT7A 2V4DA 4X89A 4CC5A 1AB3A 4X66O 4FZ1A 2YEVA 4IYIA 3JYCA 1JNBA 2R9AA 5LMNB 2XHBA 1Y76B 1TGOA 1AVMA 4P2ZA 3C3TA 4PV1B 1V55C 3B8NA 3FAVB 1W59A 2HJDA 2LFRA 2JJ2G 2RDCA 5KAFZ 1Q82W 3BVOA 1JQ0A 5C8YB 3ETQA 2V1DA 4UUJC 3P30A 4JZGA 1YZBA 5B1BC 1XMQB 5J2TB 5IDJA 3DXRA 2PI4A 3FYIB 3T1HO 1VQ9V 3CE2A 2WLNA 2ZM6O 3ZX6A 1K92A 2EINB 1IBKB 1IBKO 3N2KA 1YSCA 3MDSA 1ZAUA 4DV6O 2LO1A 2XOKG 2A9HA 4JI0B 3S3WA 3JD1A 3ZN1A 1FXHA 1ZWIC 2B1GA 1V54C 4LFCO 3SDLA 3AG3C 1NBMG 4EEQA 2Q0OC 5CA1A 2VQEB 2ZR2A 1Z2GA 1TUEB 1A32A 5KUKA 2Q5ZA 1TUBA 3EFFK 5B1BB 2QE7G 2XT9A 3AK3A 3E22A 2Q9LA 1XNQB 4UVCA 1M4UA 2A3QA 1WLEA 3E35A 1H38A 1JR9A 1Y67A 1PPJH 3ABLC 3AG2C 1Y6XA 2UXXA 5EC2C 1BS3A 3RGBA 5KHGA 4TUYA 1MZEA 3KCYA 4K3AA 1ZUQA 2YDEA 2H94A 2KB1A 1BQZA 1SKVA 5EIBC 1QBZA 5DN6G 4JI2B 2PYJA 5LOVB 3JASB 4H37A 1AP5A 5DEDA 3CXCU 1HR0B 1TVKA 1VF5B 4O4IA 3IAYA 1PKXA 1FKAO 1H8EG 4TSFG 4YIOA 5E1AC 5IY5B 5LGTA 1G1XB 1F4MA 5IJ9A 2NR5A 4Z1MG 4EB6B 3H9VA 2W6IG 2V7QG 3SPIA 3BPZA 2R9RB 4A5UB 4WBNB 2DWDC 1M57B 1CEZA 1Q81W 3CD6V 3W7UA 2PTMA 1YXBA 2ZDIC 4QNHB 4DV3O 4LF8O 2PGGA 4YY3O 3CCEV 3ASOB 1XMOO 3MHSC 3TGUH 4X20B 2QWPB 4EFBA 4TWKA 4LF6B 4YJ3B 1U96A 5CA0B 3F5TA 1AR4A 4JTCB 2P4KA 2UUAB 3FAVA 3OMIB 4BIUA 4EFEA 1P4RA 4W4LA 4J7JA 4OX9B 3K3WA 2VQFO 3AK2A 2BTOA 3H1IH 1FFXB 1XEQA 3LUTB 2DN9A 3ABLB 4PDRA 5IYZB 5H2FZ 3K0DA 3UM7A 4DUYO 1GN4A 3LNNA 1ZLZA 2ITDC 5EIBD 1MSDA 3T1YB 3CPWU 1MA1A 2P6JA 1NVPB 4MS2A 4JI1O 2DMXA 3N2KB 4ZHQA 4DUYB 4DUZO 5BR8O 3ASOC 4DR6B 3ICXA 3BA8A 4K8ZA 4QGPA 3UQ8A 3W7WA 1Y66A 1VQ8V 5FPRA 1JA8A 4GLXA 3QTCA 3CS5A 4B3MO 4DK1A 4JI7O 3A0RA 3CCUV 2EILB 4B3MB 3MD0A 5AG2A 3ZS8C 4DXWA 1YTFD 5B3SC 1FXVA 5E79Z 5K1XA 1IZ3A 2GHYA 2DYSB 2M7WA 3ABKC 1K73W 2HR3A 1FD9A 3E86A 3OM3B 1ZL8B 2X0LA 4IYHA 4FM2A 4H13B 2QKAA 4Q6GA 4UCSA 4JTAB 2EBOA 1B06A 4YXWG 4F4LA 1S5LZ 3PN1A 5LA6A 2IBZH 1ZTEA 2JIZG 2XUMA 1GN6A 2UXNA 1PD3A 3OMNB 1COWG 1NTMH 3D3IA 1KC8W 2Z5UA 3E83A 1XMQO 3H01A 1KYOF 5BMVB 1KKDA 4X66B 2D3OW 4F6EA 4YJ2B 3ML0A 4FLYA 1I08A 3DC6A 3CC4V 2LGWA 2G38A 2EJRA 3T4DA 3FB5C 4CH5A 1I7FA 4DV1B 3D3QA 3O9OA 4LFAB 1EN5A 4WFBV 3CCSV 1IBLB 3RW0A 5A9GA 1S0VA 4PA3A 2Q67A 2QEXV 4GYCB 2NNUA 4LFBB 4UCVA 1D5NA 3RYHA 1Q6IA 4JI0O 1YTFB 1QVFU 4JI2O 1HWYA 1V9PA 2F43G 5KLVH 4JYAO 1NI8A 3LSUA 3JSNA 1S76D 1R6TA 2QR4A 4UCTA 1RM1B 2QJ1A 3SJQC 4X1KA 2HHHO 4DR3O 5JVDA 2N74A 3JAKB 4GX0A 1HP8A 2Z0AA 4J9YB 4O4HA 2O57A 2Q7GA 2PF4E 3R66A 3ZEDA 1G4YB 2LFSA 1GAXA 3FD9A 1M1KW 1NH2B 2F23A 3AG1C 2WLMA 5KHKA 1H2KA 5GONA 3ETEA 2BOBC 3ZRSA 4Z1VA 3ZRWA 1US6A 4JI8B 2VWJA 1XREA 2RJZA 3ZIAG 4AI8A 1JJ2U 2F1MA 1WA8B 4O2AA 4ZBMA 3B09A 1SESA 1AP6A 3CRRA 2CDYA 4NXMO 5LXTA 4LF9O 3QO8A 1B3QA 1XL6A 3RYIA 2GV9A 1D5AA 3BFRA 3OTOB 1W2BU 4TV9A 2Q0AA 1R1BA 1TAEA 2R72A 1BZKA 2BE3A 1GTOA 4N23A 3TXQA 2HVJC 1R73A 4JZ2A 4FLTA 1FAFA 3O65A 3S3XA 4JPRA 3BRCA 2ZIMA 5EYPA 4KHPB 1IJGA 4ZKIA 4I0XB 3B4SA 2ETNA 1VQ6V 4WBNA 3I5DA 1CXZB 3L72H 3QO7A 4RAIA 1BMFG 1FXKA 3JD3A 3ETDA 3LNMB 4DV6B 3CP1A 1J5EO 2EZPA 2CTPA 4LWSB 3RYFA 4GT1A 4BR6A 1Q6HA 2AZ0A 5IWAO 1ZSPA 4G27B 3IJ4A 2UU9O 2PI5A 2VQEO 2LQTA 3RWRD 4LFCB 5EBLC 1FFXA 3W7XA 5H6QA 1M90W 1B6QA 5CBHA 4R8CA 3HKCB 2HJFC 5L3DA 2WLLB 3C3SA 1PNKA 3SYQA 2BCCH 2CK3G 2GBOA 3FB6C 4CS2A 2ARHA 4J41A 4JI4B 4ABMA 1EM1A 1YJNV 3K04A 1AI7A 2AHZA 3STLC 2HFEC 4DR2O 1M5IA 1VQKV 1SF9A 2DQ3A 1F7YA 3K5NA 1WP8A 4DR7B 3E8FA 3WG7B 1YDXA 1VF7A 4JV5B 1RPRA 5IY5C 2PYLA 1S5HC 5KA6A 5KMGB 4CC6A 5HFMA 4NXNO 3A2FA 1R3IC 4PA6A 2KG7A 4ICGA 1VQLV 1SQXH 3CC2V 2BTQA 3DC5A 1LNQA 1W0KG 5GONB 1JPXA 1M57C 2LJ2A 3JAWB 1QVGU 5FNVB 2Z3YA 3CX5F 2ZE5A 1EFRG 2Y48A 2M6YA 2OTJV 3K03A 3SPCA 4TV8A 3RYIB 2XAGA 2MK3A 3H1HH 4LFBO 4DYLA 1XDCA 3F7VC 4MVUA 4TQDA 3F5WC 3ETGA 4PDMA 2QM7A 4DV4O 1SC5B 2CAZC 4DR1B 2FB5A 4DR5B 1YIJV 3H1JH 4FFKA 5B1AC 3JD2A 1XILA 2GSMB 4RUEA 1PM9A 1UFIA 5LYJA 3T1YO 4I0XA 3UCSC 1TA8A 4XDJA 2WAMA 3ZN0A 2CGOA 4JTDB 1F4NA 1SQQH 4KUMA 3SYPA 3G6BA 5IE9A 3KDRA 1GN2A 1N33O 1Y76A 2QWOB 1VQOV 1Q5OA 2WLJA 3OMAB 3JATB 4CH3A 1FS0G 1UPGA 2IJHA 2W6JG 1BCCH 1N34B 2UUBB 3HKDA 3LDEA 2YICA 4UXNA 2X6BA 3K58A 1YI2V 3WB1A 2DOSA 1O9HA 1PP9H 4X1YB 2QWNB 2CGNA 3DXRB 2QM4A 2WLLA 1SQBH 4F6RB 4CBCA 1XHXA 1NR1A 2ATKC 3Q4HB 3L75H 2KQXA 4X1KB 1FXKC 1FFTB 2CUGA 4QIWF 3OFNG 2LP7A 3JAKA 2DWEC 3BHPA 4B3RB 3U11A 4O4HB 2IM9A 2RMKB 1W0JG 4NKGB 3RN4A 1SRYA 4X64B 2FTKA 5J2UA 3K5LA 4FLXA 1VQPV 1F23A 4B3SB 5DM6V 1H8HG 1AI4A 1QU7A 3UKMA 1BE3H 2FMLA 3APQA 2EIJC 2MW2B 4PA9A 3ZCCA 4FFBB 1GKFA 4NXMB 3G80A 2OWOA 3IC7A 2DYRC 2ZCEA 5FLXN 3E22B 1SERA 3LDDA 1VP7A 4JYCA 4PA4A 2YUAA 1NKDA 1WA8A 2UUAO 3UT5B 3TXSA 2EIMB 2ZQMA 2P06A 1U97A 1OCOC 3ASNB 1FJGO 2ZXWC 4CS3A 3KG2A 2N05A 1BHBA 2W0FC 3JAWA 3OD4A 3RBZA 3JARB 2JDIG 1BHAA 2OIGA 2XAJA 4FPPA 2JGDA 3CCJV 1RP3B 1H2GA 2N04A 2ZM6B 3CCVV 4NB5A 1TVKB 4DW0A 5LP6B 1YHQV 3K5OA 3MHHC 2QKCA 3QVNA 4MW3A 4ZOLB 1H2LA 4WFEA 2RN9A 4R50A 2UU9B 4DR1O 2EIMC 5CB4B 3IFXA 2K1EA 3HB3B 4MSWC 3K06A 1HNXO 4LWSA 1JFFA 4U7NA 4DV2O 4QE9A 2ZE8A 3ZHQA 5EK0A 3BCCH 3CEIA 1IBMO 2JRIA 3FB7C 5B1OA 5GW7A 4R6ZA 4IL6Z 2ZNIA 5CMUA 2EILC 1GK9A 5C8YA 3SJAC 5KAIZ 5D5QA 4U3JB 1NTKH 4K8XA 1K34A 5LL6Y 4DR2B 4B08A 2P22C 3AG1B 4X64O 4MW8A 3SPJA 1E1QG 1N33B 1XNQO 4I5SA 4UV8A 4MTGA 1IX9A 2A06H 1E79G 1EN6A 2PUSA 4DUZB 4BIZA 3IC9A 3EVKA 1Q43A 3JCZA 4ZHQB 4X8AA 3F7YC 1GO3F 3UO2A 5KUMA 4TOIA 3K0GA 3CB2A 4ZI7A 1NJIW 2Y0PA 3JCUZ 1QHTA 3VOUA 4LF4B 4B7KA 5J2UB 4DO2A 5EZYA 4DK0A 3JD0A 1BQ0A 2WA3A 3A8TA 4FK5C 4DRXB 2BTQB 3TK1A 3AG7A 1K33A 1DTOA 1QQCA 3EXAA 4YY3B 5DECA 2F95B 3AK1A 4KL1A 3UT5A 1E1RG 2CH7B 1PL4A 3OEHG 2Q69A 4JYAB 5L3FA 4BW9A 4HYOA 4O2BA 5CBFA 1N0JA 4TV8B 2NN4A 5KX5B 1OHHG 4HNAB 4UB6Z 1QCEA 3VQXA 1RPOA 4FVMA 3B77A 3C90A 1XQ8A 4O4LA 4FLUA 3OEEG 5IJ9B 2ZD9A 2HKOA 2YIBD 4UVAA 2HP8A 3CCQV 1N36O 1N36B 5LP6A 5ITZA 4UFZA 2GUZB 5CBGA 1N0NA 4LF7O 3AEIA 2OCCB 4P30A 4ZOLA 4UCOA 4X9QA 4JI5B 3N2GA 3G67A 4YJ2A 2X6AA 2R9IA 2JGUA 1OCCC 3AG2B 1L0NH 1S72V 1XHZA 3KZIZ 1PV0A 3TCUA 4O4JB 2Y69B 4RWUA 3CWBH 1R3KC 4AHCA 4I7ZB 4B3TB 4W4KA 4NTYA 3VQWA 4LNUB 1M56C 2IJKA 4I50B 4JI4O 2ZE6A 1K4DC 1VEWA 1PNMA 4LF9B 2JEXA 5H6RA 5B66Z 4DR3B 4F6RA 3VQVA 4IIJA 5JJNB 3M99B 4LF4O 3ZHUA 1P49A 5EC1C 2Y4UA 4PHZA 1Q90D 3RVZA 2W0XA 4JYBA 1WNSA 3J80N 3CSXA 1GM7A 2HHHB 1WPBA 2Q68A 1WB8A 3HR0A 4GX1A 1WB7A 3ZHSA 4JI6O 4KHPO 2EULA 1AI6A 1GN3A 1OCZC 4KXRA 1HR0O 3BY6A 3ZMUA 4ZI7B 2JJ1G 1ZX3A 1QLNA 3HKEA 1BSMA 2YI9A 4L8JA 3QO5A 1EZVH 2BSKB 3L71H 5IWAB 4K0KB 5L3EA 5IJ0B 1QNMA 1AJQA 5F2VO 2JEUA 4DRXA 3J81N 1MABG 2H3OA 3ZRWB 2Y69C 1Y4MA 4D7TA 3T4ZA 1D2DA 1VQNV 3ABMB 4D7SA 3ZHVA 3H1LH 3JSLA 4H0LB 4DV1O 1S3JA 2QTOA 1VQ5V 2PZSA 3ABTA 4PI0A 2UXBO 3EHBB 1SETA 1Q6UA 3ZMTA 1WPXA 2RCVA 2L6LA 1R6KA 4LFAO 2QDOA 2HVKC 5JQGA 3M7MX 4PDVA 1UJWB 4DV3B 1KP2A 4H44B 3HKBB 1BL8A 2XAHA 1YJWV 1JOYA 3PJSK 5H9CA 1AI5A 5ITZB 2ZKOA 1LUWA 2YSUB 5CB4A 1YF2A 4JI3O 4E2LA 5B5EZ 1V54B 4X65B 3BEHA 1S5JA 3D8CA 1AJPA 3L70H 2QM8A 1BT8A 5LMUO 3SYAA 4DV0O 4IHJA 4GKJB 3ABMC 4D6TH 1FXKB 2YEVB 5J9PC 5LMUB 3BA9A 1KBHA 4PI2A 4C7UA 4WFFA 1I5XA 1Q7YW 4O4JA 2IU0A 1FYJA 3NR7A 3RYFB 1QLEC 4U3FH 2QA4V 2ODMA 1DLBA 2DJVA 4U3JA 1OCRC 3MAQA 4LCUC 2CTWA 3ZMSA 4J11A 3LSSA 1FOUA 2WSSG 3JD4A 4WFGA 5LP6C 4QJFB 2DYRB 5J2TA 4HZ3A 1YJ9V 2Q8VA 4J42A 3CMEV 1Y74B 5BZBA 3LSQA 1NVPD 3ABKB 1L0LH 2ZNJA 4CH4A 3DTUB 3W7TA 2RQ6A 4CZZA 1URFA 4I9QA 2VWKA 4EKWA 1IXBA 1IDSA 1WP7A 3DGEA 2DQ0A 5JJJB 4RO2A 4NXNB 1GM8A 4PDLA 2P67A 2X6CA 4JAVA 2A0LA 5B1AB 5FPOA 4JI1B 3K9AA 4UVBA 1J95A 4QE7A 5JH7A 1NR7A 3CCLV 2DW4A 3ABUA 2IH3C 4MVMA 4DR6O 4UCRA 3HKEB 1NQTA 3B40A 1Q8IA 5CA3A 1HNZB 4Q20A 2ZT9B 4PELA 4DV0B 4LP8A 1IXMA 2NLJC 3OTFA 5C93A 1SQPH 1AR5A 1RSOA 1HNZO 4DR5O 4GZRB 2Q6AA 1K3EA 1Z5VA 4YIPA 3OUSA 1OCRB 4BIOA 4J7ZA 2OYQA 2X7RB 2ADPA 4XBFA 1I5YA 1SZXA 1MMMA 4O4LB 3FFQA 4GKJO 2UXBB 4G2KA 4X88A 1S77D 5LGNA 1JCHA 2XAFA 5KA5A 2QTSA 3GWOA 4O4IB 4B3SO 4QPKA 4RQEA 3WB2A 3K59A 4OGQB 1R6NA 1Z5WA 2GUZA 2OIEA 5EBMC 3A0HZ 3OUFA 5KHJA 1VARA 2HLDG 5K1PA 4X65O 1YEWA 2GTAA 3APOA 4IGGA 1HW7A 4JAUA 4LC1A 3K9SA 1YITV 3FB8C 4JI3B 4JF3A 3I56V 1XNRO 5GTIZ 3T2MA 3OR6C 1KQSU 1KKCA 4YJ3A 4JYYA 1F51A 3OGCC 5CA0A 3TETA 3E8GA 5JWPA 1N34O 2UUBO 2P4VA 2QWQB 4IIJB 1Q3EA 3HKDB 4JV5O 1K7DA 1EZJA 2JVDA 1AJNA 1SS3A 4X1IA 3SPGA 4PA7A 1SZTA 3CJHA 3KKYA 2JK5C 1G6UA 4P9OA 2JS3A 1R3JC 1THZA 1HDJA 1FPOA 1H2MA 1LR1A 3IGAC 3T1HB 4JASA 4B7EA 2DE0X 1DGSA 3D36C 1N4CA 2VRZA 3NXSA 1AR1B 1KU9A 2AGAA 1T5EA 1MZFA 5EBWC 1TUBB 3TJTA 4DV4B 4UCUA 4LF6O 4MVZA 5JCOC 3L73H 4N21A 5KMGA 1K8AW 3ZMVA 5KHIA 5LMNO 4FFBA 1B04A 5HFLA 5LBQA 4DV5O 2CTRA 2WLKA 1J5EB 2F66C 4GKKB 2OCCC 3CC7V 4NTWA 1N32O 5D5PA 1M9NA 2YIDA 2OCHA 4TQFA 4LH7A 3JASA 1IVSA 4ZIBA 4OPAA 2ITCC 2UXCB 3ZRVA 4PJ0Z 3H1KH 4FM0A 3OW2U 4MTOA 3M8AA 5GTHZ 2IJIA 2WLHA 3SPHA 4JAAA 1XL4A 5JQGB 1I94B 2XNDG 4LR3A 4MVRA 2FKXA 4WFAV 1M56B 2JGDB 4JI5O 2HEPA 3N27A 4WCEV 1GRJA 2WPDG 1XUQA 2R70A 3ZBHA 1I0HA 2L35A 3HPLC 3CYOA 2EINC 3CCMV 1VF6C 2P90A 1NS1A 4J7KA 1WAZA 2YI8A 1M93A 1SA0B 1RFYA 1P7GA 3RYCA 3WFVA 1JFFB 3X2QC 4X62O 4JI6B 1OJHA 2ADQB 5FL7G 1HNWB 4G28B 2OTLV 2QWRB 2UUCB 1PL0A 5IYZA 4DR7O 1LUVA 4LF8B 4X1YA 2YXLA 3OAAG 2FYUH 4AILC 4CS4A 1O9GA 1Y74A 1OV9A 1VQ4V 3JALB 2C2AA 4FLWA 3Q4HA 3ZJZA 3L9DA 1N32B 3FKSG 3ZMZA 2XTAA 1FJGB 4XDKA 1OCCB 4I4TB 4J10A 2VS0A 5LHIA 1VIBA 1CPYA 3ZRXA 3G4SV 4LF7B 3X2QB 2Q7EA 2E74B 5B1NA 2OT5A 3SGIA 2YIBA 5JH7B 1VQ7V 1P84F 4JI7B 2E5LO 1Q86W 1SQGA 1YVWA 3OGIB 2PY5A 4DV7O 1SQFA 1CP9A 4MVSA 2ZIOA 3AG3B 4IT5A 2ZINA 4RUFA 3T1CA 4TT3G 3E2EA 1KB9F 3RT3C 1NT2B 3VQYA 4PD4F 3SJBC 1BGYH 5LA6B 4ASUG 4O2BB 2F93B 3STZC 1VQMV 2WLIB 3D36A 5KX5A 5LHGA 5JJEB 2KKWA 4H33A 2KSDA 3WG7C 5JCOA 3UO3A 4DR4B 2JS5A 1KP3A 3SYCA 2EIJB 2ZE7A 2IU3A 1XNRB 2XASA 1GMGA 4GUNA 2EIKB 4AQYB 2AZ2A 4I55B 4MTFA 3VBBA 1MSWD 3N2GB 5KHHA 4CH6A 1OCZB 1SA0A 4JI8O 4J80A 4NR1A 4FLZA 3RYCB 1OCOB 3ASNC 5L3CA 3KCXA 3K08A 4XDLA 1JJOA 4B3TO 4OPHA 4FM1A 3THOA 3P3NA 1H2SB 3G6EV 1K4CC 2B9ZA 1IBLO 2P5OA 2H8PC 1IURA 2CE4A 5A2QN 4LNUA 3RYHB 1XMOB 1NTZH 3K57A 1MOFA 3CRQA 2AW9A 4MVQA 5LGUA 2EZOA 1MNGA 2P7TC 2Q4PA 5B3SB 4X62B 2EIKC 4X1IB 1KD1W 4NTXA 1NZ6A 1ROPA 2DYSC 5BXZA 3CJHB 3QF7A 2YC0A 1HNXB 1VF6A 1P7BA 5H5NA 1L1FA 1WJZA 4K35A 4GCZA 5JVDB 2F4VB 2Y4TA 2F4VO 3K5MA 1IBMB 1XI1A 4DV7B 1QR8A 3K79A 3A0BZ 1QLEB 1X59A 2IH1C 1AROP 1XBLA 1DK1A 4OX9O 4GX5A 3RFRA 2QKSA 5EZYB 2FL4A 2UXCO 1AILA 4YHHB 3CRAA 2GTSA 4FMTA 4MTXA 4NYKA 4LH6A 2IW5A 4P9PA 5BR8B 3LDCA 2EX3A 4UV9A 4DW1A 3GWKC 3QG5A 5L3BA 4OXSA 1JX9A 1WN7A 4O2AB 2K9PA 2CH7A 5LXTB 1JVMA 2WWWA 4HNAA 1X4TA 1L8DA 5FNVA 3SYOA 1ORQC 1ENVA 4TV9B 1KMIZ 1HNWO 4FIPC 2UXDO 3CRMA 5IYDO 3CRCA 4FLVA 4KP4A 5EYPB 3CHXA 3ZHTA 2UXDB 3CCRV 2HG5C 3OE7G 1G8MA 3HKBA 4RQFA 5L3GA 3WU2Z 3AG4C 1OZ0A 1K5SA 2E3CA 3R65A 5IYCO 2ZXWB 3E89A 1NU1H 2YXHA 3J7AU 2LGQA 4IHJB 2E75B 1GM9A 4NVPA 1NH2D 2E5LB 4K0KO 5IYBO 3P3PA 3FYEB 4MT8A 4B3RO 4X20A 1YCIA 3U10A 2IJJA 4I50A 4QPJA 3JATA 3FX7A 3HKCA 1VMGA 2E76B 2D2CB 2QSAA 3B8MA 3CXHF 4FZ0A 4DV2B 1H5WA 4HBNA 3JALA 4UB8Z 3BAAA 1KECA 3DSQA 1R3LC 4JGSA 4GX2A 5CN0A 2LW7A 4GKKO 3ZHRA 3AG4B 2QGNA 4I4TA 4DV5B 3OTOO 1MG1A 3BABA 3E8BA 1GH6A 5LHHA 2AHYA 3I55V 4BWAA 2Q73A 4WFHA 5BY1A 2VQFB 3JAMN 3GB7C 5CA1B 3U0ZA 2YXYA 4MVOA 4WF9V 2B1IA 2WA4A 3B2EE 2ILMA 1JMKC 2GDSA 1DF4A 4LF5O 4R7CA 2A79B 1KUQA 1EN4A 1SQVH 3WB0A 4AQYO 1K97A 4BAYA 2BSKA 2YS8A 1K5QA 1DF5A 4L87A 5IT9N 3P32A 4LF5B 5IJ0A 2KG7B 1N8RW 4Z2WA 4HAMA 3CMAV 2AXTZ 2BOCC 3OR7C 4TUYB 4LBEC 1XOUA
chains in the Genus database with same CATH topology
2QKCA 3AK1A 1WB7A 3QVNA 4F6EA 1GN3A 2CE4A 1AP6A 1PL4A 2CDYA 3AK2A 1VARA 1N0JA 1I08A 3DC6A 2AW9A 1MNGA 1GN4A 1ZLZA 3BFRA 3K9SA 1MSDA 1BSMA 3AK3A 1MA1A 3CEIA 4JZ2A 1QNMA 1JR9A 1Y67A 1KKCA 4JYYA 1EN5A 1XUQA 3DC5A 1BS3A 1IXBA 1IDSA 4E4EA 1N0NA 1I0HA 1ZUQA 5A9GA 3RN4A 1JA8A 3OT7A 4X9QA 1D5NA 1AP5A 1XDCA 1P7GA 1AVMA 1IX9A 2RCVA 3C3TA 5AG2A 1EN6A 4BR6A 3KKYA 4YIOA 3LSUA 2ADQB 3IC9A 3EVKA 1ZSPA 4FFKA 1XILA 1LUWA 1PM9A 4GUNA 1LUVA 2QKAA 1AR5A 4JZGA 2GDSA 1VEWA 1B06A 1BT8A 3TJTA 1EN4A 4YIPA 3C3SA 2ADPA 1SZXA 1MMMA 1ZTEA 3MDSA 1GN6A 4C7UA 3KDRA 1GN2A 1AR4A 2P4KA 1EM1A 1WB8A 1XREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKC A;  3AK1 A;  1WB7 A;  3QVN A;  4F6E A;  1GN3 A;  2CE4 A;  1AP6 A;  1PL4 A;  2CDY A;  3AK2 A;  1VAR A;  1N0J A;  1I08 A;  3DC6 A;  2AW9 A;  1MNG A;  1GN4 A;  1ZLZ A;  3BFR A;  3K9S A;  1MSD A;  1BSM A;  3AK3 A;  1MA1 A;  3CEI A;  4JZ2 A;  1QNM A;  1JR9 A;  1Y67 A;  1KKC A;  4JYY A;  1EN5 A;  1XUQ A;  3DC5 A;  1BS3 A;  1IXB A;  1IDS A;  4E4E A;  1N0N A;  1I0H A;  1ZUQ A;  5A9G A;  3RN4 A;  1JA8 A;  3OT7 A;  4X9Q A;  1D5N A;  1AP5 A;  1XDC A;  1P7G A;  1AVM A;  1IX9 A;  2RCV A;  3C3T A;  5AG2 A;  1EN6 A;  4BR6 A;  3KKY A;  4YIO A;  3LSU A;  2ADQ B;  3IC9 A;  3EVK A;  1ZSP A;  4FFK A;  1XIL A;  1LUW A;  1PM9 A;  4GUN A;  1LUV A;  2QKA A;  1AR5 A;  4JZG A;  2GDS A;  1VEW A;  1B06 A;  1BT8 A;  3TJT A;  1EN4 A;  4YIP A;  3C3S A;  2ADP A;  1SZX A;  1MMM A;  1ZTE A;  3MDS A;  1GN6 A;  4C7U A;  1GN2 A;  1AR4 A;  2P4K A;  1EM1 A;  1WB8 A;  1XRE A; 
#chains in the Genus database with same CATH topology
 1PNL A;  3L74 H;  2ZR3 A;  1EBO A;  2ZDI A;  1RM1 C;  5LOV A;  4DR4 O;  1ZL8 A;  4YHH O;  3RVY A;  2RNB A;  3QNE A;  1H2N A;  5TIS Z;  1RSO B;  2Y0I A;  2WLI A;  3GVM A;  3JAR A;  1I94 O;  4U7O A;  1V55 B;  2YIA A;  1K9M W;  2XAQ A;  4KFM A;  2CTQ A;  4J9Z B;  2UUC O;  3SR2 C;  2Q7H A;  4EB6 A;  3G71 V;  4FJC C;  3W7S A;  3SJC C;  2A7W A;  2B5U A;  4I9W A;  2LW1 A;  3E8H A;  1QR9 A;  4E4E A;  5LYJ B;  5BMV A;  2EJ7 A;  4I55 A;  4BW5 A;  3OT7 A;  2V4D A;  4X89 A;  4CC5 A;  1AB3 A;  4X66 O;  4FZ1 A;  2YEV A;  4IYI A;  3JYC A;  1JNB A;  2R9A A;  5LMN B;  2XHB A;  1Y76 B;  1TGO A;  1AVM A;  4P2Z A;  3C3T A;  4PV1 B;  1V55 C;  3B8N A;  3FAV B;  1W59 A;  2HJD A;  2LFR A;  2JJ2 G;  2RDC A;  5KAF Z;  1Q82 W;  3BVO A;  1JQ0 A;  5C8Y B;  3ETQ A;  2V1D A;  4UUJ C;  3P30 A;  4JZG A;  1YZB A;  5B1B C;  1XMQ B;  5J2T B;  5IDJ A;  3DXR A;  2PI4 A;  3FYI B;  3T1H O;  1VQ9 V;  3CE2 A;  2WLN A;  2ZM6 O;  3ZX6 A;  1K92 A;  2EIN B;  1IBK B;  1IBK O;  3N2K A;  1YSC A;  3MDS A;  1ZAU A;  4DV6 O;  2LO1 A;  2XOK G;  2A9H A;  4JI0 B;  3S3W A;  3JD1 A;  3ZN1 A;  1FXH A;  1ZWI C;  2B1G A;  1V54 C;  4LFC O;  3SDL A;  3AG3 C;  1NBM G;  4EEQ A;  2Q0O C;  5CA1 A;  2VQE B;  2ZR2 A;  1Z2G A;  1TUE B;  1A32 A;  5KUK A;  2Q5Z A;  1TUB A;  3EFF K;  5B1B B;  2QE7 G;  2XT9 A;  3AK3 A;  3E22 A;  2Q9L A;  1XNQ B;  4UVC A;  1M4U A;  2A3Q A;  1WLE A;  3E35 A;  1H38 A;  1JR9 A;  1Y67 A;  1PPJ H;  3ABL C;  3AG2 C;  1Y6X A;  2UXX A;  5EC2 C;  1BS3 A;  3RGB A;  5KHG A;  4TUY A;  1MZE A;  3KCY A;  4K3A A;  1ZUQ A;  2YDE A;  2H94 A;  2KB1 A;  1BQZ A;  1SKV A;  5EIB C;  1QBZ A;  5DN6 G;  4JI2 B;  2PYJ A;  5LOV B;  3JAS B;  4H37 A;  1AP5 A;  5DED A;  3CXC U;  1HR0 B;  1TVK A;  1VF5 B;  4O4I A;  3IAY A;  1PKX A;  1FKA O;  1H8E G;  4TSF G;  4YIO A;  5E1A C;  5IY5 B;  5LGT A;  1G1X B;  1F4M A;  5IJ9 A;  2NR5 A;  4Z1M G;  4EB6 B;  3H9V A;  2W6I G;  2V7Q G;  3SPI A;  3BPZ A;  2R9R B;  4A5U B;  4WBN B;  2DWD C;  1M57 B;  1CEZ A;  1Q81 W;  3CD6 V;  3W7U A;  2PTM A;  1YXB A;  2ZDI C;  4QNH B;  4DV3 O;  4LF8 O;  2PGG A;  4YY3 O;  3CCE V;  3ASO B;  1XMO O;  3MHS C;  3TGU H;  4X20 B;  2QWP B;  4EFB A;  4TWK A;  4LF6 B;  4YJ3 B;  1U96 A;  5CA0 B;  3F5T A;  1AR4 A;  4JTC B;  2P4K A;  2UUA B;  3FAV A;  3OMI B;  4BIU A;  4EFE A;  1P4R A;  4W4L A;  4J7J A;  4OX9 B;  3K3W A;  2VQF O;  3AK2 A;  2BTO A;  3H1I H;  1FFX B;  1XEQ A;  3LUT B;  2DN9 A;  3ABL B;  4PDR A;  5IYZ B;  5H2F Z;  3K0D A;  3UM7 A;  4DUY O;  1GN4 A;  3LNN A;  1ZLZ A;  2ITD C;  5EIB D;  1MSD A;  3T1Y B;  3CPW U;  1MA1 A;  2P6J A;  1NVP B;  4MS2 A;  4JI1 O;  2DMX A;  3N2K B;  4ZHQ A;  4DUY B;  4DUZ O;  5BR8 O;  3ASO C;  4DR6 B;  3ICX A;  3BA8 A;  4K8Z A;  4QGP A;  3UQ8 A;  3W7W A;  1Y66 A;  1VQ8 V;  5FPR A;  1JA8 A;  4GLX A;  3QTC A;  3CS5 A;  4B3M O;  4DK1 A;  4JI7 O;  3A0R A;  3CCU V;  2EIL B;  4B3M B;  3MD0 A;  5AG2 A;  3ZS8 C;  4DXW A;  1YTF D;  5B3S C;  1FXV A;  5E79 Z;  5K1X A;  1IZ3 A;  2GHY A;  2DYS B;  2M7W A;  3ABK C;  1K73 W;  2HR3 A;  1FD9 A;  3E86 A;  3OM3 B;  1ZL8 B;  2X0L A;  4IYH A;  4FM2 A;  4H13 B;  2QKA A;  4Q6G A;  4UCS A;  4JTA B;  2EBO A;  1B06 A;  4YXW G;  4F4L A;  1S5L Z;  3PN1 A;  5LA6 A;  2IBZ H;  1ZTE A;  2JIZ G;  2XUM A;  1GN6 A;  2UXN A;  1PD3 A;  3OMN B;  1COW G;  1NTM H;  3D3I A;  1KC8 W;  2Z5U A;  3E83 A;  1XMQ O;  3H01 A;  1KYO F;  5BMV B;  1KKD A;  4X66 B;  2D3O W;  4F6E A;  4YJ2 B;  3ML0 A;  4FLY A;  1I08 A;  3DC6 A;  3CC4 V;  2LGW A;  2G38 A;  2EJR A;  3T4D A;  3FB5 C;  4CH5 A;  1I7F A;  4DV1 B;  3D3Q A;  3O9O A;  4LFA B;  1EN5 A;  4WFB V;  3CCS V;  1IBL B;  3RW0 A;  5A9G A;  1S0V A;  4PA3 A;  2Q67 A;  2QEX V;  4GYC B;  2NNU A;  4LFB B;  4UCV A;  1D5N A;  3RYH A;  1Q6I A;  4JI0 O;  1YTF B;  1QVF U;  4JI2 O;  1HWY A;  1V9P A;  2F43 G;  5KLV H;  4JYA O;  1NI8 A;  3LSU A;  3JSN A;  1S76 D;  1R6T A;  2QR4 A;  4UCT A;  1RM1 B;  2QJ1 A;  3SJQ C;  4X1K A;  2HHH O;  4DR3 O;  5JVD A;  2N74 A;  3JAK B;  4GX0 A;  1HP8 A;  2Z0A A;  4J9Y B;  4O4H A;  2O57 A;  2Q7G A;  2PF4 E;  3R66 A;  3ZED A;  1G4Y B;  2LFS A;  1GAX A;  3FD9 A;  1M1K W;  1NH2 B;  2F23 A;  3AG1 C;  2WLM A;  5KHK A;  1H2K A;  5GON A;  3ETE A;  2BOB C;  3ZRS A;  4Z1V A;  3ZRW A;  1US6 A;  4JI8 B;  2VWJ A;  1XRE A;  2RJZ A;  3ZIA G;  4AI8 A;  1JJ2 U;  2F1M A;  1WA8 B;  4O2A A;  4ZBM A;  3B09 A;  1SES A;  1AP6 A;  3CRR A;  2CDY A;  4NXM O;  5LXT A;  4LF9 O;  3QO8 A;  1B3Q A;  1XL6 A;  3RYI A;  2GV9 A;  1D5A A;  3BFR A;  3OTO B;  1W2B U;  4TV9 A;  2Q0A A;  1R1B A;  1TAE A;  2R72 A;  1BZK A;  2BE3 A;  1GTO A;  4N23 A;  3TXQ A;  2HVJ C;  1R73 A;  4JZ2 A;  4FLT A;  1FAF A;  3O65 A;  3S3X A;  4JPR A;  3BRC A;  2ZIM A;  5EYP A;  4KHP B;  1IJG A;  4ZKI A;  4I0X B;  3B4S A;  2ETN A;  1VQ6 V;  4WBN A;  3I5D A;  1CXZ B;  3L72 H;  3QO7 A;  4RAI A;  1BMF G;  1FXK A;  3JD3 A;  3ETD A;  3LNM B;  4DV6 B;  3CP1 A;  1J5E O;  2EZP A;  2CTP A;  4LWS B;  3RYF A;  4GT1 A;  4BR6 A;  1Q6H A;  2AZ0 A;  5IWA O;  1ZSP A;  4G27 B;  3IJ4 A;  2UU9 O;  2PI5 A;  2VQE O;  2LQT A;  3RWR D;  4LFC B;  5EBL C;  1FFX A;  3W7X A;  5H6Q A;  1M90 W;  1B6Q A;  5CBH A;  4R8C A;  3HKC B;  2HJF C;  5L3D A;  2WLL B;  3C3S A;  1PNK A;  3SYQ A;  2BCC H;  2CK3 G;  2GBO A;  3FB6 C;  4CS2 A;  2ARH A;  4J41 A;  4JI4 B;  4ABM A;  1EM1 A;  1YJN V;  3K04 A;  1AI7 A;  2AHZ A;  3STL C;  2HFE C;  4DR2 O;  1M5I A;  1VQK V;  1SF9 A;  2DQ3 A;  1F7Y A;  3K5N A;  1WP8 A;  4DR7 B;  3E8F A;  3WG7 B;  1YDX A;  1VF7 A;  4JV5 B;  1RPR A;  5IY5 C;  2PYL A;  1S5H C;  5KA6 A;  5KMG B;  4CC6 A;  5HFM A;  4NXN O;  3A2F A;  1R3I C;  4PA6 A;  2KG7 A;  4ICG A;  1VQL V;  1SQX H;  3CC2 V;  2BTQ A;  3DC5 A;  1LNQ A;  1W0K G;  5GON B;  1JPX A;  1M57 C;  2LJ2 A;  3JAW B;  1QVG U;  5FNV B;  2Z3Y A;  3CX5 F;  2ZE5 A;  1EFR G;  2Y48 A;  2M6Y A;  2OTJ V;  3K03 A;  3SPC A;  4TV8 A;  3RYI B;  2XAG A;  2MK3 A;  3H1H H;  4LFB O;  4DYL A;  1XDC A;  3F7V C;  4MVU A;  4TQD A;  3F5W C;  3ETG A;  4PDM A;  2QM7 A;  4DV4 O;  1SC5 B;  2CAZ C;  4DR1 B;  2FB5 A;  4DR5 B;  1YIJ V;  3H1J H;  4FFK A;  5B1A C;  3JD2 A;  1XIL A;  2GSM B;  4RUE A;  1PM9 A;  1UFI A;  5LYJ A;  3T1Y O;  4I0X A;  3UCS C;  1TA8 A;  4XDJ A;  2WAM A;  3ZN0 A;  2CGO A;  4JTD B;  1F4N A;  1SQQ H;  4KUM A;  3SYP A;  3G6B A;  5IE9 A;  3KDR A;  1GN2 A;  1N33 O;  1Y76 A;  2QWO B;  1VQO V;  1Q5O A;  2WLJ A;  3OMA B;  3JAT B;  4CH3 A;  1FS0 G;  1UPG A;  2IJH A;  2W6J G;  1BCC H;  1N34 B;  2UUB B;  3HKD A;  3LDE A;  2YIC A;  4UXN A;  2X6B A;  3K58 A;  1YI2 V;  3WB1 A;  2DOS A;  1O9H A;  1PP9 H;  4X1Y B;  2QWN B;  2CGN A;  3DXR B;  2QM4 A;  2WLL A;  1SQB H;  4F6R B;  4CBC A;  1XHX A;  1NR1 A;  2ATK C;  3Q4H B;  3L75 H;  2KQX A;  4X1K B;  1FXK C;  1FFT B;  2CUG A;  4QIW F;  3OFN G;  2LP7 A;  3JAK A;  2DWE C;  3BHP A;  4B3R B;  3U11 A;  4O4H B;  2IM9 A;  2RMK B;  1W0J G;  4NKG B;  3RN4 A;  1SRY A;  4X64 B;  2FTK A;  5J2U A;  3K5L A;  4FLX A;  1VQP V;  1F23 A;  4B3S B;  5DM6 V;  1H8H G;  1AI4 A;  1QU7 A;  3UKM A;  1BE3 H;  2FML A;  3APQ A;  2EIJ C;  2MW2 B;  4PA9 A;  3ZCC A;  4FFB B;  1GKF A;  4NXM B;  3G80 A;  2OWO A;  3IC7 A;  2DYR C;  2ZCE A;  5FLX N;  3E22 B;  1SER A;  3LDD A;  1VP7 A;  4JYC A;  4PA4 A;  2YUA A;  1NKD A;  1WA8 A;  2UUA O;  3UT5 B;  3TXS A;  2EIM B;  2ZQM A;  2P06 A;  1U97 A;  1OCO C;  3ASN B;  1FJG O;  2ZXW C;  4CS3 A;  3KG2 A;  2N05 A;  1BHB A;  2W0F C;  3JAW A;  3OD4 A;  3RBZ A;  3JAR B;  2JDI G;  1BHA A;  2OIG A;  2XAJ A;  4FPP A;  2JGD A;  3CCJ V;  1RP3 B;  1H2G A;  2N04 A;  2ZM6 B;  3CCV V;  4NB5 A;  1TVK B;  4DW0 A;  5LP6 B;  1YHQ V;  3K5O A;  3MHH C;  2QKC A;  3QVN A;  4MW3 A;  4ZOL B;  1H2L A;  4WFE A;  2RN9 A;  4R50 A;  2UU9 B;  4DR1 O;  2EIM C;  5CB4 B;  3IFX A;  2K1E A;  3HB3 B;  4MSW C;  3K06 A;  1HNX O;  4LWS A;  1JFF A;  4U7N A;  4DV2 O;  4QE9 A;  2ZE8 A;  3ZHQ A;  5EK0 A;  3BCC H;  3CEI A;  1IBM O;  2JRI A;  3FB7 C;  5B1O A;  5GW7 A;  4R6Z A;  4IL6 Z;  2ZNI A;  5CMU A;  2EIL C;  1GK9 A;  5C8Y A;  3SJA C;  5KAI Z;  5D5Q A;  4U3J B;  1NTK H;  4K8X A;  1K34 A;  5LL6 Y;  4DR2 B;  4B08 A;  2P22 C;  3AG1 B;  4X64 O;  4MW8 A;  3SPJ A;  1E1Q G;  1N33 B;  1XNQ O;  4I5S A;  4UV8 A;  4MTG A;  1IX9 A;  2A06 H;  1E79 G;  1EN6 A;  2PUS A;  4DUZ B;  4BIZ A;  3IC9 A;  3EVK A;  1Q43 A;  3JCZ A;  4ZHQ B;  4X8A A;  3F7Y C;  1GO3 F;  3UO2 A;  5KUM A;  4TOI A;  3K0G A;  3CB2 A;  4ZI7 A;  1NJI W;  2Y0P A;  3JCU Z;  1QHT A;  3VOU A;  4LF4 B;  4B7K A;  5J2U B;  4DO2 A;  5EZY A;  4DK0 A;  3JD0 A;  1BQ0 A;  2WA3 A;  3A8T A;  4FK5 C;  4DRX B;  2BTQ B;  3TK1 A;  3AG7 A;  1K33 A;  1DTO A;  1QQC A;  3EXA A;  4YY3 B;  5DEC A;  2F95 B;  3AK1 A;  4KL1 A;  3UT5 A;  1E1R G;  2CH7 B;  1PL4 A;  3OEH G;  2Q69 A;  4JYA B;  5L3F A;  4BW9 A;  4HYO A;  4O2B A;  5CBF A;  1N0J A;  4TV8 B;  2NN4 A;  5KX5 B;  1OHH G;  4HNA B;  4UB6 Z;  1QCE A;  3VQX A;  1RPO A;  4FVM A;  3B77 A;  3C90 A;  1XQ8 A;  4O4L A;  4FLU A;  3OEE G;  5IJ9 B;  2ZD9 A;  2HKO A;  2YIB D;  4UVA A;  2HP8 A;  3CCQ V;  1N36 O;  1N36 B;  5LP6 A;  5ITZ A;  4UFZ A;  2GUZ B;  5CBG A;  1N0N A;  4LF7 O;  3AEI A;  2OCC B;  4P30 A;  4ZOL A;  4UCO A;  4X9Q A;  4JI5 B;  3N2G A;  3G67 A;  4YJ2 A;  2X6A A;  2R9I A;  2JGU A;  1OCC C;  3AG2 B;  1L0N H;  1S72 V;  1XHZ A;  3KZI Z;  1PV0 A;  3TCU A;  4O4J B;  2Y69 B;  4RWU A;  3CWB H;  1R3K C;  4AHC A;  4I7Z B;  4B3T B;  4W4K A;  4NTY A;  3VQW A;  4LNU B;  1M56 C;  2IJK A;  4I50 B;  4JI4 O;  2ZE6 A;  1K4D C;  1VEW A;  1PNM A;  4LF9 B;  2JEX A;  5H6R A;  5B66 Z;  4DR3 B;  4F6R A;  3VQV A;  4IIJ A;  5JJN B;  3M99 B;  4LF4 O;  3ZHU A;  1P49 A;  5EC1 C;  2Y4U A;  4PHZ A;  1Q90 D;  3RVZ A;  2W0X A;  4JYB A;  1WNS A;  3J80 N;  3CSX A;  1GM7 A;  2HHH B;  1WPB A;  2Q68 A;  1WB8 A;  3HR0 A;  4GX1 A;  1WB7 A;  3ZHS A;  4JI6 O;  4KHP O;  2EUL A;  1AI6 A;  1GN3 A;  1OCZ C;  4KXR A;  1HR0 O;  3BY6 A;  3ZMU A;  4ZI7 B;  2JJ1 G;  1ZX3 A;  1QLN A;  3HKE A;  1BSM A;  2YI9 A;  4L8J A;  3QO5 A;  1EZV H;  2BSK B;  3L71 H;  5IWA B;  4K0K B;  5L3E A;  5IJ0 B;  1QNM A;  1AJQ A;  5F2V O;  2JEU A;  4DRX A;  3J81 N;  1MAB G;  2H3O A;  3ZRW B;  2Y69 C;  1Y4M A;  4D7T A;  3T4Z A;  1D2D A;  1VQN V;  3ABM B;  4D7S A;  3ZHV A;  3H1L H;  3JSL A;  4H0L B;  4DV1 O;  1S3J A;  2QTO A;  1VQ5 V;  2PZS A;  3ABT A;  4PI0 A;  2UXB O;  3EHB B;  1SET A;  1Q6U A;  3ZMT A;  1WPX A;  2RCV A;  2L6L A;  1R6K A;  4LFA O;  2QDO A;  2HVK C;  5JQG A;  3M7M X;  4PDV A;  1UJW B;  4DV3 B;  1KP2 A;  4H44 B;  3HKB B;  1BL8 A;  2XAH A;  1YJW V;  1JOY A;  3PJS K;  5H9C A;  1AI5 A;  5ITZ B;  2ZKO A;  1LUW A;  2YSU B;  5CB4 A;  1YF2 A;  4JI3 O;  4E2L A;  5B5E Z;  1V54 B;  4X65 B;  3BEH A;  1S5J A;  3D8C A;  1AJP A;  3L70 H;  2QM8 A;  1BT8 A;  5LMU O;  3SYA A;  4DV0 O;  4IHJ A;  4GKJ B;  3ABM C;  4D6T H;  1FXK B;  2YEV B;  5J9P C;  5LMU B;  3BA9 A;  1KBH A;  4PI2 A;  4C7U A;  4WFF A;  1I5X A;  1Q7Y W;  4O4J A;  2IU0 A;  1FYJ A;  3NR7 A;  3RYF B;  1QLE C;  4U3F H;  2QA4 V;  2ODM A;  1DLB A;  2DJV A;  4U3J A;  1OCR C;  3MAQ A;  4LCU C;  2CTW A;  3ZMS A;  4J11 A;  3LSS A;  1FOU A;  2WSS G;  3JD4 A;  4WFG A;  5LP6 C;  4QJF B;  2DYR B;  5J2T A;  4HZ3 A;  1YJ9 V;  2Q8V A;  4J42 A;  3CME V;  1Y74 B;  5BZB A;  3LSQ A;  1NVP D;  3ABK B;  1L0L H;  2ZNJ A;  4CH4 A;  3DTU B;  3W7T A;  2RQ6 A;  4CZZ A;  1URF A;  4I9Q A;  2VWK A;  4EKW A;  1IXB A;  1IDS A;  1WP7 A;  3DGE A;  2DQ0 A;  5JJJ B;  4RO2 A;  4NXN B;  1GM8 A;  4PDL A;  2P67 A;  2X6C A;  4JAV A;  2A0L A;  5B1A B;  5FPO A;  4JI1 B;  3K9A A;  4UVB A;  1J95 A;  4QE7 A;  5JH7 A;  1NR7 A;  3CCL V;  2DW4 A;  3ABU A;  2IH3 C;  4MVM A;  4DR6 O;  4UCR A;  3HKE B;  1NQT A;  3B40 A;  1Q8I A;  5CA3 A;  1HNZ B;  4Q20 A;  2ZT9 B;  4PEL A;  4DV0 B;  4LP8 A;  1IXM A;  2NLJ C;  3OTF A;  5C93 A;  1SQP H;  1AR5 A;  1RSO A;  1HNZ O;  4DR5 O;  4GZR B;  2Q6A A;  1K3E A;  1Z5V A;  4YIP A;  3OUS A;  1OCR B;  4BIO A;  4J7Z A;  2OYQ A;  2X7R B;  2ADP A;  4XBF A;  1I5Y A;  1SZX A;  1MMM A;  4O4L B;  3FFQ A;  4GKJ O;  2UXB B;  4G2K A;  4X88 A;  1S77 D;  5LGN A;  1JCH A;  2XAF A;  5KA5 A;  2QTS A;  3GWO A;  4O4I B;  4B3S O;  4QPK A;  4RQE A;  3WB2 A;  3K59 A;  4OGQ B;  1R6N A;  1Z5W A;  2GUZ A;  2OIE A;  5EBM C;  3A0H Z;  3OUF A;  5KHJ A;  1VAR A;  2HLD G;  5K1P A;  4X65 O;  1YEW A;  2GTA A;  3APO A;  4IGG A;  1HW7 A;  4JAU A;  4LC1 A;  3K9S A;  1YIT V;  3FB8 C;  4JI3 B;  4JF3 A;  3I56 V;  1XNR O;  5GTI Z;  3T2M A;  3OR6 C;  1KQS U;  1KKC A;  4YJ3 A;  4JYY A;  1F51 A;  3OGC C;  5CA0 A;  3TET A;  3E8G A;  5JWP A;  1N34 O;  2UUB O;  2P4V A;  2QWQ B;  4IIJ B;  1Q3E A;  3HKD B;  4JV5 O;  1K7D A;  1EZJ A;  2JVD A;  1AJN A;  1SS3 A;  4X1I A;  3SPG A;  4PA7 A;  1SZT A;  3CJH A;  3KKY A;  2JK5 C;  1G6U A;  4P9O A;  2JS3 A;  1R3J C;  1THZ A;  1HDJ A;  1FPO A;  1H2M A;  1LR1 A;  3IGA C;  3T1H B;  4JAS A;  4B7E A;  2DE0 X;  1DGS A;  3D36 C;  1N4C A;  2VRZ A;  3NXS A;  1AR1 B;  1KU9 A;  2AGA A;  1T5E A;  1MZF A;  5EBW C;  1TUB B;  3TJT A;  4DV4 B;  4UCU A;  4LF6 O;  4MVZ A;  5JCO C;  3L73 H;  4N21 A;  5KMG A;  1K8A W;  3ZMV A;  5KHI A;  5LMN O;  4FFB A;  1B04 A;  5HFL A;  5LBQ A;  4DV5 O;  2CTR A;  2WLK A;  1J5E B;  2F66 C;  4GKK B;  2OCC C;  3CC7 V;  4NTW A;  1N32 O;  5D5P A;  1M9N A;  2YID A;  2OCH A;  4TQF A;  4LH7 A;  3JAS A;  1IVS A;  4ZIB A;  4OPA A;  2ITC C;  2UXC B;  3ZRV A;  4PJ0 Z;  3H1K H;  4FM0 A;  3OW2 U;  4MTO A;  3M8A A;  5GTH Z;  2IJI A;  2WLH A;  3SPH A;  4JAA A;  1XL4 A;  5JQG B;  1I94 B;  2XND G;  4LR3 A;  4MVR A;  2FKX A;  4WFA V;  1M56 B;  2JGD B;  4JI5 O;  2HEP A;  3N27 A;  4WCE V;  1GRJ A;  2WPD G;  1XUQ A;  2R70 A;  3ZBH A;  1I0H A;  2L35 A;  3HPL C;  3CYO A;  2EIN C;  3CCM V;  1VF6 C;  2P90 A;  1NS1 A;  4J7K A;  1WAZ A;  2YI8 A;  1M93 A;  1SA0 B;  1RFY A;  1P7G A;  3RYC A;  3WFV A;  1JFF B;  3X2Q C;  4X62 O;  4JI6 B;  1OJH A;  2ADQ B;  5FL7 G;  1HNW B;  4G28 B;  2OTL V;  2QWR B;  2UUC B;  1PL0 A;  5IYZ A;  4DR7 O;  1LUV A;  4LF8 B;  4X1Y A;  2YXL A;  3OAA G;  2FYU H;  4AIL C;  4CS4 A;  1O9G A;  1Y74 A;  1OV9 A;  1VQ4 V;  3JAL B;  2C2A A;  4FLW A;  3Q4H A;  3ZJZ A;  3L9D A;  1N32 B;  3FKS G;  3ZMZ A;  2XTA A;  1FJG B;  4XDK A;  1OCC B;  4I4T B;  4J10 A;  2VS0 A;  5LHI A;  1VIB A;  1CPY A;  3ZRX A;  3G4S V;  4LF7 B;  3X2Q B;  2Q7E A;  2E74 B;  5B1N A;  2OT5 A;  3SGI A;  2YIB A;  5JH7 B;  1VQ7 V;  1P84 F;  4JI7 B;  2E5L O;  1Q86 W;  1SQG A;  1YVW A;  3OGI B;  2PY5 A;  4DV7 O;  1SQF A;  1CP9 A;  4MVS A;  2ZIO A;  3AG3 B;  4IT5 A;  2ZIN A;  4RUF A;  3T1C A;  4TT3 G;  3E2E A;  1KB9 F;  3RT3 C;  1NT2 B;  3VQY A;  4PD4 F;  3SJB C;  1BGY H;  5LA6 B;  4ASU G;  4O2B B;  2F93 B;  3STZ C;  1VQM V;  2WLI B;  3D36 A;  5KX5 A;  5LHG A;  5JJE B;  2KKW A;  4H33 A;  2KSD A;  3WG7 C;  5JCO A;  3UO3 A;  4DR4 B;  2JS5 A;  1KP3 A;  3SYC A;  2EIJ B;  2ZE7 A;  2IU3 A;  1XNR B;  2XAS A;  1GMG A;  4GUN A;  2EIK B;  4AQY B;  2AZ2 A;  4I55 B;  4MTF A;  3VBB A;  1MSW D;  3N2G B;  5KHH A;  4CH6 A;  1OCZ B;  1SA0 A;  4JI8 O;  4J80 A;  4NR1 A;  4FLZ A;  3RYC B;  1OCO B;  3ASN C;  5L3C A;  3KCX A;  3K08 A;  4XDL A;  1JJO A;  4B3T O;  4OPH A;  4FM1 A;  3THO A;  3P3N A;  1H2S B;  3G6E V;  1K4C C;  2B9Z A;  1IBL O;  2P5O A;  2H8P C;  1IUR A;  2CE4 A;  5A2Q N;  4LNU A;  3RYH B;  1XMO B;  1NTZ H;  3K57 A;  1MOF A;  3CRQ A;  2AW9 A;  4MVQ A;  5LGU A;  2EZO A;  1MNG A;  2P7T C;  2Q4P A;  5B3S B;  4X62 B;  2EIK C;  4X1I B;  1KD1 W;  4NTX A;  1NZ6 A;  1ROP A;  2DYS C;  5BXZ A;  3CJH B;  3QF7 A;  2YC0 A;  1HNX B;  1VF6 A;  1P7B A;  5H5N A;  1L1F A;  1WJZ A;  4K35 A;  4GCZ A;  5JVD B;  2F4V B;  2Y4T A;  2F4V O;  3K5M A;  1IBM B;  1XI1 A;  4DV7 B;  1QR8 A;  3K79 A;  3A0B Z;  1QLE B;  1X59 A;  2IH1 C;  1ARO P;  1XBL A;  1DK1 A;  4OX9 O;  4GX5 A;  3RFR A;  2QKS A;  5EZY B;  2FL4 A;  2UXC O;  1AIL A;  4YHH B;  3CRA A;  2GTS A;  4FMT A;  4MTX A;  4NYK A;  4LH6 A;  2IW5 A;  4P9P A;  5BR8 B;  3LDC A;  2EX3 A;  4UV9 A;  4DW1 A;  3GWK C;  3QG5 A;  5L3B A;  4OXS A;  1JX9 A;  1WN7 A;  4O2A B;  2K9P A;  2CH7 A;  5LXT B;  1JVM A;  2WWW A;  4HNA A;  1X4T A;  1L8D A;  5FNV A;  3SYO A;  1ORQ C;  1ENV A;  4TV9 B;  1KMI Z;  1HNW O;  4FIP C;  2UXD O;  3CRM A;  5IYD O;  3CRC A;  4FLV A;  4KP4 A;  5EYP B;  3CHX A;  3ZHT A;  2UXD B;  3CCR V;  2HG5 C;  3OE7 G;  1G8M A;  3HKB A;  4RQF A;  5L3G A;  3WU2 Z;  3AG4 C;  1OZ0 A;  1K5S A;  2E3C A;  3R65 A;  5IYC O;  2ZXW B;  3E89 A;  1NU1 H;  2YXH A;  3J7A U;  2LGQ A;  4IHJ B;  2E75 B;  1GM9 A;  4NVP A;  1NH2 D;  2E5L B;  4K0K O;  5IYB O;  3P3P A;  3FYE B;  4MT8 A;  4B3R O;  4X20 A;  1YCI A;  3U10 A;  2IJJ A;  4I50 A;  4QPJ A;  3JAT A;  3FX7 A;  3HKC A;  1VMG A;  2E76 B;  2D2C B;  2QSA A;  3B8M A;  3CXH F;  4FZ0 A;  4DV2 B;  1H5W A;  4HBN A;  3JAL A;  4UB8 Z;  3BAA A;  1KEC A;  3DSQ A;  1R3L C;  4JGS A;  4GX2 A;  5CN0 A;  2LW7 A;  4GKK O;  3ZHR A;  3AG4 B;  2QGN A;  4I4T A;  4DV5 B;  3OTO O;  1MG1 A;  3BAB A;  3E8B A;  1GH6 A;  5LHH A;  2AHY A;  3I55 V;  4BWA A;  2Q73 A;  4WFH A;  5BY1 A;  2VQF B;  3JAM N;  3GB7 C;  5CA1 B;  3U0Z A;  2YXY A;  4MVO A;  4WF9 V;  2B1I A;  2WA4 A;  3B2E E;  2ILM A;  1JMK C;  2GDS A;  1DF4 A;  4LF5 O;  4R7C A;  2A79 B;  1KUQ A;  1EN4 A;  1SQV H;  3WB0 A;  4AQY O;  1K97 A;  4BAY A;  2BSK A;  2YS8 A;  1K5Q A;  1DF5 A;  4L87 A;  5IT9 N;  3P32 A;  4LF5 B;  5IJ0 A;  2KG7 B;  1N8R W;  4Z2W A;  4HAM A;  3CMA V;  2AXT Z;  2BOC C;  3OR7 C;  4TUY B;  4LBE C;  1XOU A; 
#chains in the Genus database with same CATH homology
 2QKC A;  3AK1 A;  1WB7 A;  3QVN A;  4F6E A;  1GN3 A;  2CE4 A;  1AP6 A;  1PL4 A;  2CDY A;  3AK2 A;  1VAR A;  1N0J A;  1I08 A;  3DC6 A;  2AW9 A;  1MNG A;  1GN4 A;  1ZLZ A;  3BFR A;  3K9S A;  1MSD A;  1BSM A;  3AK3 A;  1MA1 A;  3CEI A;  4JZ2 A;  1QNM A;  1JR9 A;  1Y67 A;  1KKC A;  4JYY A;  1EN5 A;  1XUQ A;  3DC5 A;  1BS3 A;  1IXB A;  1IDS A;  4E4E A;  1N0N A;  1I0H A;  1ZUQ A;  5A9G A;  3RN4 A;  1JA8 A;  3OT7 A;  4X9Q A;  1D5N A;  1AP5 A;  1XDC A;  1P7G A;  1AVM A;  1IX9 A;  2RCV A;  3C3T A;  5AG2 A;  1EN6 A;  4BR6 A;  3KKY A;  4YIO A;  3LSU A;  2ADQ B;  3IC9 A;  3EVK A;  1ZSP A;  4FFK A;  1XIL A;  1LUW A;  1PM9 A;  4GUN A;  1LUV A;  2QKA A;  1AR5 A;  4JZG A;  2GDS A;  1VEW A;  1B06 A;  1BT8 A;  3TJT A;  1EN4 A;  4YIP A;  3C3S A;  2ADP A;  1SZX A;  1MMM A;  1ZTE A;  3MDS A;  1GN6 A;  4C7U A;  3KDR A;  1GN2 A;  1AR4 A;  2P4K A;  1EM1 A;  1WB8 A;  1XRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...