3DC5A

Crystal structure of a manganese superoxide dismutases from caenorhabditis elegans
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
194
structure length
194
Chain Sequence
KHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn] 2
publication title Purification, crystallization and X-ray structures of the two manganese superoxide dismutases from Caenorhabditis elegans
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 76
structure length 194
sequence length 194
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3dc5A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3dc5A02
3RN4A 1AR5A 3DC5A 1Y67A 4JYYA 1MNGA 2P4KA 1GN6A 2ADPA 1I08A 1MMMA 1SZXA 2RCVA 1B06A 3BFRA 1WB7A 1ZTEA 1VARA 1IX9A 1AR4A 1EM1A 1XILA 3QVNA 2QKCA 2CE4A 1I0HA 5A9GA 1EN5A 1EN4A 4YIOA 4C7UA 3AK2A 3C3SA 4F6EA 1BSMA 1D5NA 2AW9A 1BS3A 1IXBA 1ZUQA 1WB8A 2GDSA 1AP5A 3AK3A 1IDSA 1KKCA 3DC6A 3TJTA 1QNMA 1LUVA 2ADQB 1BT8A 3MDSA 1N0JA 2CDYA 1AVMA 1GN2A 1XUQA 1JA8A 5AG2A 1P7GA 1JR9A 3K9SA 1EN6A 1ZLZA 4BR6A 3IC9A 3CEIA 3C3TA 4JZGA 2QKAA 4JZ2A 1VEWA 3OT7A 1MA1A 3KKYA 4YIPA 4GUNA 3AK1A 1LUWA 1XDCA 1PL4A 1AP6A 4E4EA 1N0NA 3EVKA 1XREA 1ZSPA 3LSUA 1MSDA 4X9QA 1PM9A 1GN3A 1GN4A 4FFKA
chains in the Genus database with same CATH superfamily
1VIBA 2V4DA 4FJCC 1BE3H 2EZPA 5KA6A 3VQXA 2WLMA 3CC2V 2YICA 2E3CA 1Y74A 1B04A 1KP3A 1VQLV 4R7CA 4PD4F 3ZX6A 1E1QG 1NVPD 2EJRA 4CS3A 1TAEA 3J81N 2DYSB 3B8MA 1YCIA 2QWNB 1DTOA 4GKKO 4LF7B 1XILA 2Q69A 2XNDG 4TV8A 4LF4B 2BSKB 1M90W 1G4YB 1UFIA 3FKSG 5TISZ 1R73A 1XMQO 2P90A 5EYPA 3H1JH 2JVDA 2JJ1G 1H2SB 5GTHZ 3CCEV 3HB3B 4D7SA 2R9IA 3QO7A 3JAKA 1YTFB 4KXRA 5EZYA 2GDSA 3BAAA 5EBMC 4JI3O 2CUGA 1HNWO 4J7KA 1SQXH 2X6BA 5IJ9B 1QNMA 1KECA 5H5NA 1BT8A 2XHBA 1K3EA 2PYLA 1Q8IA 4X20B 3ZRWA 2XUMA 3ZHQA 1R6NA 1Y76A 3B40A 4B7KA 1NVPB 1XEQA 2LFSA 1DGSA 4MVRA 5LXTA 3JALA 1V55B 4KP4A 4K35A 4JZGA 1FJGB 5EBLC 2VQEB 4LF5O 4JI0B 4ZHQB 1US6A 4PHZA 1XQ8A 4LF8B 1F23A 2GHYA 3UKMA 2KQXA 1XREA 5JJJB 1ROPA 2WLIB 5E1AC 3OMNB 5J2UA 5IYCO 1JCHA 2LO1A 3G67A 2YIDA 1OCRB 5CA3A 5LMNB 2NR5A 3OAAG 5L3GA 1LR1A 2ITDC 3CMEV 5KHKA 3SR2C 1Q6UA 2P22C 5CBGA 1VF5B 1QLEC 3L71H 1AI4A 4GX0A 1DLBA 2DN9A 1WPXA 2QM4A 2PZSA 1KBHA 5IY5C 4MVQA 2QA4V 5FNVA 5KAIZ 3W7XA 4LWSB 5JJNB 3L74H 4AI8A 3B2EE 1YIJV 4J80A 4AHCA 1IVSA 1NTMH 1BQZA 3OGCC 1P84F 2EX3A 1WA8A 2Z0AA 2ZM6O 1W0KG 4ZKIA 1X59A 2YIAA 4MTFA 3SPIA 1N34O 4F6EA 3CRAA 3N2GA 1WAZA 4B3MO 5IE9A 4FPPA 2OCHA 1ZUQA 1OCZC 1PP9H 4I4TB 1HNZO 1CXZB 2N74A 5CB4B 2CK3G 3AK3A 1Z2GA 2CH7B 2IH3C 3JCZA 4MT8A 1WP7A 3G4SV 4U3JB 4J42A 1I94O 2ITCC 4HAMA 1H5WA 4DV3O 2ADQB 4F6RA 3ZMSA 1S0VA 3M7MX 1JQ0A 3OTOO 1EZJA 3JASB 1IJGA 4IIJB 4H37A 5IJ0A 2E5LB 4DUYO 3T4DA 1JX9A 4DRXB 1MZFA 1UJWB 1GM7A 1S3JA 3K0GA 4DV1O 1AP6A 4X1YB 3UT5B 4FLVA 4RUEA 1N0NA 3EVKA 1RM1C 2Q7EA 3RYIB 5J2TB 1K8AW 2YXYA 4QNHB 2UUBO 1PNMA 4BWAA 2X0LA 4DR1B 2DYRC 3RN4A 5IYZA 4DUZB 4UCRA 4CC6A 3CSXA 2Y0IA 3DC5A 5B1AB 5LMUB 4NTWA 5FPOA 4JYYA 3RGBA 2CGNA 5JH7A 3JYCA 1M56C 2YXHA 5FPRA 4JYAB 3ZS8C 1AR4A 4JV5B 2PTMA 5JJEB 3AG1B 1FD9A 2XAHA 1TUBB 4LF7O 2B1GA 4LF4O 2FKXA 2JEXA 3K06A 4L8JA 4XDJA 1S5JA 3Q4HA 3RW0A 4FK5C 2EIMC 2BSKA 3ASNC 4N21A 1H2MA 4UCUA 4PELA 2Q0AA 4LF6B 3ABKC 3LDEA 2QM8A 2JGUA 2Q0OC 4QPJA 3ZHRA 5LP6A 2GUZB 4JAUA 1IBKB 3TJTA 3E22B 1NTKH 4P30A 1B6QA 3AG4B 2JEUA 2LW1A 3MDSA 4GKJB 4U7NA 2Z5UA 1XUQA 1BHBA 2LGQA 1EBOA 2HG5C 5IDJA 1FS0G 3IC9A 2Q6AA 1GRJA 5IJ9A 2WLJA 4FZ0A 1VEWA 1BCCH 4CZZA 4X20A 2ZDIC 2QGNA 4MTXA 3O9OA 1KYOF 4X64B 1FJGO 4D7TA 1J5EB 2VQEO 2ZXWC 3JARA 4LF8O 3AG7A 1MG1A 3H1IH 3IGAC 1N32B 4FIPC 2EINC 5BXZA 1K5QA 5LGNA 3T1YB 2O57A 4DV2B 4JTDB 2A79B 2WLIA 5KHJA 5LMNO 3WG7C 3E89A 4QJFB 4DXWA 3F7VC 4IYIA 1S72V 2A3QA 2QM7A 2OTJV 4DV7B 3SDLA 1QU7A 1RFYA 4PA9A 4ABMA 5EC1C 2DJVA 3G6EV 4PA4A 2EULA 4UCVA 4H0LB 1I0HA 3UQ8A 1Q7YW 2UXNA 4NXNO 3AK2A 3OW2U 1QR9A 1GTOA 3G80A 4LWSA 5IWAB 4I9WA 1S5LZ 1NKDA 2JRIA 1HDJA 5LHGA 1VQ9V 4YHHB 1JNBA 1NH2D 2IH1C 1E79G 3CC7V 1KU9A 1O9HA 3CRQA 3ZJZA 4KL1A 4DV0B 1I7FA 4H33A 2R70A 2EIKB 3CC4V 1F4MA 2ZE7A 1OCCB 4I4TA 5GW7A 2P5OA 1AVMA 4MVZA 5CB4A 1GM8A 3RYHB 5KX5B 5K1XA 1AI7A 3JAWB 4NTXA 4WFHA 4U3JA 1OCOC 4G2KA 5BMVB 2CGOA 2RNBA 4TQFA 1H38A 3BPZA 3ETDA 1PNKA 3WU2Z 3CCRV 1AI5A 3RYCB 2E5LO 1QHTA 1OJHA 3K79A 2ZNJA 3SYPA 1WLEA 1AJPA 5KUMA 1ZAUA 3MHHC 2BTOA 1VF6A 3ABMC 2N04A 4CC5A 3AG3B 2YSUB 3EFFK 3FB8C 4DRXA 1KP2A 2Y4TA 2WLLB 1YXBA 4PDLA 1FKAO 3UT5A 1NH2B 1NR7A 2QWRB 1VQ5V 3VBBA 4DR1O 5LA6B 3RYIA 5J2TA 5J2UB 3CCVV 4DUZO 4I0XB 1XNRB 2Q9LA 1MMMA 2H3OA 2ZQMA 5LMUO 2Q7HA 1PV0A 1XI1A 4K0KB 2VS0A 1R3JC 1K9MW 1Y66A 3ZCCA 4JYAO 1BQ0A 3B09A 4EFBA 4W4LA 4DW1A 1IBLB 4JV5O 1W0JG 1OCRC 4Q6GA 1KD1W 1H8EG 3VQVA 1PPJH 3WB0A 1ZWIC 3GWOA 3SPHA 4X1KB 3DC6A 2OWOA 2PF4E 1GO3F 4O2BB 3T4ZA 4LF6O 3H01A 1N34B 1BL8A 1AJNA 3ASOC 3CWBH 1IBKO 1N0JA 1K4CC 1GN2A 1GMGA 3VQWA 1S5HC 2GUZA 3CXHF 4GKJO 1Q43A 5KMGB 1V54B 4CS2A 3E22A 4K3AA 2K9PA 1I94B 3OMAB 3L75H 4O4HB 4Z1MG 2JGDA 3I56V 2L6LA 2LGWA 1FFTB 1BGYH 2R9AA 3E86A 3HKCB 1LUWA 1K97A 2WWWA 3K58A 1XDCA 4JI2B 2Y69C 5JQGB 4J7ZA 4I5SA 1YHQV 4X64O 4UB8Z 1J5EO 3NXSA 2EZOA 4X1IB 3P30A 3ABLB 4TV9B 2PI4A 4DV4B 4WFBV 1QLNA 3TK1A 3CRCA 1X4TA 1M57C 3X2QB 3T1CA 1N32O 3DXRB 3SYCA 4FLTA 3UM7A 3FX7A 1SZXA 1P7BA 3T1YO 2UUBB 4DV2O 3CCQV 2ZD9A 1AR1B 4TUYB 2P4VA 2XTAA 3N2KB 4LCUC 1TA8A 1P4RA 4GZRB 5JH7B 4DV7O 2GTSA 4I50B 5EIBD 2A7WA 3OUFA 4K8XA 1FXKB 1R6TA 3AEIA 2LQTA 5B1AC 3AG2B 1FFXB 4QE9A 1SC5B 1H8HG 4DR6B 3Q4HB 3D3IA 3QG5A 4WFAV 5CA1B 5IWAO 4YHHO 2XAJA 1QVGU 5BY1A 3NR7A 4CH3A 5LP6B 1NS1A 4E2LA 1IXMA 2HKOA 4DV0O 2QE7G 3DTUB 2QJ1A 4MTGA 5J9PC 2RDCA 2EIJC 4MVSA 4BIUA 4H13B 2BCCH 3RYHA 2WA4A 2WAMA 4JAVA 2YI8A 5KX5A 3A0HZ 3AK1A 2DQ3A 3JAWA 4CH4A 4GLXA 5BMVA 3A8TA 4UXNA 1ZSPA 2BTQB 2IM9A 1H2LA 2RJZA 1SQVH 2XAFA 4LFCB 1GN3A 3ABTA 4KHPB 4X62B 1XL6A 5F2VO 2AGAA 3JARB 3RYCA 1MSWD 5IYBO 4TOIA 2QKSA 1M93A 1Y67A 4CS4A 3R65A 2P4KA 4NYKA 4FLYA 4BW9A 4DK0A 1XNRO 5EK0A 2WLLA 3D36C 5LA6A 4GCZA 3MAQA 3APQA 4I0XA 4J11A 3K57A 4K0KO 3ETEA 4FFBB 1Q5OA 5H6QA 3K5MA 1JOYA 2DQ0A 1IBLO 3CYOA 1BSMA 2F23A 1MOFA 1AP5A 2KG7B 3ETQA 1WPBA 3STLC 4Z2WA 5IT9N 3LUTB 4NTYA 3ZHVA 5GTIZ 4NXNB 2QWQB 5LOVA 1SQQH 1NBMG 4X1KA 5LL6Y 4O2BA 3A2FA 2FYUH 2QKAA 1QQCA 2E75B 3BY6A 5LHHA 2AXTZ 5D5QA 1D5AA 3S3XA 5L3EA 4WCEV 3JAMN 4X65B 1SKVA 2CTRA 3OD4A 1RSOA 3JD2A 4XBFA 5KMGA 1XL4A 4J9ZB 1UPGA 1DF5A 1MSDA 4O4HA 2HVKC 4JI2O 3SPJA 4CBCA 4JI1B 3OGIB 2DWDC 2UUAB 5B1BB 3HKCA 3VQYA 5L3FA 5JQGA 3HKDB 4DV4O 1GKFA 3UO2A 2RMKB 1MNGA 3SYAA 2CAZC 4FM1A 4X88A 1I08A 4X1IA 1CP9A 1B06A 4TV9A 3SYOA 2YEVA 1Y6XA 2ZCEA 3B77A 3R66A 4LR3A 4X66B 5B3SB 2X6CA 3DXRA 2X7RB 3QO5A 3AG3C 5KHGA 2QKCA 1SERA 4FZ1A 2EILB 4TUYA 2UUCB 1H2GA 1WJZA 3RFRA 3OR6C 5CA0B 3N2KA 3F5TA 4YIOA 4MTOA 3C3SA 4I7ZB 3ZHTA 1YSCA 4I50A 2KB1A 1FXKA 1XMOB 2FTKA 3OM3B 4BIZA 2RN9A 3HKBA 4DR6O 1FFXA 3LDDA 3LSQA 4HNAB 1HR0B 5LBQA 3UO3A 2EJ7A 1AROP 4UB6Z 3S3WA 1WP8A 1M4UA 3PN1A 4PDMA 5KHIA 4WF9V 2Q73A 3UCSC 3FD9A 3VOUA 5CA1A 2FMLA 1S77D 4DR3B 5CBHA 2FL4A 4RWUA 3ZMZA 1K33A 3E35A 3GVMA 4O2AB 2ETNA 1AILA 5KAFZ 4TT3G 2XAQA 3APOA 1R3KC 2BOBC 5GONB 3SJCC 3P32A 5DM6V 4OPHA 1SQBH 2JGDB 1FXVA 3IAYA 1VF7A 1HNXB 4YY3B 3FYEB 1L0LH 2C2AA 1VQMV 4J10A 1VQOV 3I55V 2OT5A 4LFCO 3RYFB 2CTWA 4KHPO 2MW2B 3U10A 4X62O 3HKEB 2BTQA 1FAFA 1ZL8B 1URFA 1ORQC 2MK3A 1N33B 3HR0A 1F7YA 4F4LA 5JCOA 3CB2A 3SJAC 1VARA 4PV1B 2ZT9B 3ABUA 3SJBC 3KG2A 3TCUA 4O4JB 5FLXN 3CD6V 5JWPA 4P9OA 1PKXA 4LH6A 1YJ9V 2CE4A 1KB9F 2ARHA 2OIGA 2F4VB 4AQYB 4JYCA 5LGTA 3ZN1A 4IL6Z 4G27B 2F95B 3EHBB 2M6YA 2D3OW 4FFBA 3BA8A 4WFFA 3K0DA 2UXDB 3LDCA 1OHHG 4H44B 1IDSA 2Q68A 4NXMB 2L35A 1JFFB 5B5EZ 2W0XA 3BEHA 1QLEB 2P6JA 2G38A 5IY5B 5JVDA 1WN7A 2KG7A 3SGIA 3ZN0A 4DV6B 1DF4A 4BR6A 3C3TA 2DYSC 2IJKA 4UCOA 3OUSA 5KUKA 3BA9A 3K5NA 4MS2A 3K5OA 3H1LH 3KCXA 3OEHG 3KKYA 3M8AA 5B1NA 2FB5A 3O65A 2H94A 1PL4A 1VQ7V 2UU9B 1OCZB 3CCSV 2UXXA 4X65O 5LP6C 1TUEB 3WB1A 1BHAA 3CPWU 1NT2B 1CEZA 1O9GA 5DN6G 4X8AA 3K59A 4MSWC 3J7AU 1VQ4V 4JI1O 1SETA 3J80N 1M1KW 2UUAO 1MZEA 3K04A 3BRCA 4UUJC 1Q82W 2RCVA 5EIBC 1SS3A 2ZE5A 1SESA 3HKDA 2IJJA 3ZMVA 3B4SA 3STZC 4CH5A 1V55C 2QTOA 2AHYA 3P3PA 4X66O 1RM1B 2ZKOA 4PJ0Z 5B66Z 1G8MA 1G6UA 3BHPA 3K9AA 1N36B 4ZI7A 2A9HA 1J95A 2UUCO 1D5NA 1JVMA 5KLVH 1E1RG 2WSSG 4PDVA 1IBMB 4NKGB 1K92A 4U7OA 3BABA 1VQ6V 5CA0A 1XMOO 3CS5A 1V9PA 1TGOA 1LUVA 4YJ2B 1M56B 4O4IB 4MW8A 3FB5C 1HR0O 4GX5A 4A5UB 3ZBHA 2HR3A 4P9PA 4DYLA 1ZLZA 2LP7A 4YXWG 4HNAA 5LOVB 2B9ZA 4FLUA 1THZA 1SQFA 4B3TB 3ZEDA 3ML0A 4DR3O 3OT7A 5C8YB 1MABG 2VWJA 4GUNA 1NI8A 1SQPH 3JD1A 2EIMB 2K1EA 2LJ2A 3ASNB 5LYJA 4NVPA 2Q5ZA 2DE0X 3ABKB 3WB2A 4O4LB 3D8CA 4O2AA 3MD0A 1RSOB 4RQFA 3CHXA 1HNXO 5GONA 4YY3O 3CCMV 4MVMA 2Y0PA 3TETA 2GV9A 2M7WA 4L87A 1JJOA 1L1FA 2ZR3A 3G71V 3L70H 5BZBA 3K5LA 1N33O 3RYFA 3OR7C 2UXBB 2OTLV 4U3FH 2AHZA 4OGQB 5HFMA 3CXCU 3HKEA 1ZL8A 3ZHUA 2YEVB 2ZXWB 2YXLA 5DECA 1I5XA 1VP7A 1EZVH 3CRRA 4JAAA 1VF6C 1T5EA 3K03A 4O4JA 4C7UA 4I55A 1FXHA 2EBOA 4P2ZA 3CX5F 3JD0A 3KCYA 2EINB 2F4VO 2ZE8A 4RUFA 1YJWV 4AQYO 1KUQA 2NNUA 3ZHSA 1B3QA 3BCCH 4LP8A 2NLJC 2GBOA 3WG7B 2F43G 2UXDO 5EBWC 3I5DA 4PA6A 4LH7A 4R8CA 4UCTA 4NXMO 3HKBB 2WLNA 3ICXA 4JI6B 5AG2A 1NTZH 1AJQA 5LHIA 1Q90D 2H8PC 5H6RA 1JFFA 2YC0A 3RT3C 1S76D 4GX1A 4R50A 3IJ4A 1VQPV 4JI8B 4DV6O 2JJ2G 1Q6HA 2RQ6A 4WBNA 3ZMTA 3AG1C 3GWKC 3A0BZ 4Z1VA 2BE3A 3C90A 2HP8A 3CRMA 1FOUA 1YTFD 2IJHA 4UCSA 3E8GA 2UU9O 2DMXA 4B08A 1I5YA 2IBZH 2Q4PA 2YIBA 4JGSA 1K34A 4D6TH 3W7SA 1WNSA 4MW3A 4JI4B 4PA3A 1NQTA 2IW5A 2DW4A 3F7YC 3HPLC 1OCOB 3OFNG 3T2MA 3AG4C 4KUMA 4JF3A 1IURA 4K8ZA 1GM9A 2W6IG 1PL0A 1Q3EA 2AZ2A 1EM1A 1P49A 3L73H 3E83A 2UXCB 4TQDA 1ZX3A 3K08A 1Y4MA 4EKWA 1N4CA 4LFAB 3ABMB 3CCLV 3WFVA 2VWKA 5C93A 2AW9A 1BS3A 2OCCB 1XBLA 1N36O 3RVYA 2PYJA 4PI0A 2WLKA 1IBMO 2QWPB 3CCJV 1KC8W 5KA5A 1GAXA 1OV9A 1YDXA 1XOUA 4QIWF 2YS8A 2X6AA 3FAVA 4B3RO 1PNLA 1OZ0A 4ZBMA 1QVFU 2XT9A 1EN6A 3QNEA 3OE7G 5BR8O 5JVDB 4YJ2A 4O4IA 1VQ8V 1KMIZ 1Q6IA 1MA1A 3TGUH 3M99B 2XAGA 4B3TO 4JASA 4LNUB 2P7TC 2Q7GA 1KQSU 4PI2A 2IU3A 2AZ0A 3JD4A 2Y4UA 5C8YA 3B8NA 3P3NA 5D5PA 1QBZA 1Z5VA 1AR5A 4AILC 3BVOA 3ASOB 2ODMA 4O4LA 3MHSC 4LBEC 3BFRA 3CCUV 2EIKC 1IX9A 1YZBA 1OCCC 1JJ2U 1IZ3A 2ZIOA 3FFQA 2V7QG 2HHHB 4DV5B 2UXBO 3E8FA 5L3CA 2NN4A 3QVNA 3N27A 1TVKB 2Y69B 1Q81W 1HW7A 4UVCA 5ITZB 3JATB 4RAIA 3W7UA 1K73W 4I9QA 3CMAV 4MVUA 2ZDIA 4BAYA 5CMUA 4W4KA 2JK5C 4B7EA 4YJ3B 1M57B 1IXBA 1M9NA 2XOKG 4R6ZA 3JD3A 4EB6B 5LGUA 4ZI7B 4DR2B 3SPGA 4UVBA 2A0LA 4HZ3A 3OTFA 3ZRXA 4FLWA 1ENVA 3H9VA 3RVZA 4JI6O 4N23A 4DR7B 4WFGA 4WFEA 3EXAA 1JPXA 1YJNV 3ZIAG 4LF9B 2BOCC 1RP3B 3F5WC 2YI9A 4QGPA 4YIPA 4JI8O 2W6JG 3A0RA 1QR8A 4ICGA 4DR5B 2F93B 3GB7C 1RPRA 1L0NH 3FB7C 4X9QA 4XDKA 4LFBB 1EFRG 1JMKC 2ZINA 5LYJB 1XNQB 4IHJB 3TXSA 2WPDG 4OX9B 4FLZA 2ILMA 2R9RB 4JTCB 1FYJA 2Z3YA 2JS3A 4RQEA 3RWRD 1F51A 4PA7A 2R72A 1SA0B 4RO2A 4JI4O 1W59A 3T1HB 3LSSA 4ZOLB 2EIJB 2PY5A 2GSMB 4B3SB 5CN0A 2HJFC 1V54C 5K1PA 4TSFG 5A9GA 5A2QN 4JI7B 2UXCO 3H1HH 5B1OA 2LFRA 3E8HA 4J7JA 4FMTA 5H9CA 4IGGA 3K3WA 5L3BA 1K4DC 2JS5A 1QCEA 3QF7A 4ASUG 3U11A 4LFAO 2QSAA 1WB8A 4I55B 3SYQA 4BW5A 3JCUZ 4NR1A 3CP1A 3OEEG 3ABLC 3H1KH 2KSDA 3CJHB 2JDIG 1BZKA 3SJQC 1SZTA 3X2QC 2YIBD 4ZIBA 4JI0O 2ZIMA 2N05A 2XASA 2F66C 2E76B 4DR4B 3KZIZ 4EEQA 3K9SA 3QTCA 4BIOA 2OYQA 4ZHQA 3DSQA 5EC2C 3PJSK 2VQFB 4CH6A 4QPKA 4JI5B 4UV8A 3DGEA 3SPCA 2Q67A 2OIEA 3JSNA 1SRYA 1Y74B 1FXKC 3OMIB 1Q86W 3LSUA 1R1BA 4WBNB 1GN4A 3AG2C 2B1IA 1F4NA 4J9YB 4IYHA 2ZR2A 4LNUA 3JSLA 3KDRA 1K5SA 4G28B 4FVMA 4TV8B 3W7TA 1GN6A 1YVWA 5E79Z 2ADPA 1GH6A 4MVOA 2QTSA 1HWYA 1D2DA 4GKKB 2Q8VA 1YF2A 1ZTEA 3LNNA 1FPOA 3G6BA 3IFXA 5EYPB 1VMGA 1W2BU 2B5UA 2ZNIA 2HVJC 1XHXA 2P06A 3ETGA 1XMQB 3CE2A 3JAKB 2HHHO 5EZYB 2V1DA 4TWKA 4GX2A 4DV5O 1EN4A 2IJIA 2CTPA 2Y48A 2KKWA 2CH7A 4JI3B 1SQGA 1HNWB 2HEPA 1TVKA 4JYBA 2F1MA 3E8BA 3ZRWB 5ITZA 1BMFG 3JATA 1Y76B 3TXQA 2QDOA 1KKCA 5LXTB 5JCOC 2A06H 1K7DA 3JALB 2DWEC 3JASA 4DR2O 5H2FZ 4YJ3A 4HBNA 4IIJA 2CDYA 4EB6A 2DOSA 2PGGA 3RBZA 1JR9A 2DYRB 4LF5B 3FAVB 2GTAA 2OCCC 3D3QA 1YI2V 4X1YA 2LW7A 2WLHA 4DR7O 4JTAB 1KKDA 3U0ZA 4B3RB 1R6KA 4LF9O 4JPRA 2QR4A 4FM0A 5CBFA 2CTQA 4IT5A 2HLDG 2HFEC 2PI5A 1U97A 1PM9A 4DR5O 1G1XB 4FFKA 4EFEA 5BR8B 3FB6C 1YITV 1PD3A 2QWOB 4QE7A 4LFBO 2ZE6A 1VQKV 1AI6A 3FYIB 5L3DA 1XNQO 2YDEA 5FNVB 1COWG 4HYOA 4OX9O 1CPYA 1WB7A 1A32A 1WA8B 4IHJA 2QEXV 1TUBA 4GT1A 4NB5A 3T1HO 3QO8A 4X89A 1Z5WA 1NR1A 3N2GB 3LNMB 1R3IC 2ZM6B 1VQNV 4UFZA 2ATKC 1SA0A 1H2NA 4FM2A 4B3SO 1EN5A 4ZOLA 1NJIW 4B3MB 2WA3A 1HNZB 1H2KA 1RPOA 4KFMA 5FL7G 1NU1H 4JI7O 4F6RB 3THOA 1YEWA 4OXSA 4DK1A 4DV3B 5IYDO 2JIZG 5HFLA 4J41A 3L9DA 5B1BC 5KHHA 5IJ0B 3W7WA 3OTOB 3E2EA 1L8DA 1R3LC 2D2CB 2YUAA 4DW0A 4XDLA 1HP8A 4UV9A 1DK1A 4FLXA 1JA8A 1GK9A 3L72H 1P7GA 1U96A 4LC1A 1NZ6A 1XHZA 5DEDA 3ZRSA 2E74B 4DUYB 1SF9A 3CEIA 3CJHA 2HJDA 1LNQA 4JZ2A 4PDRA 2IU0A 4DR4O 4DV1B 3D36A 2PUSA 3ZMUA 1M5IA 2VRZA 5B3SC 4GYCB 2P67A 4DO2A 5IYZB 1N8RW 2VQFO 1AB3A 3IC7A 4UVAA 3ZRVA 4JI5O 2EILC 4E4EA 4Q20A 2W0FC 4OPAA
chains in the Genus database with same CATH topology
3RN4A 1AR5A 3KDRA 3DC5A 1Y67A 4JYYA 1MNGA 2P4KA 1GN6A 2ADPA 1I08A 1MMMA 1SZXA 2RCVA 1B06A 3BFRA 1WB7A 1ZTEA 1VARA 1IX9A 1AR4A 1EM1A 1XILA 3QVNA 2QKCA 2CE4A 1I0HA 5A9GA 1EN5A 1EN4A 4YIOA 4C7UA 3AK2A 3C3SA 4F6EA 1BSMA 1D5NA 2AW9A 1BS3A 1IXBA 1ZUQA 1WB8A 2GDSA 1AP5A 3AK3A 1IDSA 1KKCA 3DC6A 3TJTA 1QNMA 1LUVA 2ADQB 1BT8A 3MDSA 1N0JA 2CDYA 1AVMA 1GN2A 1XUQA 1JA8A 5AG2A 1P7GA 1JR9A 3K9SA 1EN6A 1ZLZA 4BR6A 3IC9A 3CEIA 3C3TA 4JZGA 2QKAA 4JZ2A 1VEWA 3OT7A 1MA1A 3KKYA 4YIPA 4GUNA 3AK1A 1LUWA 1XDCA 1PL4A 1AP6A 4E4EA 1N0NA 3EVKA 1XREA 1ZSPA 3LSUA 1MSDA 4X9QA 1PM9A 1GN3A 1GN4A 4FFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN4 A;  1AR5 A;  3DC5 A;  1Y67 A;  4JYY A;  1MNG A;  2P4K A;  1GN6 A;  2ADP A;  1I08 A;  1MMM A;  1SZX A;  2RCV A;  1B06 A;  3BFR A;  1WB7 A;  1ZTE A;  1VAR A;  1IX9 A;  1AR4 A;  1EM1 A;  1XIL A;  3QVN A;  2QKC A;  2CE4 A;  1I0H A;  5A9G A;  1EN5 A;  1EN4 A;  4YIO A;  4C7U A;  3AK2 A;  3C3S A;  4F6E A;  1BSM A;  1D5N A;  2AW9 A;  1BS3 A;  1IXB A;  1ZUQ A;  1WB8 A;  2GDS A;  1AP5 A;  3AK3 A;  1IDS A;  1KKC A;  3DC6 A;  3TJT A;  1QNM A;  1LUV A;  2ADQ B;  1BT8 A;  3MDS A;  1N0J A;  2CDY A;  1AVM A;  1GN2 A;  1XUQ A;  1JA8 A;  5AG2 A;  1P7G A;  1JR9 A;  3K9S A;  1EN6 A;  1ZLZ A;  4BR6 A;  3IC9 A;  3CEI A;  3C3T A;  4JZG A;  2QKA A;  4JZ2 A;  1VEW A;  3OT7 A;  1MA1 A;  3KKY A;  4YIP A;  4GUN A;  3AK1 A;  1LUW A;  1XDC A;  1PL4 A;  1AP6 A;  4E4E A;  1N0N A;  3EVK A;  1XRE A;  1ZSP A;  3LSU A;  1MSD A;  4X9Q A;  1PM9 A;  1GN3 A;  1GN4 A;  4FFK A; 
#chains in the Genus database with same CATH topology
 1VIB A;  2V4D A;  4FJC C;  1BE3 H;  2EZP A;  5KA6 A;  3VQX A;  2WLM A;  3CC2 V;  2YIC A;  2E3C A;  1Y74 A;  1B04 A;  1KP3 A;  1VQL V;  4R7C A;  4PD4 F;  3ZX6 A;  1E1Q G;  1NVP D;  2EJR A;  4CS3 A;  1TAE A;  3J81 N;  2DYS B;  3B8M A;  1YCI A;  2QWN B;  1DTO A;  4GKK O;  4LF7 B;  1XIL A;  2Q69 A;  2XND G;  4TV8 A;  4LF4 B;  2BSK B;  1M90 W;  1G4Y B;  1UFI A;  3FKS G;  5TIS Z;  1R73 A;  1XMQ O;  2P90 A;  5EYP A;  3H1J H;  2JVD A;  2JJ1 G;  1H2S B;  5GTH Z;  3CCE V;  3HB3 B;  4D7S A;  2R9I A;  3QO7 A;  3JAK A;  1YTF B;  4KXR A;  5EZY A;  2GDS A;  3BAA A;  5EBM C;  4JI3 O;  2CUG A;  1HNW O;  4J7K A;  1SQX H;  2X6B A;  5IJ9 B;  1QNM A;  1KEC A;  5H5N A;  1BT8 A;  2XHB A;  1K3E A;  2PYL A;  1Q8I A;  4X20 B;  3ZRW A;  2XUM A;  3ZHQ A;  1R6N A;  1Y76 A;  3B40 A;  4B7K A;  1NVP B;  1XEQ A;  2LFS A;  1DGS A;  4MVR A;  5LXT A;  3JAL A;  1V55 B;  4KP4 A;  4K35 A;  4JZG A;  1FJG B;  5EBL C;  2VQE B;  4LF5 O;  4JI0 B;  4ZHQ B;  1US6 A;  4PHZ A;  1XQ8 A;  4LF8 B;  1F23 A;  2GHY A;  3UKM A;  2KQX A;  1XRE A;  5JJJ B;  1ROP A;  2WLI B;  5E1A C;  3OMN B;  5J2U A;  5IYC O;  1JCH A;  2LO1 A;  3G67 A;  2YID A;  1OCR B;  5CA3 A;  5LMN B;  2NR5 A;  3OAA G;  5L3G A;  1LR1 A;  2ITD C;  3CME V;  5KHK A;  3SR2 C;  1Q6U A;  2P22 C;  5CBG A;  1VF5 B;  1QLE C;  3L71 H;  1AI4 A;  4GX0 A;  1DLB A;  2DN9 A;  1WPX A;  2QM4 A;  2PZS A;  1KBH A;  5IY5 C;  4MVQ A;  2QA4 V;  5FNV A;  5KAI Z;  3W7X A;  4LWS B;  5JJN B;  3L74 H;  4AI8 A;  3B2E E;  1YIJ V;  4J80 A;  4AHC A;  1IVS A;  1NTM H;  1BQZ A;  3OGC C;  1P84 F;  2EX3 A;  1WA8 A;  2Z0A A;  2ZM6 O;  1W0K G;  4ZKI A;  1X59 A;  2YIA A;  4MTF A;  3SPI A;  1N34 O;  4F6E A;  3CRA A;  3N2G A;  1WAZ A;  4B3M O;  5IE9 A;  4FPP A;  2OCH A;  1ZUQ A;  1OCZ C;  1PP9 H;  4I4T B;  1HNZ O;  1CXZ B;  2N74 A;  5CB4 B;  2CK3 G;  3AK3 A;  1Z2G A;  2CH7 B;  2IH3 C;  3JCZ A;  4MT8 A;  1WP7 A;  3G4S V;  4U3J B;  4J42 A;  1I94 O;  2ITC C;  4HAM A;  1H5W A;  4DV3 O;  2ADQ B;  4F6R A;  3ZMS A;  1S0V A;  3M7M X;  1JQ0 A;  3OTO O;  1EZJ A;  3JAS B;  1IJG A;  4IIJ B;  4H37 A;  5IJ0 A;  2E5L B;  4DUY O;  3T4D A;  1JX9 A;  4DRX B;  1MZF A;  1UJW B;  1GM7 A;  1S3J A;  3K0G A;  4DV1 O;  1AP6 A;  4X1Y B;  3UT5 B;  4FLV A;  4RUE A;  1N0N A;  3EVK A;  1RM1 C;  2Q7E A;  3RYI B;  5J2T B;  1K8A W;  2YXY A;  4QNH B;  2UUB O;  1PNM A;  4BWA A;  2X0L A;  4DR1 B;  2DYR C;  3RN4 A;  5IYZ A;  4DUZ B;  4UCR A;  4CC6 A;  3CSX A;  2Y0I A;  3DC5 A;  5B1A B;  5LMU B;  4NTW A;  5FPO A;  4JYY A;  3RGB A;  2CGN A;  5JH7 A;  3JYC A;  1M56 C;  2YXH A;  5FPR A;  4JYA B;  3ZS8 C;  1AR4 A;  4JV5 B;  2PTM A;  5JJE B;  3AG1 B;  1FD9 A;  2XAH A;  1TUB B;  4LF7 O;  2B1G A;  4LF4 O;  2FKX A;  2JEX A;  3K06 A;  4L8J A;  4XDJ A;  1S5J A;  3Q4H A;  3RW0 A;  4FK5 C;  2EIM C;  2BSK A;  3ASN C;  4N21 A;  1H2M A;  4UCU A;  4PEL A;  2Q0A A;  4LF6 B;  3ABK C;  3LDE A;  2QM8 A;  2JGU A;  2Q0O C;  4QPJ A;  3ZHR A;  5LP6 A;  2GUZ B;  4JAU A;  1IBK B;  3TJT A;  3E22 B;  1NTK H;  4P30 A;  1B6Q A;  3AG4 B;  2JEU A;  2LW1 A;  3MDS A;  4GKJ B;  4U7N A;  2Z5U A;  1XUQ A;  1BHB A;  2LGQ A;  1EBO A;  2HG5 C;  5IDJ A;  1FS0 G;  3IC9 A;  2Q6A A;  1GRJ A;  5IJ9 A;  2WLJ A;  4FZ0 A;  1VEW A;  1BCC H;  4CZZ A;  4X20 A;  2ZDI C;  2QGN A;  4MTX A;  3O9O A;  1KYO F;  4X64 B;  1FJG O;  4D7T A;  1J5E B;  2VQE O;  2ZXW C;  3JAR A;  4LF8 O;  3AG7 A;  1MG1 A;  3H1I H;  3IGA C;  1N32 B;  4FIP C;  2EIN C;  5BXZ A;  1K5Q A;  5LGN A;  3T1Y B;  2O57 A;  4DV2 B;  4JTD B;  2A79 B;  2WLI A;  5KHJ A;  5LMN O;  3WG7 C;  3E89 A;  4QJF B;  4DXW A;  3F7V C;  4IYI A;  1S72 V;  2A3Q A;  2QM7 A;  2OTJ V;  4DV7 B;  3SDL A;  1QU7 A;  1RFY A;  4PA9 A;  4ABM A;  5EC1 C;  2DJV A;  3G6E V;  4PA4 A;  2EUL A;  4UCV A;  4H0L B;  1I0H A;  3UQ8 A;  1Q7Y W;  2UXN A;  4NXN O;  3AK2 A;  3OW2 U;  1QR9 A;  1GTO A;  3G80 A;  4LWS A;  5IWA B;  4I9W A;  1S5L Z;  1NKD A;  2JRI A;  1HDJ A;  5LHG A;  1VQ9 V;  4YHH B;  1JNB A;  1NH2 D;  2IH1 C;  1E79 G;  3CC7 V;  1KU9 A;  1O9H A;  3CRQ A;  3ZJZ A;  4KL1 A;  4DV0 B;  1I7F A;  4H33 A;  2R70 A;  2EIK B;  3CC4 V;  1F4M A;  2ZE7 A;  1OCC B;  4I4T A;  5GW7 A;  2P5O A;  1AVM A;  4MVZ A;  5CB4 A;  1GM8 A;  3RYH B;  5KX5 B;  5K1X A;  1AI7 A;  3JAW B;  4NTX A;  4WFH A;  4U3J A;  1OCO C;  4G2K A;  5BMV B;  2CGO A;  2RNB A;  4TQF A;  1H38 A;  3BPZ A;  3ETD A;  1PNK A;  3WU2 Z;  3CCR V;  1AI5 A;  3RYC B;  2E5L O;  1QHT A;  1OJH A;  3K79 A;  2ZNJ A;  3SYP A;  1WLE A;  1AJP A;  5KUM A;  1ZAU A;  3MHH C;  2BTO A;  1VF6 A;  3ABM C;  2N04 A;  4CC5 A;  3AG3 B;  2YSU B;  3EFF K;  3FB8 C;  4DRX A;  1KP2 A;  2Y4T A;  2WLL B;  1YXB A;  4PDL A;  1FKA O;  3UT5 A;  1NH2 B;  1NR7 A;  2QWR B;  1VQ5 V;  3VBB A;  4DR1 O;  5LA6 B;  3RYI A;  5J2T A;  5J2U B;  3CCV V;  4DUZ O;  4I0X B;  1XNR B;  2Q9L A;  1MMM A;  2H3O A;  2ZQM A;  5LMU O;  2Q7H A;  1PV0 A;  1XI1 A;  4K0K B;  2VS0 A;  1R3J C;  1K9M W;  1Y66 A;  3ZCC A;  4JYA O;  1BQ0 A;  3B09 A;  4EFB A;  4W4L A;  4DW1 A;  1IBL B;  4JV5 O;  1W0J G;  1OCR C;  4Q6G A;  1KD1 W;  1H8E G;  3VQV A;  1PPJ H;  3WB0 A;  1ZWI C;  3GWO A;  3SPH A;  4X1K B;  3DC6 A;  2OWO A;  2PF4 E;  1GO3 F;  4O2B B;  3T4Z A;  4LF6 O;  3H01 A;  1N34 B;  1BL8 A;  1AJN A;  3ASO C;  3CWB H;  1IBK O;  1N0J A;  1K4C C;  1GN2 A;  1GMG A;  3VQW A;  1S5H C;  2GUZ A;  3CXH F;  4GKJ O;  1Q43 A;  5KMG B;  1V54 B;  4CS2 A;  3E22 A;  4K3A A;  2K9P A;  1I94 B;  3OMA B;  3L75 H;  4O4H B;  4Z1M G;  2JGD A;  3I56 V;  2L6L A;  2LGW A;  1FFT B;  1BGY H;  2R9A A;  3E86 A;  3HKC B;  1LUW A;  1K97 A;  2WWW A;  3K58 A;  1XDC A;  4JI2 B;  2Y69 C;  5JQG B;  4J7Z A;  4I5S A;  1YHQ V;  4X64 O;  4UB8 Z;  1J5E O;  3NXS A;  2EZO A;  4X1I B;  3P30 A;  3ABL B;  4TV9 B;  2PI4 A;  4DV4 B;  4WFB V;  1QLN A;  3TK1 A;  3CRC A;  1X4T A;  1M57 C;  3X2Q B;  3T1C A;  1N32 O;  3DXR B;  3SYC A;  4FLT A;  3UM7 A;  3FX7 A;  1SZX A;  1P7B A;  3T1Y O;  2UUB B;  4DV2 O;  3CCQ V;  2ZD9 A;  1AR1 B;  4TUY B;  2P4V A;  2XTA A;  3N2K B;  4LCU C;  1TA8 A;  1P4R A;  4GZR B;  5JH7 B;  4DV7 O;  2GTS A;  4I50 B;  5EIB D;  2A7W A;  3OUF A;  4K8X A;  1FXK B;  1R6T A;  3AEI A;  2LQT A;  5B1A C;  3AG2 B;  1FFX B;  4QE9 A;  1SC5 B;  1H8H G;  4DR6 B;  3Q4H B;  3D3I A;  3QG5 A;  4WFA V;  5CA1 B;  5IWA O;  4YHH O;  2XAJ A;  1QVG U;  5BY1 A;  3NR7 A;  4CH3 A;  5LP6 B;  1NS1 A;  4E2L A;  1IXM A;  2HKO A;  4DV0 O;  2QE7 G;  3DTU B;  2QJ1 A;  4MTG A;  5J9P C;  2RDC A;  2EIJ C;  4MVS A;  4BIU A;  4H13 B;  2BCC H;  3RYH A;  2WA4 A;  2WAM A;  4JAV A;  2YI8 A;  5KX5 A;  3A0H Z;  3AK1 A;  2DQ3 A;  3JAW A;  4CH4 A;  4GLX A;  5BMV A;  3A8T A;  4UXN A;  1ZSP A;  2BTQ B;  2IM9 A;  1H2L A;  2RJZ A;  1SQV H;  2XAF A;  4LFC B;  1GN3 A;  3ABT A;  4KHP B;  4X62 B;  1XL6 A;  5F2V O;  2AGA A;  3JAR B;  3RYC A;  1MSW D;  5IYB O;  4TOI A;  2QKS A;  1M93 A;  1Y67 A;  4CS4 A;  3R65 A;  2P4K A;  4NYK A;  4FLY A;  4BW9 A;  4DK0 A;  1XNR O;  5EK0 A;  2WLL A;  3D36 C;  5LA6 A;  4GCZ A;  3MAQ A;  3APQ A;  4I0X A;  4J11 A;  3K57 A;  4K0K O;  3ETE A;  4FFB B;  1Q5O A;  5H6Q A;  3K5M A;  1JOY A;  2DQ0 A;  1IBL O;  3CYO A;  1BSM A;  2F23 A;  1MOF A;  1AP5 A;  2KG7 B;  3ETQ A;  1WPB A;  3STL C;  4Z2W A;  5IT9 N;  3LUT B;  4NTY A;  3ZHV A;  5GTI Z;  4NXN B;  2QWQ B;  5LOV A;  1SQQ H;  1NBM G;  4X1K A;  5LL6 Y;  4O2B A;  3A2F A;  2FYU H;  2QKA A;  1QQC A;  2E75 B;  3BY6 A;  5LHH A;  2AXT Z;  5D5Q A;  1D5A A;  3S3X A;  5L3E A;  4WCE V;  3JAM N;  4X65 B;  1SKV A;  2CTR A;  3OD4 A;  1RSO A;  3JD2 A;  4XBF A;  5KMG A;  1XL4 A;  4J9Z B;  1UPG A;  1DF5 A;  1MSD A;  4O4H A;  2HVK C;  4JI2 O;  3SPJ A;  4CBC A;  4JI1 B;  3OGI B;  2DWD C;  2UUA B;  5B1B B;  3HKC A;  3VQY A;  5L3F A;  5JQG A;  3HKD B;  4DV4 O;  1GKF A;  3UO2 A;  2RMK B;  1MNG A;  3SYA A;  2CAZ C;  4FM1 A;  4X88 A;  1I08 A;  4X1I A;  1CP9 A;  1B06 A;  4TV9 A;  3SYO A;  2YEV A;  1Y6X A;  2ZCE A;  3B77 A;  3R66 A;  4LR3 A;  4X66 B;  5B3S B;  2X6C A;  3DXR A;  2X7R B;  3QO5 A;  3AG3 C;  5KHG A;  2QKC A;  1SER A;  4FZ1 A;  2EIL B;  4TUY A;  2UUC B;  1H2G A;  1WJZ A;  3RFR A;  3OR6 C;  5CA0 B;  3N2K A;  3F5T A;  4YIO A;  4MTO A;  3C3S A;  4I7Z B;  3ZHT A;  1YSC A;  4I50 A;  2KB1 A;  1FXK A;  1XMO B;  2FTK A;  3OM3 B;  4BIZ A;  2RN9 A;  3HKB A;  4DR6 O;  1FFX A;  3LDD A;  3LSQ A;  4HNA B;  1HR0 B;  5LBQ A;  3UO3 A;  2EJ7 A;  1ARO P;  4UB6 Z;  3S3W A;  1WP8 A;  1M4U A;  3PN1 A;  4PDM A;  5KHI A;  4WF9 V;  2Q73 A;  3UCS C;  3FD9 A;  3VOU A;  5CA1 A;  2FML A;  1S77 D;  4DR3 B;  5CBH A;  2FL4 A;  4RWU A;  3ZMZ A;  1K33 A;  3E35 A;  3GVM A;  4O2A B;  2ETN A;  1AIL A;  5KAF Z;  4TT3 G;  2XAQ A;  3APO A;  1R3K C;  2BOB C;  5GON B;  3SJC C;  3P32 A;  5DM6 V;  4OPH A;  1SQB H;  2JGD B;  1FXV A;  3IAY A;  1VF7 A;  1HNX B;  4YY3 B;  3FYE B;  1L0L H;  2C2A A;  1VQM V;  4J10 A;  1VQO V;  3I55 V;  2OT5 A;  4LFC O;  3RYF B;  2CTW A;  4KHP O;  2MW2 B;  3U10 A;  4X62 O;  3HKE B;  2BTQ A;  1FAF A;  1ZL8 B;  1URF A;  1ORQ C;  2MK3 A;  1N33 B;  3HR0 A;  1F7Y A;  4F4L A;  5JCO A;  3CB2 A;  3SJA C;  1VAR A;  4PV1 B;  2ZT9 B;  3ABU A;  3SJB C;  3KG2 A;  3TCU A;  4O4J B;  5FLX N;  3CD6 V;  5JWP A;  4P9O A;  1PKX A;  4LH6 A;  1YJ9 V;  2CE4 A;  1KB9 F;  2ARH A;  2OIG A;  2F4V B;  4AQY B;  4JYC A;  5LGT A;  3ZN1 A;  4IL6 Z;  4G27 B;  2F95 B;  3EHB B;  2M6Y A;  2D3O W;  4FFB A;  3BA8 A;  4WFF A;  3K0D A;  2UXD B;  3LDC A;  1OHH G;  4H44 B;  1IDS A;  2Q68 A;  4NXM B;  2L35 A;  1JFF B;  5B5E Z;  2W0X A;  3BEH A;  1QLE B;  2P6J A;  2G38 A;  5IY5 B;  5JVD A;  1WN7 A;  2KG7 A;  3SGI A;  3ZN0 A;  4DV6 B;  1DF4 A;  4BR6 A;  3C3T A;  2DYS C;  2IJK A;  4UCO A;  3OUS A;  5KUK A;  3BA9 A;  3K5N A;  4MS2 A;  3K5O A;  3H1L H;  3KCX A;  3OEH G;  3KKY A;  3M8A A;  5B1N A;  2FB5 A;  3O65 A;  2H94 A;  1PL4 A;  1VQ7 V;  2UU9 B;  1OCZ B;  3CCS V;  2UXX A;  4X65 O;  5LP6 C;  1TUE B;  3WB1 A;  1BHA A;  3CPW U;  1NT2 B;  1CEZ A;  1O9G A;  5DN6 G;  4X8A A;  3K59 A;  4MSW C;  3J7A U;  1VQ4 V;  4JI1 O;  1SET A;  3J80 N;  1M1K W;  2UUA O;  1MZE A;  3K04 A;  3BRC A;  4UUJ C;  1Q82 W;  2RCV A;  5EIB C;  1SS3 A;  2ZE5 A;  1SES A;  3HKD A;  2IJJ A;  3ZMV A;  3B4S A;  3STZ C;  4CH5 A;  1V55 C;  2QTO A;  2AHY A;  3P3P A;  4X66 O;  1RM1 B;  2ZKO A;  4PJ0 Z;  5B66 Z;  1G8M A;  1G6U A;  3BHP A;  3K9A A;  1N36 B;  4ZI7 A;  2A9H A;  1J95 A;  2UUC O;  1D5N A;  1JVM A;  5KLV H;  1E1R G;  2WSS G;  4PDV A;  1IBM B;  4NKG B;  1K92 A;  4U7O A;  3BAB A;  1VQ6 V;  5CA0 A;  1XMO O;  3CS5 A;  1V9P A;  1TGO A;  1LUV A;  4YJ2 B;  1M56 B;  4O4I B;  4MW8 A;  3FB5 C;  1HR0 O;  4GX5 A;  4A5U B;  3ZBH A;  2HR3 A;  4P9P A;  4DYL A;  1ZLZ A;  2LP7 A;  4YXW G;  4HNA A;  5LOV B;  2B9Z A;  4FLU A;  1THZ A;  1SQF A;  4B3T B;  3ZED A;  3ML0 A;  4DR3 O;  3OT7 A;  5C8Y B;  1MAB G;  2VWJ A;  4GUN A;  1NI8 A;  1SQP H;  3JD1 A;  2EIM B;  2K1E A;  2LJ2 A;  3ASN B;  5LYJ A;  4NVP A;  2Q5Z A;  2DE0 X;  3ABK B;  3WB2 A;  4O4L B;  3D8C A;  4O2A A;  3MD0 A;  1RSO B;  4RQF A;  3CHX A;  1HNX O;  5GON A;  4YY3 O;  3CCM V;  4MVM A;  2Y0P A;  3TET A;  2GV9 A;  2M7W A;  4L87 A;  1JJO A;  1L1F A;  2ZR3 A;  3G71 V;  3L70 H;  5BZB A;  3K5L A;  1N33 O;  3RYF A;  3OR7 C;  2UXB B;  2OTL V;  4U3F H;  2AHZ A;  4OGQ B;  5HFM A;  3CXC U;  3HKE A;  1ZL8 A;  3ZHU A;  2YEV B;  2ZXW B;  2YXL A;  5DEC A;  1I5X A;  1VP7 A;  1EZV H;  3CRR A;  4JAA A;  1VF6 C;  1T5E A;  3K03 A;  4O4J A;  4C7U A;  4I55 A;  1FXH A;  2EBO A;  4P2Z A;  3CX5 F;  3JD0 A;  3KCY A;  2EIN B;  2F4V O;  2ZE8 A;  4RUF A;  1YJW V;  4AQY O;  1KUQ A;  2NNU A;  3ZHS A;  1B3Q A;  3BCC H;  4LP8 A;  2NLJ C;  2GBO A;  3WG7 B;  2F43 G;  2UXD O;  5EBW C;  3I5D A;  4PA6 A;  4LH7 A;  4R8C A;  4UCT A;  4NXM O;  3HKB B;  2WLN A;  3ICX A;  4JI6 B;  5AG2 A;  1NTZ H;  1AJQ A;  5LHI A;  1Q90 D;  2H8P C;  5H6R A;  1JFF A;  2YC0 A;  3RT3 C;  1S76 D;  4GX1 A;  4R50 A;  3IJ4 A;  1VQP V;  4JI8 B;  4DV6 O;  2JJ2 G;  1Q6H A;  2RQ6 A;  4WBN A;  3ZMT A;  3AG1 C;  3GWK C;  3A0B Z;  4Z1V A;  2BE3 A;  3C90 A;  2HP8 A;  3CRM A;  1FOU A;  1YTF D;  2IJH A;  4UCS A;  3E8G A;  2UU9 O;  2DMX A;  4B08 A;  1I5Y A;  2IBZ H;  2Q4P A;  2YIB A;  4JGS A;  1K34 A;  4D6T H;  3W7S A;  1WNS A;  4MW3 A;  4JI4 B;  4PA3 A;  1NQT A;  2IW5 A;  2DW4 A;  3F7Y C;  3HPL C;  1OCO B;  3OFN G;  3T2M A;  3AG4 C;  4KUM A;  4JF3 A;  1IUR A;  4K8Z A;  1GM9 A;  2W6I G;  1PL0 A;  1Q3E A;  2AZ2 A;  1EM1 A;  1P49 A;  3L73 H;  3E83 A;  2UXC B;  4TQD A;  1ZX3 A;  3K08 A;  1Y4M A;  4EKW A;  1N4C A;  4LFA B;  3ABM B;  3CCL V;  3WFV A;  2VWK A;  5C93 A;  2AW9 A;  1BS3 A;  2OCC B;  1XBL A;  1N36 O;  3RVY A;  2PYJ A;  4PI0 A;  2WLK A;  1IBM O;  2QWP B;  3CCJ V;  1KC8 W;  5KA5 A;  1GAX A;  1OV9 A;  1YDX A;  1XOU A;  4QIW F;  2YS8 A;  2X6A A;  3FAV A;  4B3R O;  1PNL A;  1OZ0 A;  4ZBM A;  1QVF U;  2XT9 A;  1EN6 A;  3QNE A;  3OE7 G;  5BR8 O;  5JVD B;  4YJ2 A;  4O4I A;  1VQ8 V;  1KMI Z;  1Q6I A;  1MA1 A;  3TGU H;  3M99 B;  2XAG A;  4B3T O;  4JAS A;  4LNU B;  2P7T C;  2Q7G A;  1KQS U;  4PI2 A;  2IU3 A;  2AZ0 A;  3JD4 A;  2Y4U A;  5C8Y A;  3B8N A;  3P3N A;  5D5P A;  1QBZ A;  1Z5V A;  1AR5 A;  4AIL C;  3BVO A;  3ASO B;  2ODM A;  4O4L A;  3MHS C;  4LBE C;  3BFR A;  3CCU V;  2EIK C;  1IX9 A;  1YZB A;  1OCC C;  1JJ2 U;  1IZ3 A;  2ZIO A;  3FFQ A;  2V7Q G;  2HHH B;  4DV5 B;  2UXB O;  3E8F A;  5L3C A;  2NN4 A;  3QVN A;  3N27 A;  1TVK B;  2Y69 B;  1Q81 W;  1HW7 A;  4UVC A;  5ITZ B;  3JAT B;  4RAI A;  3W7U A;  1K73 W;  4I9Q A;  3CMA V;  4MVU A;  2ZDI A;  4BAY A;  5CMU A;  4W4K A;  2JK5 C;  4B7E A;  4YJ3 B;  1M57 B;  1IXB A;  1M9N A;  2XOK G;  4R6Z A;  3JD3 A;  4EB6 B;  5LGU A;  4ZI7 B;  4DR2 B;  3SPG A;  4UVB A;  2A0L A;  4HZ3 A;  3OTF A;  3ZRX A;  4FLW A;  1ENV A;  3H9V A;  3RVZ A;  4JI6 O;  4N23 A;  4DR7 B;  4WFG A;  4WFE A;  3EXA A;  1JPX A;  1YJN V;  3ZIA G;  4LF9 B;  2BOC C;  1RP3 B;  3F5W C;  2YI9 A;  4QGP A;  4YIP A;  4JI8 O;  2W6J G;  3A0R A;  1QR8 A;  4ICG A;  4DR5 B;  2F93 B;  3GB7 C;  1RPR A;  1L0N H;  3FB7 C;  4X9Q A;  4XDK A;  4LFB B;  1EFR G;  1JMK C;  2ZIN A;  5LYJ B;  1XNQ B;  4IHJ B;  3TXS A;  2WPD G;  4OX9 B;  4FLZ A;  2ILM A;  2R9R B;  4JTC B;  1FYJ A;  2Z3Y A;  2JS3 A;  4RQE A;  3RWR D;  1F51 A;  4PA7 A;  2R72 A;  1SA0 B;  4RO2 A;  4JI4 O;  1W59 A;  3T1H B;  3LSS A;  4ZOL B;  2EIJ B;  2PY5 A;  2GSM B;  4B3S B;  5CN0 A;  2HJF C;  1V54 C;  5K1P A;  4TSF G;  5A9G A;  5A2Q N;  4JI7 B;  2UXC O;  3H1H H;  5B1O A;  2LFR A;  3E8H A;  4J7J A;  4FMT A;  5H9C A;  4IGG A;  3K3W A;  5L3B A;  1K4D C;  2JS5 A;  1QCE A;  3QF7 A;  4ASU G;  3U11 A;  4LFA O;  2QSA A;  1WB8 A;  4I55 B;  3SYQ A;  4BW5 A;  3JCU Z;  4NR1 A;  3CP1 A;  3OEE G;  3ABL C;  3H1K H;  2KSD A;  3CJH B;  2JDI G;  1BZK A;  3SJQ C;  1SZT A;  3X2Q C;  2YIB D;  4ZIB A;  4JI0 O;  2ZIM A;  2N05 A;  2XAS A;  2F66 C;  2E76 B;  4DR4 B;  3KZI Z;  4EEQ A;  3K9S A;  3QTC A;  4BIO A;  2OYQ A;  4ZHQ A;  3DSQ A;  5EC2 C;  3PJS K;  2VQF B;  4CH6 A;  4QPK A;  4JI5 B;  4UV8 A;  3DGE A;  3SPC A;  2Q67 A;  2OIE A;  3JSN A;  1SRY A;  1Y74 B;  1FXK C;  3OMI B;  1Q86 W;  3LSU A;  1R1B A;  4WBN B;  1GN4 A;  3AG2 C;  2B1I A;  1F4N A;  4J9Y B;  4IYH A;  2ZR2 A;  4LNU A;  3JSL A;  3KDR A;  1K5S A;  4G28 B;  4FVM A;  4TV8 B;  3W7T A;  1GN6 A;  1YVW A;  5E79 Z;  2ADP A;  1GH6 A;  4MVO A;  2QTS A;  1HWY A;  1D2D A;  4GKK B;  2Q8V A;  1YF2 A;  1ZTE A;  3LNN A;  1FPO A;  3G6B A;  3IFX A;  5EYP B;  1VMG A;  1W2B U;  2B5U A;  2ZNI A;  2HVJ C;  1XHX A;  2P06 A;  3ETG A;  1XMQ B;  3CE2 A;  3JAK B;  2HHH O;  5EZY B;  2V1D A;  4TWK A;  4GX2 A;  4DV5 O;  1EN4 A;  2IJI A;  2CTP A;  2Y48 A;  2KKW A;  2CH7 A;  4JI3 B;  1SQG A;  1HNW B;  2HEP A;  1TVK A;  4JYB A;  2F1M A;  3E8B A;  3ZRW B;  5ITZ A;  1BMF G;  3JAT A;  1Y76 B;  3TXQ A;  2QDO A;  1KKC A;  5LXT B;  5JCO C;  2A06 H;  1K7D A;  3JAL B;  2DWE C;  3JAS A;  4DR2 O;  5H2F Z;  4YJ3 A;  4HBN A;  4IIJ A;  2CDY A;  4EB6 A;  2DOS A;  2PGG A;  3RBZ A;  1JR9 A;  2DYR B;  4LF5 B;  3FAV B;  2GTA A;  2OCC C;  3D3Q A;  1YI2 V;  4X1Y A;  2LW7 A;  2WLH A;  4DR7 O;  4JTA B;  1KKD A;  3U0Z A;  4B3R B;  1R6K A;  4LF9 O;  4JPR A;  2QR4 A;  4FM0 A;  5CBF A;  2CTQ A;  4IT5 A;  2HLD G;  2HFE C;  2PI5 A;  1U97 A;  1PM9 A;  4DR5 O;  1G1X B;  4FFK A;  4EFE A;  5BR8 B;  3FB6 C;  1YIT V;  1PD3 A;  2QWO B;  4QE7 A;  4LFB O;  2ZE6 A;  1VQK V;  1AI6 A;  3FYI B;  5L3D A;  1XNQ O;  2YDE A;  5FNV B;  1COW G;  4HYO A;  4OX9 O;  1CPY A;  1WB7 A;  1A32 A;  1WA8 B;  4IHJ A;  2QEX V;  1TUB A;  4GT1 A;  4NB5 A;  3T1H O;  3QO8 A;  4X89 A;  1Z5W A;  1NR1 A;  3N2G B;  3LNM B;  1R3I C;  2ZM6 B;  1VQN V;  4UFZ A;  2ATK C;  1SA0 A;  1H2N A;  4FM2 A;  4B3S O;  1EN5 A;  4ZOL A;  1NJI W;  4B3M B;  2WA3 A;  1HNZ B;  1H2K A;  1RPO A;  4KFM A;  5FL7 G;  1NU1 H;  4JI7 O;  4F6R B;  3THO A;  1YEW A;  4OXS A;  4DK1 A;  4DV3 B;  5IYD O;  2JIZ G;  5HFL A;  4J41 A;  3L9D A;  5B1B C;  5KHH A;  5IJ0 B;  3W7W A;  3OTO B;  3E2E A;  1L8D A;  1R3L C;  2D2C B;  2YUA A;  4DW0 A;  4XDL A;  1HP8 A;  4UV9 A;  1DK1 A;  4FLX A;  1JA8 A;  1GK9 A;  3L72 H;  1P7G A;  1U96 A;  4LC1 A;  1NZ6 A;  1XHZ A;  5DED A;  3ZRS A;  2E74 B;  4DUY B;  1SF9 A;  3CEI A;  3CJH A;  2HJD A;  1LNQ A;  4JZ2 A;  4PDR A;  2IU0 A;  4DR4 O;  4DV1 B;  3D36 A;  2PUS A;  3ZMU A;  1M5I A;  2VRZ A;  5B3S C;  4GYC B;  2P67 A;  4DO2 A;  5IYZ B;  1N8R W;  2VQF O;  1AB3 A;  3IC7 A;  4UVA A;  3ZRV A;  4JI5 O;  2EIL C;  4E4E A;  4Q20 A;  2W0F C;  4OPA A; 
#chains in the Genus database with same CATH homology
 3RN4 A;  1AR5 A;  3KDR A;  3DC5 A;  1Y67 A;  4JYY A;  1MNG A;  2P4K A;  1GN6 A;  2ADP A;  1I08 A;  1MMM A;  1SZX A;  2RCV A;  1B06 A;  3BFR A;  1WB7 A;  1ZTE A;  1VAR A;  1IX9 A;  1AR4 A;  1EM1 A;  1XIL A;  3QVN A;  2QKC A;  2CE4 A;  1I0H A;  5A9G A;  1EN5 A;  1EN4 A;  4YIO A;  4C7U A;  3AK2 A;  3C3S A;  4F6E A;  1BSM A;  1D5N A;  2AW9 A;  1BS3 A;  1IXB A;  1ZUQ A;  1WB8 A;  2GDS A;  1AP5 A;  3AK3 A;  1IDS A;  1KKC A;  3DC6 A;  3TJT A;  1QNM A;  1LUV A;  2ADQ B;  1BT8 A;  3MDS A;  1N0J A;  2CDY A;  1AVM A;  1GN2 A;  1XUQ A;  1JA8 A;  5AG2 A;  1P7G A;  1JR9 A;  3K9S A;  1EN6 A;  1ZLZ A;  4BR6 A;  3IC9 A;  3CEI A;  3C3T A;  4JZG A;  2QKA A;  4JZ2 A;  1VEW A;  3OT7 A;  1MA1 A;  3KKY A;  4YIP A;  4GUN A;  3AK1 A;  1LUW A;  1XDC A;  1PL4 A;  1AP6 A;  4E4E A;  1N0N A;  3EVK A;  1XRE A;  1ZSP A;  3LSU A;  1MSD A;  4X9Q A;  1PM9 A;  1GN3 A;  1GN4 A;  4FFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...