3CEIA

Crystal structure of superoxide dismutase from helicobacter pylori
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
213
structure length
213
Chain Sequence
MFTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQIYNHDFYWDCLSPKATALSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYGHINWHFVSQCYEWAKKEGLGSVDYYINELVHKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title The crystal structure of the superoxide dismutase from Helicobacter pylori reveals a structured C-terminal extension
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 77
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ceiA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ceiA02
1ZUQA 3AK2A 3MDSA 3RN4A 1AP6A 1BS3A 1D5NA 1KKCA 1XREA 1EM1A 1I0HA 5AG2A 3C3SA 1MSDA 2QKCA 3C3TA 1SZXA 4F6EA 1MMMA 1QNMA 3DC6A 1IXBA 1VEWA 1XUQA 2CE4A 1GN3A 1AR4A 2CDYA 1ZTEA 1GN4A 4YIOA 1GN2A 2RCVA 1N0JA 1EN4A 3AK3A 3EVKA 4JZ2A 1MNGA 4FFKA 4JYYA 3IC9A 1AP5A 3OT7A 2QKAA 3LSUA 1B06A 1Y67A 5A9GA 1BT8A 3CEIA 4X9QA 1IDSA 4JZGA 3QVNA 3KKYA 1LUVA 1IX9A 2ADQB 1MA1A 1PM9A 3BFRA 1EN6A 1JR9A 1LUWA 2ADPA 1ZLZA 1I08A 1PL4A 1GN6A 2AW9A 1WB7A 1WB8A 3AK1A 1JA8A 2P4KA 1EN5A 1BSMA 3K9SA 4YIPA 1ZSPA 1XILA 4C7UA 1AR5A 1AVMA 2GDSA 1XDCA 1P7GA 3DC5A 4GUNA 4BR6A 4E4EA 1N0NA 1VARA 3TJTA
chains in the Genus database with same CATH superfamily
4LWSB 1OZ0A 4X89A 1WPBA 1N32O 5CBFA 5BMVB 4ICGA 3FKSG 4U3JB 3K5LA 4U7NA 3ICXA 4MSWC 2PY5A 2VRZA 4B3SO 4I4TA 2N05A 3HKEA 5LMUO 2GBOA 4BAYA 3K06A 3OW2U 5KX5B 1GN4A 1K33A 1H2GA 4QIWF 4K8XA 1XOUA 3EVKA 3ETQA 4JZ2A 3O9OA 2XAGA 4P9PA 1QVGU 1I5XA 1YDXA 3OMAB 5H6QA 3CMAV 4J9YB 4TSFG 4L8JA 1NU1H 3ASNC 2F43G 3LSSA 4I7ZB 3ZX6A 3SDLA 1KC8W 3GVMA 1KP3A 2BTOA 4R7CA 3J7AU 1HNWB 1IZ3A 2E3CA 4JI4B 1H8EG 5BR8O 4B3RO 2JVDA 4LH7A 3MHHC 4CS3A 1UPGA 1PL4A 3CP1A 4X1IA 1Q90D 3ML0A 3J81N 1OCCB 2UU9B 4CC5A 1BSMA 2HKOA 2UUBO 3AG1C 2R9IA 1GRJA 3FYIB 2PGGA 1S0VA 1XDCA 4U7OA 2UXBO 1OCOB 3ASOC 2H8PC 4KXRA 1SQQH 2HJFC 1M90W 3OMNB 4N23A 4ASUG 2UUAO 5JVDB 5C8YB 3S3WA 3BEHA 3CX5F 3ZMZA 4HNAA 2Q69A 3OGIB 3LNNA 4J7KA 1NH2B 4JI7B 1SQBH 2YC0A 3FAVB 1B3QA 4FLTA 1Y6XA 3RVYA 1Q82W 4LF8O 3ABLC 3H01A 2XUMA 1KECA 3JSLA 1WPXA 5KUMA 5IWAB 2YIAA 2RNBA 3FFQA 1IBKO 2WA3A 4K0KB 2DYSC 4IHJB 3D36A 3QO8A 4UVCA 5IJ9A 4GX1A 1I94O 2Q73A 1HNZB 3K0DA 3OAAG 1E1RG 4LC1A 4JI0B 4NVPA 5JQGA 4OXSA 5CBGA 4AI8A 3EFFK 2VWJA 3ZHVA 2KQXA 2OYQA 3CEIA 2GSMB 2PF4E 4FZ1A 4MVUA 4LFCO 2NR5A 2CTPA 5LA6B 4EEQA 2W0XA 1N32B 4JZGA 3QVNA 2PI4A 5IDJA 3GWKC 1I7FA 1YHQV 2W0FC 3JALA 2YXLA 5LMUB 4C7UA 1AR5A 2Q7EA 3JD1A 4NXNO 4DR6O 4K8ZA 5FNVA 1TUEB 1RSOA 4PDRA 5H2FZ 1BL8A 2Q68A 2LGWA 1R6NA 4AILC 4I0XA 4OGQB 4CH5A 2CTQA 2XOKG 1FXKB 2BTQA 4NYKA 4JV5B 3ZIAG 3H1IH 1XHZA 4PA4A 5EBWC 4I50A 2YEVB 3RN4A 3CCLV 5DEDA 3OEEG 1SZTA 1XNRO 2EIJB 3U0ZA 4DR4O 2JS3A 1EFRG 1NS1A 4LWSA 1BE3H 5BR8B 4B3RB 5BY1A 1D5AA 1WP7A 4U3JA 5LP6B 3I5DA 4YIOA 1MG1A 1TVKB 2RCVA 1SA0A 4UCVA 2AZ0A 4DUZO 4I5SA 5IT9N 2UUBB 1LNQA 2HFEC 5FPRA 1GM9A 3IC9A 1HDJA 4AHCA 2UXBB 2ZXWC 5KX5A 2GTSA 5EK0A 2EX3A 2NLJC 2UUAB 2ITDC 4NXMO 1GM7A 1KBHA 5JJNB 2V1DA 3E89A 3JASA 4HAMA 4KUMA 2E74B 4ZIBA 1NR7A 2ITCC 3ETEA 5JJJB 3CRAA 3B77A 4IIJB 3CC4V 1JA8A 1S5LZ 3UCSC 5L3GA 2IH3C 1Q6IA 4IL6Z 5ITZB 1XL6A 3CCSV 4YIPA 1NR1A 2PYLA 1KB9F 1IBKB 4O4LB 4E2LA 3GB7C 4BIUA 5CA0A 4ZBMA 4FZ0A 4H44B 1I94B 5LHGA 2A7WA 2XAJA 2YUAA 4JI8O 1GKFA 1ZUQA 1DF4A 3RYCB 1WNSA 1SQGA 2WSSG 3VOUA 4LFCB 3AG3C 1EM1A 3W7TA 3HKDB 2P4VA 4NB5A 1WA8A 2QKCA 1SZXA 3ZN1A 2ZE5A 1XI1A 3QO5A 2R9AA 5B3SB 1NH2D 4AQYO 2Q4PA 1J5EB 3X2QC 5E79Z 2YIDA 4FM1A 4ZOLA 2CTWA 2JRIA 2WLMA 2ZCEA 3FB5C 3ABTA 5H5NA 4LNUB 4H37A 4N21A 1KQSU 1AP5A 3P32A 1M57B 5CBHA 4NXNB 4DR6B 3DGEA 3SJBC 4XDKA 1F51A 3TGUH 1RPRA 2AHYA 1YITV 3IJ4A 5EBMC 3OFNG 3T4ZA 4X1YB 1HW7A 3BRCA 2ZD9A 5H9CA 4X9QA 4A5UB 2FKXA 3PJSK 3A8TA 5FLXN 2R9RB 4LFAO 2QWQB 1XNRB 1IURA 4UCTA 1FYJA 1TAEA 4DR7B 1M4UA 3ABKC 3JAWB 4H33A 4DR4B 1K97A 2QWNB 1W0KG 3E35A 1KKDA 2DWEC 1TGOA 2EJ7A 3G80A 1COWG 1XILA 2A06H 4RUFA 1CP9A 4FJCC 4WBNB 3H9VA 3B8MA 3JARB 4WFEA 2K1EA 3RBZA 1P7GA 4DUZB 4QJFB 1GK9A 3RWRD 2Q7GA 3CRCA 3VBBA 4LF7O 2ATKC 2WLKA 4X8AA 5CB4A 1BHBA 3L75H 1LR1A 3H1KH 4DK0A 4DR2B 2EIMB 3MDSA 4ZI7B 4TQDA 1JX9A 1D5NA 3Q4HA 1KKCA 3G4SV 4NXMB 1F4MA 3C3SA 1BZKA 1FXKA 5JH7A 2Y48A 1FAFA 2YEVA 1OCRC 4D7SA 1GN3A 2CDYA 4IGGA 2Q0OC 4UVBA 3AG7A 1N0JA 4G2KA 4O4JB 5IE9A 5K1XA 4MVOA 3E8HA 3QTCA 2QKAA 3LSUA 1AJPA 2DQ3A 3I56V 3T1HO 4B7EA 4PI2A 2WAMA 2UU9O 2ZKOA 2BE3A 5BZBA 5EZYB 4H0LB 4JI8B 1FXHA 1SESA 1SF9A 3STLC 2QE7G 2QKSA 4I55B 4TV9B 2A3QA 4NR1A 1SC5B 4XDLA 5KMGB 2IH1C 4R50A 4B3TO 3SPIA 3BVOA 3BCCH 3IGAC 2QDOA 1EZJA 2P90A 3B2EE 3VQXA 2AW9A 4UV9A 4GZRB 3CCVV 3DXRB 5KHKA 2XAHA 1FFXA 4AQYB 3UKMA 4UFZA 2KSDA 3MHSC 3HB3B 1RM1B 3ZRXA 4GCZA 2LW1A 1OCCC 2LO1A 3G6BA 1S5JA 1Y74B 4G27B 1QR9A 3F7YC 2F23A 3SR2C 1NKDA 3UT5B 2EILB 4OX9O 4JAAA 1NI8A 2ZDIA 2ZE8A 2ZIOA 4JI0O 5KHJA 4JPRA 2EZPA 3CRQA 1X59A 4LFAB 1R1BA 3VQWA 2KKWA 4K35A 4JASA 2YDEA 2XTAA 1K5SA 2E76B 4TWKA 4X20B 2WPDG 2EINB 3RT3C 4O2AB 3WG7C 1NTKH 4UCUA 5KA6A 2F4VO 2ZQMA 5KHIA 3M8AA 1V54B 1HNXO 1B06A 2BOCC 4DR1O 3UO3A 4LF7B 4LBEC 3CRMA 1FS0G 2B9ZA 2CGOA 2E75B 1VQNV 1T5EA 3L9DA 1IX9A 1SQVH 5A2QN 2OWOA 3BFRA 3ZRWB 1AJQA 5EC1C 1QU7A 2GUZA 1ZAUA 1ZLZA 4JV5O 4PI0A 1VQ9V 1YTFB 4MTOA 4TV8B 4J80A 4OPAA 3JD0A 1EN5A 1FD9A 2RN9A 1M56B 1SERA 1R3KC 3F5WC 2RMKB 4UVAA 4XDJA 1J95A 2CH7B 2QJ1A 4UCSA 1P7BA 3CCQV 1QR8A 4JGSA 2A9HA 2PUSA 3DC5A 3WFVA 4P9OA 3ZHTA 4BR6A 4WFFA 2ZE6A 1DLBA 4LFBO 3K9AA 2Y69B 1R6KA 1PNMA 3T1HB 2OIGA 3TJTA 5L3DA 4WBNA 5IYCO 3JARA 3AK2A 3SJQC 2YIBD 3CJHA 3ZHQA 3RYIA 1KU9A 2DWDC 5CA1B 4UCRA 1FXKC 4MT8A 4FIPC 3OMIB 4B3TB 1Y76A 4FFBB 3OUFA 4B08A 1VP7A 1QNMA 1EZVH 2ZR2A 4FLWA 2EIJC 1NTMH 2DQ0A 2L6LA 1JNBA 1OCZB 3ZJZA 2GTAA 2UUCO 1AI5A 1H2KA 3P3PA 1PL0A 1TUBB 1VF5B 3BY6A 3E83A 1KMIZ 1FPOA 2YXHA 1AI6A 3JD3A 1PNLA 3IC7A 3TXSA 1X4TA 2Q7HA 1Y66A 3HKBB 3CCUV 3NR7A 4DYLA 3TXQA 1F4NA 4DV5B 1ENVA 4MTGA 5LOVB 4HYOA 3JCUZ 2M7WA 4KFMA 4X64B 1YJWV 1QLNA 1PP9H 3N2GA 5IJ0B 4O4HB 4OX9B 1XQ8A 2Y0PA 3E8GA 1H2NA 1K5QA 5KHGA 2CAZC 3FB7C 2WLIB 2BSKA 4DV4O 1BQ0A 4DV2O 4I55A 1A32A 2JGDA 3AK1A 4FLUA 3BA9A 4W4KA 2YI9A 3JATA 4B3MO 2H3OA 4LF9O 5KMGA 5EYPA 2Z0AA 3AG2B 1PV0A 3RGBA 3HKCB 1AVMA 3FX7A 1YZBA 4O2BB 2R72A 1GTOA 3PN1A 1VQ8V 4BWAA 2ZIMA 5DM6V 5EBLC 3ZBHA 2F4VB 1E79G 4DRXB 1J5EO 4JAUA 3ZEDA 1HNXB 1VARA 1ORQC 2P06A 3JAKA 1AR1B 3M99B 4YJ2B 1K3EA 4DR1B 3OR7C 4X1KB 3ABUA 3ZHSA 1AP6A 3ASNB 1DF5A 2ZDIC 4PA7A 2HG5C 3ZCCA 2N04A 4IYHA 4ZHQA 2Q5ZA 3E22B 4NTWA 3BABA 2PI5A 3OGCC 1HWYA 1ZL8B 4YJ3B 2LFRA 5KAIZ 1GM8A 4FM0A 1IVSA 2F66C 3SPCA 4PHZA 5GTHZ 3ZMVA 1B6QA 1K92A 2FYUH 3CHXA 1XBLA 2X6BA 3D8CA 2OCHA 4TUYA 4EFBA 4PV1B 4DR7O 2EJRA 1YSCA 3QO7A 2WLJA 2XASA 3BAAA 1MOFA 1Q43A 2IJHA 4MS2A 3APOA 5BMVA 3WB0A 4LFBB 2V4DA 1M57C 1S5HC 5GONB 4UV8A 1IDSA 4CH6A 4PA3A 3ZHUA 3KKYA 5J2UB 2VQFB 2ADQB 3JCZA 2IJKA 3SJAC 2XAFA 3LSQA 1G4YB 2JS5A 1Z5WA 3LNMB 3U10A 1GO3F 4DR2O 1WB7A 3IFXA 3ZN0A 2PYJA 3H1JH 2QM8A 2DW4A 5LXTB 4CS2A 1AB3A 1VQKV 1Y4MA 1YTFD 4UCOA 2XHBA 3C90A 2GDSA 2UUCB 5TISZ 4XBFA 3DSQA 1V55B 2UXCO 3CCJV 4GYCB 1W0JG 2NN4A 4J7ZA 4LP8A 2HHHB 2EIKB 1N36B 3SGIA 1JVMA 4LR3A 2CH7A 3ZS8C 4EB6B 4J41A 1JFFB 2KG7B 4Q6GA 2B1IA 1NJIW 1NZ6A 1XREA 1ROPA 1V9PA 2EIMC 1S3JA 4Q20A 1Z5VA 2IJIA 2B1GA 4Z2WA 2DE0X 4DV4B 4DV2B 2H94A 3G6EV 1WLEA 5CA1A 4O4IB 4B3MB 4LF9B 3L71H 4FFBA 1W59A 1BHAA 1K4CC 2ILMA 4DV7B 4MVQA 5JVDA 2ZT9B 4IT5A 5C8YA 4DW0A 5L3CA 2HEPA 5JWPA 4J42A 3B8NA 3EXAA 4RAIA 2OT5A 2M6YA 4X62O 3K0GA 4LF4O 4UB8Z 3FAVA 2Z3YA 2AXTZ 3CCMV 5LHIA 3NXSA 4QGPA 3ZHRA 3HKBA 3RW0A 5L3FA 1L1FA 4DV3B 1HR0O 1K7DA 4R6ZA 1JOYA 2ZR3A 4IHJA 3RYFB 4B7KA 4I4TB 4CZZA 1Q5OA 5LOVA 4LH6A 4QE7A 3RFRA 3HKEB 3K04A 5IJ0A 1ZSPA 3CC2V 1Q6HA 5IY5B 1CXZB 2WLLB 4WF9V 1QLEB 2X6CA 1KUQA 3SYCA 3THOA 2YSUB 3SPGA 1S77D 4DR5B 1R3LC 3TETA 1BCCH 4JF3A 5LA6A 5B1BB 2AZ2A 1AILA 1RM1C 3OTOB 2IU3A 3HKCA 4PA6A 1IXMA 3N2KB 3QG5A 5GTIZ 2QGNA 2A0LA 5BXZA 2YICA 4P2ZA 3CCEV 1JJ2U 2R70A 2P22C 1CPYA 3QNEA 3LDDA 1H8HG 1N33B 3SJCC 1NVPB 3E86A 2YXYA 2JEUA 4X1KA 2EILC 1BMFG 1JCHA 3M7MX 2CE4A 4DXWA 4JI2O 2Q8VA 2VQEO 3QF7A 2RQ6A 1IBMB 1SKVA 4X1IB 1VQ6V 2A79B 2D2CB 4JI6O 2PTMA 2ZNJA 5B1OA 2QM7A 3OD4A 1UJWB 4GX5A 2DJVA 1AJNA 5KUKA 3UM7A 1YJNV 2UXCB 4FLXA 3CB2A 3FYEB 1XMOO 1OHHG 5LBQA 1G6UA 2EINC 3TCUA 3K5MA 3FB6C 1KYOF 1JMKC 3RYHB 2ZE7A 2Y4TA 5LYJB 2BOBC 2VWKA 1CEZA 5JCOA 3CPWU 3K57A 2JEXA 4F4LA 3AG3B 4MTXA 4NTYA 5LP6A 1GN6A 1TVKA 4FK5C 1VQOV 3T4DA 4LF5B 4LF6O 1ZX3A 1P49A 1VQLV 3X2QB 3K08A 5HFMA 1M93A 3LDCA 3A0RA 3WU2Z 3UO2A 2QWOB 1N34O 5IJ9B 1M56C 3JSNA 5LXTA 4FM2A 2DYRB 2HVJC 4FLZA 3ETDA 3K03A 1BQZA 5JQGB 1THZA 2AGAA 2DN9A 4X62B 2P6JA 1OV9A 1I0HA 2JJ1G 2Z5UA 5D5QA 4LF4B 3JD2A 4NKGB 5J2TB 4F6EA 4IIJA 2QM4A 4OPHA 1NTZH 3G71V 5ITZA 1HR0B 1XUQA 4F6RB 1E1QG 1MZFA 3BPZA 4O4LA 5J9PC 4I9WA 4DV5O 3JALB 1OCOC 3OR6C 1H2LA 4X64O 4GX0A 4JTCB 1YIJV 1P4RA 4ABMA 5FNVB 4PDVA 3UQ8A 3RYCA 3CXHF 1VMGA 3H1LH 1QCEA 5F2VO 1PD3A 4BIOA 3CD6V 1H2MA 1DTOA 1OJHA 5EIBD 2QEXV 2BTQB 3HKDA 1Z2GA 1N4CA 1FKAO 4I50B 4DUYO 2ARHA 4I9QA 1JQ0A 5C93A 3KCXA 1L0NH 5CMUA 1I08A 3K58A 3ABMB 1VIBA 2P7TC 3K9SA 1AROP 3W7UA 4LNUA 3S3XA 2HJDA 4JI2B 2VQEB 2CUGA 1OCRB 3K79A 3D3IA 1KP2A 4BW9A 4JI6B 5HFLA 1SA0B 1VF6A 3T1CA 3RYFA 3U11A 4RWUA 1N0NA 1GH6A 3AG2C 2RJZA 4UXNA 4X1YA 3KDRA 1B04A 4DR3O 2WLLA 1XMOB 1H38A 2JDIG 4J7JA 5EC2C 5B1AB 4IYIA 1SRYA 3MAQA 2E5LO 5LMNO 1PKXA 4HZ3A 3JAWA 2UXDO 2FMLA 4Z1VA 1VQ7V 1M1KW 4DV6O 4PJ0Z 3N2KA 1K4DC 3JASB 4RO2A 1KD1W 3KG2A 1L0LH 2X6AA 4JAVA 1NVPD 1YF2A 3SPHA 4JI3B 2VQFO 3AG4B 1MNGA 4LF6B 5CA3A 1NQTA 4FFKA 1XMQB 2N74A 2F93B 5IYDO 2XNDG 2YIBA 2NNUA 2IW5A 5CA0B 1Y67A 4DV1B 1EBOA 1YCIA 1BGYH 4ZI7A 1N34B 3SYOA 1BT8A 3WB1A 4GX2A 4H13B 5JCOC 4D7TA 1YJ9V 4L87A 2HHHO 1MA1A 1N36O 2OCCB 3BHPA 1YEWA 1JR9A 5LP6C 3RYHA 3K59A 2ADPA 2IBZH 4WFHA 1WA8B 5LYJA 5DN6G 1K8AW 2P4KA 4O4JA 2EULA 4FMTA 1U97A 3L70H 1DGSA 2XT9A 2Y4UA 1P84F 1R6TA 1Q7YW 4ZOLB 3ZRVA 3A2FA 2RDCA 4PD4F 1Q81W 4E4EA 2FB5A 3WG7B 3CC7V 3FB8C 5EZYA 3L74H 1SQFA 2F1MA 4K3AA 4TV9A 1V55C 2QTOA 2CTRA 2EIKC 4ZKIA 3TK1A 2F95B 4DV7O 4JI1O 3K3WA 4GKJB 2IM9A 4QE9A 2Q67A 4DUYB 2WLNA 4GKKB 1L8DA 3DXRA 1FFTB 1JJOA 3CXCU 5LHHA 2YS8A 1VEWA 4MW8A 4CBCA 3I55V 1MZEA 1FJGO 3ZRSA 1FOUA 1VQ5V 3B09A 5LL6Y 2ZM6O 1EN4A 3AK3A 5J2TA 4D6TH 4CS4A 2PZSA 1Y74A 2WLHA 3E2EA 3OT7A 4DV3O 2QTSA 4F6RA 3JD4A 1K73W 5JJEB 4JYBA 3HR0A 4B3SB 2DMXA 2QWPB 3UT5A 2IJJA 2D3OW 1IBLO 5LGTA 1I5YA 1MSWD 5CB4B 2XAQA 4DR3B 4J9ZB 4EFEA 1SQXH 3CSXA 2K9PA 2IU0A 5B3SC 5EIBC 1H5WA 4DR5O 1Q6UA 2E5LB 3HPLC 5LMNB 1S76D 3AG1B 3Q4HB 2UXDB 2LGQA 1EN6A 1LUWA 4X20A 4WFGA 1ZWIC 3OTOO 4DV6B 2CGNA 5JH7B 1QVFU 4FLVA 4KL1A 3IAYA 5KA5A 4NTXA 3ASOB 1YI2V 4O2AA 2MK3A 4PDLA 2FTKA 4PA9A 1O9GA 2WA4A 3W7SA 1NT2B 1VF6C 4JYAO 4DV0O 1H2SB 4WFAV 4QNHB 1N33O 1K34A 2B5UA 3W7WA 3K5NA 5IY5C 1S72V 1QLEC 3DTUB 1IBMO 3SYPA 4RQEA 4GLXA 3B4SA 3ABLB 2W6IG 2Y0IA 3SPJA 1BS3A 3A0BZ 2FL4A 3OM3B 1WP8A 3D3QA 3ZRWA 5B1BC 3R65A 2DYSB 4FLYA 3C3TA 1TA8A 1W2BU 2ZINA 5L3EA 4TV8A 2Q9LA 1F23A 1IJGA 1IXBA 5KLVH 1R73A 4RQFA 1RP3B 1F7YA 4TT3G 3LUTB 1FFXB 1QBZA 4CC6A 1K9MW 4Z1MG 1XEQA 4KHPO 3CS5A 3CCRV 5B5EZ 5IYZB 4W4LA 2L35A 4X65O 3T2MA 3T1YO 4YY3O 4LF8B 3STZC 3VQVA 2ETNA 3ZMUA 4LF5O 4MVRA 3KZIZ 2W6JG 2LQTA 1SETA 2YI8A 1GMGA 4YHHO 2WWWA 2GHYA 4X88A 1PNKA 5CN0A 3E8FA 4JTDB 1LUVA 5B1NA 2OTJV 1XNQO 4JYCA 2JK5C 4JI1B 2HR3A 4X66O 1PPJH 1WJZA 2P67A 2GV9A 1WB8A 3P30A 3VQYA 5LGNA 2ZNIA 1Q3EA 3APQA 1TUBA 1FJGB 2X7RB 4QPJA 1R3IC 3JAMN 3EHBB 2ZM6B 4GUNA 2P5OA 4QPKA 3OE7G 4PELA 3W7XA 2DOSA 1U96A 3K5OA 4JI5O 3D36C 1XL4A 1IBLB 2EBOA 1VQMV 1SS3A 4O4HA 1NBMG 2MW2B 5FPOA 4UB6Z 1AI4A 1GAXA 5AG2A 2DYRC 3SYAA 4DO2A 1JPXA 1MSDA 2WLIA 4UUJC 4BIZA 5DECA 1AI7A 2VS0A 2Q6AA 3FD9A 3JYCA 1US6A 2KB1A 2CK3G 3SYQA 2QA4V 2C2AA 3P3NA 4RUEA 2GUZB 3J80N 1AR4A 2JGUA 1N8RW 5IYBO 2ZXWB 4O2BA 3CMEV 5K1PA 5H6RA 1DK1A 3E8BA 4KP4A 3G67A 4JYYA 4DRXA 3N27A 3OUSA 4JYAB 4DV0B 3R66A 3LDEA 4YJ2A 3OTFA 3AEIA 3OEHG 3B40A 3ZMTA 1URFA 3WB2A 3L73H 1M9NA 4MVZA 3H1HH 2OTLV 2O57A 3E22A 4DW1A 2QWRB 3CJHB 1ZL8A 4YJ3A 3RYIB 3L72H 3O65A 1MABG 1RFYA 4MW3A 2QR4A 5LGUA 1Y76B 2LP7A 4FPPA 1RPOA 2Q0AA 2UXXA 4GT1A 2JIZG 4CH4A 4EKWA 1FXVA 1V54C 5D5PA 2QSAA 4HNAB 3ABMC 2LJ2A 5B66Z 4MVMA 4KHPB 3CRRA 3ZMSA 1QQCA 3BA8A 4X65B 3T1YB 5GONA 4YY3B 1VQ4V 4BW5A 3RVZA 4JI3O 2JJ2G 5J2UA 4R8CA 5KHHA 4DK1A 1HNWO 4JI4O 1XMQO 1R3JC 5E1AC 1QHTA 4TQFA 1XHXA 4YHHB 4J10A 4DV1O 1XNQB 4LCUC 1MMMA 3CE2A 3N2GB 2HP8A 2LW7A 2G38A 3DC6A 5B1AC 2BCCH 4X66B 1UFIA 2BSKB 1ZTEA 1WAZA 1GN2A 2JGDB 1WN7A 3JATB 5EYPB 2HLDG 1SQPH 2Y69C 3CWBH 4EB6A 1JFFA 3AG4C 5A9GA 2KG7A 3CYOA 1O9HA 3ABKB 4P30A 4JI5B 1Q86W 3JAKB 1M5IA 5GW7A 5IYZA 1HP8A 2ODMA 4MTFA 4JI7O 1G1XB 2LFSA 1VF7A 1D2DA 4HBNA 3KCYA 1Q8IA 1PM9A 4YXWG 4WCEV 5IWAO 4PDMA 1OCZC 1YVWA 4TOIA 4ZHQB 2HVKC 1RSOB 4JTAB 4G28B 4J11A 4O4IA 4K0KO 3A0HZ 5FL7G 4I0XB 3GWOA 2OCCC 5L3BA 2EZOA 4CH3A 1HNZO 3F5TA 2UXNA 3F7VC 1VQPV 4WFBV 2AHZA 4GKJO 3ETGA 4GKKO 3MD0A 2OIEA 1G8MA 4MVSA 4U3FH 4TUYB 4FVMA 5KAFZ 1YXBA 2X0LA 2V7QG
chains in the Genus database with same CATH topology
1ZUQA 3AK2A 3MDSA 3RN4A 1AP6A 1BS3A 1D5NA 1KKCA 1XREA 1EM1A 1I0HA 5AG2A 3C3SA 1MSDA 2QKCA 3C3TA 1SZXA 4F6EA 1MMMA 1QNMA 3DC6A 1IXBA 1VEWA 1XUQA 2CE4A 1GN3A 1AR4A 2CDYA 1ZTEA 1GN4A 4YIOA 1GN2A 2RCVA 1N0JA 1EN4A 3AK3A 3EVKA 4JZ2A 1MNGA 4FFKA 4JYYA 3IC9A 1AP5A 3OT7A 2QKAA 3LSUA 1B06A 1Y67A 5A9GA 1BT8A 3CEIA 4X9QA 1IDSA 4JZGA 3QVNA 3KKYA 1LUVA 1IX9A 2ADQB 1MA1A 1PM9A 3BFRA 1EN6A 1JR9A 1LUWA 2ADPA 1ZLZA 1I08A 1PL4A 1GN6A 2AW9A 1WB7A 1WB8A 3AK1A 1JA8A 2P4KA 1EN5A 1BSMA 3K9SA 4YIPA 1ZSPA 1XILA 4C7UA 1AR5A 1AVMA 2GDSA 1XDCA 1P7GA 3DC5A 4GUNA 4BR6A 4E4EA 1N0NA 3KDRA 1VARA 3TJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUQ A;  3AK2 A;  3MDS A;  3RN4 A;  1AP6 A;  1BS3 A;  1D5N A;  1KKC A;  1XRE A;  1EM1 A;  1I0H A;  5AG2 A;  3C3S A;  1MSD A;  2QKC A;  3C3T A;  1SZX A;  4F6E A;  1MMM A;  1QNM A;  3DC6 A;  1IXB A;  1VEW A;  1XUQ A;  2CE4 A;  1GN3 A;  1AR4 A;  2CDY A;  1ZTE A;  1GN4 A;  4YIO A;  1GN2 A;  2RCV A;  1N0J A;  1EN4 A;  3AK3 A;  3EVK A;  4JZ2 A;  1MNG A;  4FFK A;  4JYY A;  3IC9 A;  1AP5 A;  3OT7 A;  2QKA A;  3LSU A;  1B06 A;  1Y67 A;  5A9G A;  1BT8 A;  3CEI A;  4X9Q A;  1IDS A;  4JZG A;  3QVN A;  3KKY A;  1LUV A;  1IX9 A;  2ADQ B;  1MA1 A;  1PM9 A;  3BFR A;  1EN6 A;  1JR9 A;  1LUW A;  2ADP A;  1ZLZ A;  1I08 A;  1PL4 A;  1GN6 A;  2AW9 A;  1WB7 A;  1WB8 A;  3AK1 A;  1JA8 A;  2P4K A;  1EN5 A;  1BSM A;  3K9S A;  4YIP A;  1ZSP A;  1XIL A;  4C7U A;  1AR5 A;  1AVM A;  2GDS A;  1XDC A;  1P7G A;  3DC5 A;  4GUN A;  4BR6 A;  4E4E A;  1N0N A;  1VAR A;  3TJT A; 
#chains in the Genus database with same CATH topology
 4LWS B;  1OZ0 A;  4X89 A;  1WPB A;  1N32 O;  5CBF A;  5BMV B;  4ICG A;  3FKS G;  4U3J B;  3K5L A;  4U7N A;  3ICX A;  4MSW C;  2PY5 A;  2VRZ A;  4B3S O;  4I4T A;  2N05 A;  3HKE A;  5LMU O;  2GBO A;  4BAY A;  3K06 A;  3OW2 U;  5KX5 B;  1GN4 A;  1K33 A;  1H2G A;  4QIW F;  4K8X A;  1XOU A;  3EVK A;  3ETQ A;  4JZ2 A;  3O9O A;  2XAG A;  4P9P A;  1QVG U;  1I5X A;  1YDX A;  3OMA B;  5H6Q A;  3CMA V;  4J9Y B;  4TSF G;  4L8J A;  1NU1 H;  3ASN C;  2F43 G;  3LSS A;  4I7Z B;  3ZX6 A;  3SDL A;  1KC8 W;  3GVM A;  1KP3 A;  2BTO A;  4R7C A;  3J7A U;  1HNW B;  1IZ3 A;  2E3C A;  4JI4 B;  1H8E G;  5BR8 O;  4B3R O;  2JVD A;  4LH7 A;  3MHH C;  4CS3 A;  1UPG A;  1PL4 A;  3CP1 A;  4X1I A;  1Q90 D;  3ML0 A;  3J81 N;  1OCC B;  2UU9 B;  4CC5 A;  1BSM A;  2HKO A;  2UUB O;  3AG1 C;  2R9I A;  1GRJ A;  3FYI B;  2PGG A;  1S0V A;  1XDC A;  4U7O A;  2UXB O;  1OCO B;  3ASO C;  2H8P C;  4KXR A;  1SQQ H;  2HJF C;  1M90 W;  3OMN B;  4N23 A;  4ASU G;  2UUA O;  5JVD B;  5C8Y B;  3S3W A;  3BEH A;  3CX5 F;  3ZMZ A;  4HNA A;  2Q69 A;  3OGI B;  3LNN A;  4J7K A;  1NH2 B;  4JI7 B;  1SQB H;  2YC0 A;  3FAV B;  1B3Q A;  4FLT A;  1Y6X A;  3RVY A;  1Q82 W;  4LF8 O;  3ABL C;  3H01 A;  2XUM A;  1KEC A;  3JSL A;  1WPX A;  5KUM A;  5IWA B;  2YIA A;  2RNB A;  3FFQ A;  1IBK O;  2WA3 A;  4K0K B;  2DYS C;  4IHJ B;  3D36 A;  3QO8 A;  4UVC A;  5IJ9 A;  4GX1 A;  1I94 O;  2Q73 A;  1HNZ B;  3K0D A;  3OAA G;  1E1R G;  4LC1 A;  4JI0 B;  4NVP A;  5JQG A;  4OXS A;  5CBG A;  4AI8 A;  3EFF K;  2VWJ A;  3ZHV A;  2KQX A;  2OYQ A;  3CEI A;  2GSM B;  2PF4 E;  4FZ1 A;  4MVU A;  4LFC O;  2NR5 A;  2CTP A;  5LA6 B;  4EEQ A;  2W0X A;  1N32 B;  4JZG A;  3QVN A;  2PI4 A;  5IDJ A;  3GWK C;  1I7F A;  1YHQ V;  2W0F C;  3JAL A;  2YXL A;  5LMU B;  4C7U A;  1AR5 A;  2Q7E A;  3JD1 A;  4NXN O;  4DR6 O;  4K8Z A;  5FNV A;  1TUE B;  1RSO A;  4PDR A;  5H2F Z;  1BL8 A;  2Q68 A;  2LGW A;  1R6N A;  4AIL C;  4I0X A;  4OGQ B;  4CH5 A;  2CTQ A;  2XOK G;  1FXK B;  2BTQ A;  4NYK A;  4JV5 B;  3ZIA G;  3H1I H;  1XHZ A;  4PA4 A;  5EBW C;  4I50 A;  2YEV B;  3RN4 A;  3CCL V;  5DED A;  3OEE G;  1SZT A;  1XNR O;  2EIJ B;  3U0Z A;  4DR4 O;  2JS3 A;  1EFR G;  1NS1 A;  4LWS A;  1BE3 H;  5BR8 B;  4B3R B;  5BY1 A;  1D5A A;  1WP7 A;  4U3J A;  5LP6 B;  3I5D A;  4YIO A;  1MG1 A;  1TVK B;  2RCV A;  1SA0 A;  4UCV A;  2AZ0 A;  4DUZ O;  4I5S A;  5IT9 N;  2UUB B;  1LNQ A;  2HFE C;  5FPR A;  1GM9 A;  3IC9 A;  1HDJ A;  4AHC A;  2UXB B;  2ZXW C;  5KX5 A;  2GTS A;  5EK0 A;  2EX3 A;  2NLJ C;  2UUA B;  2ITD C;  4NXM O;  1GM7 A;  1KBH A;  5JJN B;  2V1D A;  3E89 A;  3JAS A;  4HAM A;  4KUM A;  2E74 B;  4ZIB A;  1NR7 A;  2ITC C;  3ETE A;  5JJJ B;  3CRA A;  3B77 A;  4IIJ B;  3CC4 V;  1JA8 A;  1S5L Z;  3UCS C;  5L3G A;  2IH3 C;  1Q6I A;  4IL6 Z;  5ITZ B;  1XL6 A;  3CCS V;  4YIP A;  1NR1 A;  2PYL A;  1KB9 F;  1IBK B;  4O4L B;  4E2L A;  3GB7 C;  4BIU A;  5CA0 A;  4ZBM A;  4FZ0 A;  4H44 B;  1I94 B;  5LHG A;  2A7W A;  2XAJ A;  2YUA A;  4JI8 O;  1GKF A;  1ZUQ A;  1DF4 A;  3RYC B;  1WNS A;  1SQG A;  2WSS G;  3VOU A;  4LFC B;  3AG3 C;  1EM1 A;  3W7T A;  3HKD B;  2P4V A;  4NB5 A;  1WA8 A;  2QKC A;  1SZX A;  3ZN1 A;  2ZE5 A;  1XI1 A;  3QO5 A;  2R9A A;  5B3S B;  1NH2 D;  4AQY O;  2Q4P A;  1J5E B;  3X2Q C;  5E79 Z;  2YID A;  4FM1 A;  4ZOL A;  2CTW A;  2JRI A;  2WLM A;  2ZCE A;  3FB5 C;  3ABT A;  5H5N A;  4LNU B;  4H37 A;  4N21 A;  1KQS U;  1AP5 A;  3P32 A;  1M57 B;  5CBH A;  4NXN B;  4DR6 B;  3DGE A;  3SJB C;  4XDK A;  1F51 A;  3TGU H;  1RPR A;  2AHY A;  1YIT V;  3IJ4 A;  5EBM C;  3OFN G;  3T4Z A;  4X1Y B;  1HW7 A;  3BRC A;  2ZD9 A;  5H9C A;  4X9Q A;  4A5U B;  2FKX A;  3PJS K;  3A8T A;  5FLX N;  2R9R B;  4LFA O;  2QWQ B;  1XNR B;  1IUR A;  4UCT A;  1FYJ A;  1TAE A;  4DR7 B;  1M4U A;  3ABK C;  3JAW B;  4H33 A;  4DR4 B;  1K97 A;  2QWN B;  1W0K G;  3E35 A;  1KKD A;  2DWE C;  1TGO A;  2EJ7 A;  3G80 A;  1COW G;  1XIL A;  2A06 H;  4RUF A;  1CP9 A;  4FJC C;  4WBN B;  3H9V A;  3B8M A;  3JAR B;  4WFE A;  2K1E A;  3RBZ A;  1P7G A;  4DUZ B;  4QJF B;  1GK9 A;  3RWR D;  2Q7G A;  3CRC A;  3VBB A;  4LF7 O;  2ATK C;  2WLK A;  4X8A A;  5CB4 A;  1BHB A;  3L75 H;  1LR1 A;  3H1K H;  4DK0 A;  4DR2 B;  2EIM B;  3MDS A;  4ZI7 B;  4TQD A;  1JX9 A;  1D5N A;  3Q4H A;  1KKC A;  3G4S V;  4NXM B;  1F4M A;  3C3S A;  1BZK A;  1FXK A;  5JH7 A;  2Y48 A;  1FAF A;  2YEV A;  1OCR C;  4D7S A;  1GN3 A;  2CDY A;  4IGG A;  2Q0O C;  4UVB A;  3AG7 A;  1N0J A;  4G2K A;  4O4J B;  5IE9 A;  5K1X A;  4MVO A;  3E8H A;  3QTC A;  2QKA A;  3LSU A;  1AJP A;  2DQ3 A;  3I56 V;  3T1H O;  4B7E A;  4PI2 A;  2WAM A;  2UU9 O;  2ZKO A;  2BE3 A;  5BZB A;  5EZY B;  4H0L B;  4JI8 B;  1FXH A;  1SES A;  1SF9 A;  3STL C;  2QE7 G;  2QKS A;  4I55 B;  4TV9 B;  2A3Q A;  4NR1 A;  1SC5 B;  4XDL A;  5KMG B;  2IH1 C;  4R50 A;  4B3T O;  3SPI A;  3BVO A;  3BCC H;  3IGA C;  2QDO A;  1EZJ A;  2P90 A;  3B2E E;  3VQX A;  2AW9 A;  4UV9 A;  4GZR B;  3CCV V;  3DXR B;  5KHK A;  2XAH A;  1FFX A;  4AQY B;  3UKM A;  4UFZ A;  2KSD A;  3MHS C;  3HB3 B;  1RM1 B;  3ZRX A;  4GCZ A;  2LW1 A;  1OCC C;  2LO1 A;  3G6B A;  1S5J A;  1Y74 B;  4G27 B;  1QR9 A;  3F7Y C;  2F23 A;  3SR2 C;  1NKD A;  3UT5 B;  2EIL B;  4OX9 O;  4JAA A;  1NI8 A;  2ZDI A;  2ZE8 A;  2ZIO A;  4JI0 O;  5KHJ A;  4JPR A;  2EZP A;  3CRQ A;  1X59 A;  4LFA B;  1R1B A;  3VQW A;  2KKW A;  4K35 A;  4JAS A;  2YDE A;  2XTA A;  1K5S A;  2E76 B;  4TWK A;  4X20 B;  2WPD G;  2EIN B;  3RT3 C;  4O2A B;  3WG7 C;  1NTK H;  4UCU A;  5KA6 A;  2F4V O;  2ZQM A;  5KHI A;  3M8A A;  1V54 B;  1HNX O;  1B06 A;  2BOC C;  4DR1 O;  3UO3 A;  4LF7 B;  4LBE C;  3CRM A;  1FS0 G;  2B9Z A;  2CGO A;  2E75 B;  1VQN V;  1T5E A;  3L9D A;  1IX9 A;  1SQV H;  5A2Q N;  2OWO A;  3BFR A;  3ZRW B;  1AJQ A;  5EC1 C;  1QU7 A;  2GUZ A;  1ZAU A;  1ZLZ A;  4JV5 O;  4PI0 A;  1VQ9 V;  1YTF B;  4MTO A;  4TV8 B;  4J80 A;  4OPA A;  3JD0 A;  1EN5 A;  1FD9 A;  2RN9 A;  1M56 B;  1SER A;  1R3K C;  3F5W C;  2RMK B;  4UVA A;  4XDJ A;  1J95 A;  2CH7 B;  2QJ1 A;  4UCS A;  1P7B A;  3CCQ V;  1QR8 A;  4JGS A;  2A9H A;  2PUS A;  3DC5 A;  3WFV A;  4P9O A;  3ZHT A;  4BR6 A;  4WFF A;  2ZE6 A;  1DLB A;  4LFB O;  3K9A A;  2Y69 B;  1R6K A;  1PNM A;  3T1H B;  2OIG A;  3TJT A;  5L3D A;  4WBN A;  5IYC O;  3JAR A;  3AK2 A;  3SJQ C;  2YIB D;  3CJH A;  3ZHQ A;  3RYI A;  1KU9 A;  2DWD C;  5CA1 B;  4UCR A;  1FXK C;  4MT8 A;  4FIP C;  3OMI B;  4B3T B;  1Y76 A;  4FFB B;  3OUF A;  4B08 A;  1VP7 A;  1QNM A;  1EZV H;  2ZR2 A;  4FLW A;  2EIJ C;  1NTM H;  2DQ0 A;  2L6L A;  1JNB A;  1OCZ B;  3ZJZ A;  2GTA A;  2UUC O;  1AI5 A;  1H2K A;  3P3P A;  1PL0 A;  1TUB B;  1VF5 B;  3BY6 A;  3E83 A;  1KMI Z;  1FPO A;  2YXH A;  1AI6 A;  3JD3 A;  1PNL A;  3IC7 A;  3TXS A;  1X4T A;  2Q7H A;  1Y66 A;  3HKB B;  3CCU V;  3NR7 A;  4DYL A;  3TXQ A;  1F4N A;  4DV5 B;  1ENV A;  4MTG A;  5LOV B;  4HYO A;  3JCU Z;  2M7W A;  4KFM A;  4X64 B;  1YJW V;  1QLN A;  1PP9 H;  3N2G A;  5IJ0 B;  4O4H B;  4OX9 B;  1XQ8 A;  2Y0P A;  3E8G A;  1H2N A;  1K5Q A;  5KHG A;  2CAZ C;  3FB7 C;  2WLI B;  2BSK A;  4DV4 O;  1BQ0 A;  4DV2 O;  4I55 A;  1A32 A;  2JGD A;  3AK1 A;  4FLU A;  3BA9 A;  4W4K A;  2YI9 A;  3JAT A;  4B3M O;  2H3O A;  4LF9 O;  5KMG A;  5EYP A;  2Z0A A;  3AG2 B;  1PV0 A;  3RGB A;  3HKC B;  1AVM A;  3FX7 A;  1YZB A;  4O2B B;  2R72 A;  1GTO A;  3PN1 A;  1VQ8 V;  4BWA A;  2ZIM A;  5DM6 V;  5EBL C;  3ZBH A;  2F4V B;  1E79 G;  4DRX B;  1J5E O;  4JAU A;  3ZED A;  1HNX B;  1VAR A;  1ORQ C;  2P06 A;  3JAK A;  1AR1 B;  3M99 B;  4YJ2 B;  1K3E A;  4DR1 B;  3OR7 C;  4X1K B;  3ABU A;  3ZHS A;  1AP6 A;  3ASN B;  1DF5 A;  2ZDI C;  4PA7 A;  2HG5 C;  3ZCC A;  2N04 A;  4IYH A;  4ZHQ A;  2Q5Z A;  3E22 B;  4NTW A;  3BAB A;  2PI5 A;  3OGC C;  1HWY A;  1ZL8 B;  4YJ3 B;  2LFR A;  5KAI Z;  1GM8 A;  4FM0 A;  1IVS A;  2F66 C;  3SPC A;  4PHZ A;  5GTH Z;  3ZMV A;  1B6Q A;  1K92 A;  2FYU H;  3CHX A;  1XBL A;  2X6B A;  3D8C A;  2OCH A;  4TUY A;  4EFB A;  4PV1 B;  4DR7 O;  2EJR A;  1YSC A;  3QO7 A;  2WLJ A;  2XAS A;  3BAA A;  1MOF A;  1Q43 A;  2IJH A;  4MS2 A;  3APO A;  5BMV A;  3WB0 A;  4LFB B;  2V4D A;  1M57 C;  1S5H C;  5GON B;  4UV8 A;  1IDS A;  4CH6 A;  4PA3 A;  3ZHU A;  3KKY A;  5J2U B;  2VQF B;  2ADQ B;  3JCZ A;  2IJK A;  3SJA C;  2XAF A;  3LSQ A;  1G4Y B;  2JS5 A;  1Z5W A;  3LNM B;  3U10 A;  1GO3 F;  4DR2 O;  1WB7 A;  3IFX A;  3ZN0 A;  2PYJ A;  3H1J H;  2QM8 A;  2DW4 A;  5LXT B;  4CS2 A;  1AB3 A;  1VQK V;  1Y4M A;  1YTF D;  4UCO A;  2XHB A;  3C90 A;  2GDS A;  2UUC B;  5TIS Z;  4XBF A;  3DSQ A;  1V55 B;  2UXC O;  3CCJ V;  4GYC B;  1W0J G;  2NN4 A;  4J7Z A;  4LP8 A;  2HHH B;  2EIK B;  1N36 B;  3SGI A;  1JVM A;  4LR3 A;  2CH7 A;  3ZS8 C;  4EB6 B;  4J41 A;  1JFF B;  2KG7 B;  4Q6G A;  2B1I A;  1NJI W;  1NZ6 A;  1XRE A;  1ROP A;  1V9P A;  2EIM C;  1S3J A;  4Q20 A;  1Z5V A;  2IJI A;  2B1G A;  4Z2W A;  2DE0 X;  4DV4 B;  4DV2 B;  2H94 A;  3G6E V;  1WLE A;  5CA1 A;  4O4I B;  4B3M B;  4LF9 B;  3L71 H;  4FFB A;  1W59 A;  1BHA A;  1K4C C;  2ILM A;  4DV7 B;  4MVQ A;  5JVD A;  2ZT9 B;  4IT5 A;  5C8Y A;  4DW0 A;  5L3C A;  2HEP A;  5JWP A;  4J42 A;  3B8N A;  3EXA A;  4RAI A;  2OT5 A;  2M6Y A;  4X62 O;  3K0G A;  4LF4 O;  4UB8 Z;  3FAV A;  2Z3Y A;  2AXT Z;  3CCM V;  5LHI A;  3NXS A;  4QGP A;  3ZHR A;  3HKB A;  3RW0 A;  5L3F A;  1L1F A;  4DV3 B;  1HR0 O;  1K7D A;  4R6Z A;  1JOY A;  2ZR3 A;  4IHJ A;  3RYF B;  4B7K A;  4I4T B;  4CZZ A;  1Q5O A;  5LOV A;  4LH6 A;  4QE7 A;  3RFR A;  3HKE B;  3K04 A;  5IJ0 A;  1ZSP A;  3CC2 V;  1Q6H A;  5IY5 B;  1CXZ B;  2WLL B;  4WF9 V;  1QLE B;  2X6C A;  1KUQ A;  3SYC A;  3THO A;  2YSU B;  3SPG A;  1S77 D;  4DR5 B;  1R3L C;  3TET A;  1BCC H;  4JF3 A;  5LA6 A;  5B1B B;  2AZ2 A;  1AIL A;  1RM1 C;  3OTO B;  2IU3 A;  3HKC A;  4PA6 A;  1IXM A;  3N2K B;  3QG5 A;  5GTI Z;  2QGN A;  2A0L A;  5BXZ A;  2YIC A;  4P2Z A;  3CCE V;  1JJ2 U;  2R70 A;  2P22 C;  1CPY A;  3QNE A;  3LDD A;  1H8H G;  1N33 B;  3SJC C;  1NVP B;  3E86 A;  2YXY A;  2JEU A;  4X1K A;  2EIL C;  1BMF G;  1JCH A;  3M7M X;  2CE4 A;  4DXW A;  4JI2 O;  2Q8V A;  2VQE O;  3QF7 A;  2RQ6 A;  1IBM B;  1SKV A;  4X1I B;  1VQ6 V;  2A79 B;  2D2C B;  4JI6 O;  2PTM A;  2ZNJ A;  5B1O A;  2QM7 A;  3OD4 A;  1UJW B;  4GX5 A;  2DJV A;  1AJN A;  5KUK A;  3UM7 A;  1YJN V;  2UXC B;  4FLX A;  3CB2 A;  3FYE B;  1XMO O;  1OHH G;  5LBQ A;  1G6U A;  2EIN C;  3TCU A;  3K5M A;  3FB6 C;  1KYO F;  1JMK C;  3RYH B;  2ZE7 A;  2Y4T A;  5LYJ B;  2BOB C;  2VWK A;  1CEZ A;  5JCO A;  3CPW U;  3K57 A;  2JEX A;  4F4L A;  3AG3 B;  4MTX A;  4NTY A;  5LP6 A;  1GN6 A;  1TVK A;  4FK5 C;  1VQO V;  3T4D A;  4LF5 B;  4LF6 O;  1ZX3 A;  1P49 A;  1VQL V;  3X2Q B;  3K08 A;  5HFM A;  1M93 A;  3LDC A;  3A0R A;  3WU2 Z;  3UO2 A;  2QWO B;  1N34 O;  5IJ9 B;  1M56 C;  3JSN A;  5LXT A;  4FM2 A;  2DYR B;  2HVJ C;  4FLZ A;  3ETD A;  3K03 A;  1BQZ A;  5JQG B;  1THZ A;  2AGA A;  2DN9 A;  4X62 B;  2P6J A;  1OV9 A;  1I0H A;  2JJ1 G;  2Z5U A;  5D5Q A;  4LF4 B;  3JD2 A;  4NKG B;  5J2T B;  4F6E A;  4IIJ A;  2QM4 A;  4OPH A;  1NTZ H;  3G71 V;  5ITZ A;  1HR0 B;  1XUQ A;  4F6R B;  1E1Q G;  1MZF A;  3BPZ A;  4O4L A;  5J9P C;  4I9W A;  4DV5 O;  3JAL B;  1OCO C;  3OR6 C;  1H2L A;  4X64 O;  4GX0 A;  4JTC B;  1YIJ V;  1P4R A;  4ABM A;  5FNV B;  4PDV A;  3UQ8 A;  3RYC A;  3CXH F;  1VMG A;  3H1L H;  1QCE A;  5F2V O;  1PD3 A;  4BIO A;  3CD6 V;  1H2M A;  1DTO A;  1OJH A;  5EIB D;  2QEX V;  2BTQ B;  3HKD A;  1Z2G A;  1N4C A;  1FKA O;  4I50 B;  4DUY O;  2ARH A;  4I9Q A;  1JQ0 A;  5C93 A;  3KCX A;  1L0N H;  5CMU A;  1I08 A;  3K58 A;  3ABM B;  1VIB A;  2P7T C;  3K9S A;  1ARO P;  3W7U A;  4LNU A;  3S3X A;  2HJD A;  4JI2 B;  2VQE B;  2CUG A;  1OCR B;  3K79 A;  3D3I A;  1KP2 A;  4BW9 A;  4JI6 B;  5HFL A;  1SA0 B;  1VF6 A;  3T1C A;  3RYF A;  3U11 A;  4RWU A;  1N0N A;  1GH6 A;  3AG2 C;  2RJZ A;  4UXN A;  4X1Y A;  3KDR A;  1B04 A;  4DR3 O;  2WLL A;  1XMO B;  1H38 A;  2JDI G;  4J7J A;  5EC2 C;  5B1A B;  4IYI A;  1SRY A;  3MAQ A;  2E5L O;  5LMN O;  1PKX A;  4HZ3 A;  3JAW A;  2UXD O;  2FML A;  4Z1V A;  1VQ7 V;  1M1K W;  4DV6 O;  4PJ0 Z;  3N2K A;  1K4D C;  3JAS B;  4RO2 A;  1KD1 W;  3KG2 A;  1L0L H;  2X6A A;  4JAV A;  1NVP D;  1YF2 A;  3SPH A;  4JI3 B;  2VQF O;  3AG4 B;  1MNG A;  4LF6 B;  5CA3 A;  1NQT A;  4FFK A;  1XMQ B;  2N74 A;  2F93 B;  5IYD O;  2XND G;  2YIB A;  2NNU A;  2IW5 A;  5CA0 B;  1Y67 A;  4DV1 B;  1EBO A;  1YCI A;  1BGY H;  4ZI7 A;  1N34 B;  3SYO A;  1BT8 A;  3WB1 A;  4GX2 A;  4H13 B;  5JCO C;  4D7T A;  1YJ9 V;  4L87 A;  2HHH O;  1MA1 A;  1N36 O;  2OCC B;  3BHP A;  1YEW A;  1JR9 A;  5LP6 C;  3RYH A;  3K59 A;  2ADP A;  2IBZ H;  4WFH A;  1WA8 B;  5LYJ A;  5DN6 G;  1K8A W;  2P4K A;  4O4J A;  2EUL A;  4FMT A;  1U97 A;  3L70 H;  1DGS A;  2XT9 A;  2Y4U A;  1P84 F;  1R6T A;  1Q7Y W;  4ZOL B;  3ZRV A;  3A2F A;  2RDC A;  4PD4 F;  1Q81 W;  4E4E A;  2FB5 A;  3WG7 B;  3CC7 V;  3FB8 C;  5EZY A;  3L74 H;  1SQF A;  2F1M A;  4K3A A;  4TV9 A;  1V55 C;  2QTO A;  2CTR A;  2EIK C;  4ZKI A;  3TK1 A;  2F95 B;  4DV7 O;  4JI1 O;  3K3W A;  4GKJ B;  2IM9 A;  4QE9 A;  2Q67 A;  4DUY B;  2WLN A;  4GKK B;  1L8D A;  3DXR A;  1FFT B;  1JJO A;  3CXC U;  5LHH A;  2YS8 A;  1VEW A;  4MW8 A;  4CBC A;  3I55 V;  1MZE A;  1FJG O;  3ZRS A;  1FOU A;  1VQ5 V;  3B09 A;  5LL6 Y;  2ZM6 O;  1EN4 A;  3AK3 A;  5J2T A;  4D6T H;  4CS4 A;  2PZS A;  1Y74 A;  2WLH A;  3E2E A;  3OT7 A;  4DV3 O;  2QTS A;  4F6R A;  3JD4 A;  1K73 W;  5JJE B;  4JYB A;  3HR0 A;  4B3S B;  2DMX A;  2QWP B;  3UT5 A;  2IJJ A;  2D3O W;  1IBL O;  5LGT A;  1I5Y A;  1MSW D;  5CB4 B;  2XAQ A;  4DR3 B;  4J9Z B;  4EFE A;  1SQX H;  3CSX A;  2K9P A;  2IU0 A;  5B3S C;  5EIB C;  1H5W A;  4DR5 O;  1Q6U A;  2E5L B;  3HPL C;  5LMN B;  1S76 D;  3AG1 B;  3Q4H B;  2UXD B;  2LGQ A;  1EN6 A;  1LUW A;  4X20 A;  4WFG A;  1ZWI C;  3OTO O;  4DV6 B;  2CGN A;  5JH7 B;  1QVF U;  4FLV A;  4KL1 A;  3IAY A;  5KA5 A;  4NTX A;  3ASO B;  1YI2 V;  4O2A A;  2MK3 A;  4PDL A;  2FTK A;  4PA9 A;  1O9G A;  2WA4 A;  3W7S A;  1NT2 B;  1VF6 C;  4JYA O;  4DV0 O;  1H2S B;  4WFA V;  4QNH B;  1N33 O;  1K34 A;  2B5U A;  3W7W A;  3K5N A;  5IY5 C;  1S72 V;  1QLE C;  3DTU B;  1IBM O;  3SYP A;  4RQE A;  4GLX A;  3B4S A;  3ABL B;  2W6I G;  2Y0I A;  3SPJ A;  1BS3 A;  3A0B Z;  2FL4 A;  3OM3 B;  1WP8 A;  3D3Q A;  3ZRW A;  5B1B C;  3R65 A;  2DYS B;  4FLY A;  3C3T A;  1TA8 A;  1W2B U;  2ZIN A;  5L3E A;  4TV8 A;  2Q9L A;  1F23 A;  1IJG A;  1IXB A;  5KLV H;  1R73 A;  4RQF A;  1RP3 B;  1F7Y A;  4TT3 G;  3LUT B;  1FFX B;  1QBZ A;  4CC6 A;  1K9M W;  4Z1M G;  1XEQ A;  4KHP O;  3CS5 A;  3CCR V;  5B5E Z;  5IYZ B;  4W4L A;  2L35 A;  4X65 O;  3T2M A;  3T1Y O;  4YY3 O;  4LF8 B;  3STZ C;  3VQV A;  2ETN A;  3ZMU A;  4LF5 O;  4MVR A;  3KZI Z;  2W6J G;  2LQT A;  1SET A;  2YI8 A;  1GMG A;  4YHH O;  2WWW A;  2GHY A;  4X88 A;  1PNK A;  5CN0 A;  3E8F A;  4JTD B;  1LUV A;  5B1N A;  2OTJ V;  1XNQ O;  4JYC A;  2JK5 C;  4JI1 B;  2HR3 A;  4X66 O;  1PPJ H;  1WJZ A;  2P67 A;  2GV9 A;  1WB8 A;  3P30 A;  3VQY A;  5LGN A;  2ZNI A;  1Q3E A;  3APQ A;  1TUB A;  1FJG B;  2X7R B;  4QPJ A;  1R3I C;  3JAM N;  3EHB B;  2ZM6 B;  4GUN A;  2P5O A;  4QPK A;  3OE7 G;  4PEL A;  3W7X A;  2DOS A;  1U96 A;  3K5O A;  4JI5 O;  3D36 C;  1XL4 A;  1IBL B;  2EBO A;  1VQM V;  1SS3 A;  4O4H A;  1NBM G;  2MW2 B;  5FPO A;  4UB6 Z;  1AI4 A;  1GAX A;  5AG2 A;  2DYR C;  3SYA A;  4DO2 A;  1JPX A;  1MSD A;  2WLI A;  4UUJ C;  4BIZ A;  5DEC A;  1AI7 A;  2VS0 A;  2Q6A A;  3FD9 A;  3JYC A;  1US6 A;  2KB1 A;  2CK3 G;  3SYQ A;  2QA4 V;  2C2A A;  3P3N A;  4RUE A;  2GUZ B;  3J80 N;  1AR4 A;  2JGU A;  1N8R W;  5IYB O;  2ZXW B;  4O2B A;  3CME V;  5K1P A;  5H6R A;  1DK1 A;  3E8B A;  4KP4 A;  3G67 A;  4JYY A;  4DRX A;  3N27 A;  3OUS A;  4JYA B;  4DV0 B;  3R66 A;  3LDE A;  4YJ2 A;  3OTF A;  3AEI A;  3OEH G;  3B40 A;  3ZMT A;  1URF A;  3WB2 A;  3L73 H;  1M9N A;  4MVZ A;  3H1H H;  2OTL V;  2O57 A;  3E22 A;  4DW1 A;  2QWR B;  3CJH B;  1ZL8 A;  4YJ3 A;  3RYI B;  3L72 H;  3O65 A;  1MAB G;  1RFY A;  4MW3 A;  2QR4 A;  5LGU A;  1Y76 B;  2LP7 A;  4FPP A;  1RPO A;  2Q0A A;  2UXX A;  4GT1 A;  2JIZ G;  4CH4 A;  4EKW A;  1FXV A;  1V54 C;  5D5P A;  2QSA A;  4HNA B;  3ABM C;  2LJ2 A;  5B66 Z;  4MVM A;  4KHP B;  3CRR A;  3ZMS A;  1QQC A;  3BA8 A;  4X65 B;  3T1Y B;  5GON A;  4YY3 B;  1VQ4 V;  4BW5 A;  3RVZ A;  4JI3 O;  2JJ2 G;  5J2U A;  4R8C A;  5KHH A;  4DK1 A;  1HNW O;  4JI4 O;  1XMQ O;  1R3J C;  5E1A C;  1QHT A;  4TQF A;  1XHX A;  4YHH B;  4J10 A;  4DV1 O;  1XNQ B;  4LCU C;  1MMM A;  3CE2 A;  3N2G B;  2HP8 A;  2LW7 A;  2G38 A;  3DC6 A;  5B1A C;  2BCC H;  4X66 B;  1UFI A;  2BSK B;  1ZTE A;  1WAZ A;  1GN2 A;  2JGD B;  1WN7 A;  3JAT B;  5EYP B;  2HLD G;  1SQP H;  2Y69 C;  3CWB H;  4EB6 A;  1JFF A;  3AG4 C;  5A9G A;  2KG7 A;  3CYO A;  1O9H A;  3ABK B;  4P30 A;  4JI5 B;  1Q86 W;  3JAK B;  1M5I A;  5GW7 A;  5IYZ A;  1HP8 A;  2ODM A;  4MTF A;  4JI7 O;  1G1X B;  2LFS A;  1VF7 A;  1D2D A;  4HBN A;  3KCY A;  1Q8I A;  1PM9 A;  4YXW G;  4WCE V;  5IWA O;  4PDM A;  1OCZ C;  1YVW A;  4TOI A;  4ZHQ B;  2HVK C;  1RSO B;  4JTA B;  4G28 B;  4J11 A;  4O4I A;  4K0K O;  3A0H Z;  5FL7 G;  4I0X B;  3GWO A;  2OCC C;  5L3B A;  2EZO A;  4CH3 A;  1HNZ O;  3F5T A;  2UXN A;  3F7V C;  1VQP V;  4WFB V;  2AHZ A;  4GKJ O;  3ETG A;  4GKK O;  3MD0 A;  2OIE A;  1G8M A;  4MVS A;  4U3F H;  4TUY B;  4FVM A;  5KAF Z;  1YXB A;  2X0L A;  2V7Q G; 
#chains in the Genus database with same CATH homology
 1ZUQ A;  3AK2 A;  3MDS A;  3RN4 A;  1AP6 A;  1BS3 A;  1D5N A;  1KKC A;  1XRE A;  1EM1 A;  1I0H A;  5AG2 A;  3C3S A;  1MSD A;  2QKC A;  3C3T A;  1SZX A;  4F6E A;  1MMM A;  1QNM A;  3DC6 A;  1IXB A;  1VEW A;  1XUQ A;  2CE4 A;  1GN3 A;  1AR4 A;  2CDY A;  1ZTE A;  1GN4 A;  4YIO A;  1GN2 A;  2RCV A;  1N0J A;  1EN4 A;  3AK3 A;  3EVK A;  4JZ2 A;  1MNG A;  4FFK A;  4JYY A;  3IC9 A;  1AP5 A;  3OT7 A;  2QKA A;  3LSU A;  1B06 A;  1Y67 A;  5A9G A;  1BT8 A;  3CEI A;  4X9Q A;  1IDS A;  4JZG A;  3QVN A;  3KKY A;  1LUV A;  1IX9 A;  2ADQ B;  1MA1 A;  1PM9 A;  3BFR A;  1EN6 A;  1JR9 A;  1LUW A;  2ADP A;  1ZLZ A;  1I08 A;  1PL4 A;  1GN6 A;  2AW9 A;  1WB7 A;  1WB8 A;  3AK1 A;  1JA8 A;  2P4K A;  1EN5 A;  1BSM A;  3K9S A;  4YIP A;  1ZSP A;  1XIL A;  4C7U A;  1AR5 A;  1AVM A;  2GDS A;  1XDC A;  1P7G A;  3DC5 A;  4GUN A;  4BR6 A;  4E4E A;  1N0N A;  3KDR A;  1VAR A;  3TJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...