3DC5A

Crystal structure of a manganese superoxide dismutases from caenorhabditis elegans
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
194
structure length
194
Chain Sequence
KHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn] 2
publication title Purification, crystallization and X-ray structures of the two manganese superoxide dismutases from Caenorhabditis elegans
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 76
structure length 194
sequence length 194
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3dc5A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3dc5A02
1KKCA 1EM1A 1B06A 2GDSA 1PL4A 2P4KA 4BR6A 1XREA 4X9QA 1XILA 4JZGA 3LSUA 1N0JA 1EN6A 3BFRA 1ZLZA 1I08A 5AG2A 1AP5A 3DC5A 1WB8A 3TJTA 1BSMA 2ADQB 1GN6A 2RCVA 1VARA 1AP6A 4YIPA 1AVMA 1BS3A 3C3SA 3KKYA 1BT8A 1AR4A 1MA1A 2QKAA 3RN4A 4C7UA 2ADPA 1P7GA 1XUQA 1GN2A 1VEWA 1PM9A 1IXBA 1SZXA 3OT7A 1MNGA 1EN4A 3AK2A 4JZ2A 1ZSPA 4F6EA 1AR5A 5A9GA 1GN4A 1D5NA 3AK3A 1QNMA 3C3TA 3MDSA 1MMMA 1JR9A 1LUVA 2QKCA 1IX9A 3K9SA 3AK1A 2CE4A 3IC9A 4YIOA 1XDCA 1ZTEA 3DC6A 4GUNA 3EVKA 1I0HA 3CEIA 3QVNA 4JYYA 1MSDA 1WB7A 1GN3A 1N0NA 1ZUQA 2CDYA 1JA8A 4FFKA 2AW9A 1EN5A 1IDSA 1Y67A 1LUWA 4E4EA
chains in the Genus database with same CATH superfamily
1TAEA 4WFFA 1U96A 4BR6A 1VP7A 1VF7A 1WP7A 1JQ0A 3DSQA 4HNAA 3SDLA 3CCMV 4FJCC 3IJ4A 3ZN0A 2IU3A 4ZHQB 5EZYB 2EJ7A 1HNWO 1K4DC 2ADQB 3TXSA 3EHBB 4ZHQA 5EZYA 1H8HG 4LFAB 4NXMO 3H1KH 1H38A 3W7TA 1NJIW 1XEQA 2Q4PA 1SQBH 5B1OA 5DN6G 3AG1B 4DV0O 5F2VO 4AI8A 1Q6HA 4DR5B 1I5YA 1FXVA 3ZRWB 3B77A 4G27B 4N21A 2OTJV 4PDLA 3OGCC 4FPPA 4K0KO 3I55V 3LSQA 3ZRWA 3FAVB 3BVOA 3MHHC 4QPJA 3WG7B 4UV9A 4DUZB 4J9YB 2KB1A 3SYAA 1JX9A 1M93A 4I55B 3FAVA 3K9SA 4H13B 3X2QB 1KB9F 1FAFA 2LFSA 3IFXA 2RNBA 5KAFZ 2CE4A 3OEEG 2HR3A 4H44B 1TGOA 4X89A 2QWOB 4I55A 3LDCA 3JAMN 2R70A 2DQ3A 1B3QA 5L3DA 1NQTA 1AI6A 2LGQA 4GX0A 4DV2B 1V9PA 4DUYB 3ZRVA 1PV0A 2YXHA 3ZHVA 3ZJZA 4TOIA 2HJDA 3ZMTA 3OMIB 2OCCC 3J7AU 1WLEA 1VIBA 4X20B 1I94O 1NR1A 4KFMA 2N05A 5B1AC 5GTHZ 4X20A 1YZBA 1G1XB 4DR4O 1Y76B 4YXWG 3ASOC 3PJSK 4FLUA 3DC5A 4LFBB 5EK0A 2RJZA 2OCCB 1CP9A 1Y76A 4JYAO 4JV5O 2E74B 4P2ZA 1WPBA 5LP6C 2W0XA 1I5XA 4LF8B 4GX5A 5B3SC 4NTWA 3A0RA 3IGAC 5FL7G 5KHKA 1RPOA 3SJQC 2NNUA 2ZR2A 1Y74B 1D2DA 1SZXA 3K5NA 4J7ZA 2WLJA 1F51A 1PNMA 1S72V 3RBZA 4UB6Z 3BY6A 4DV4O 1Y74A 3T2MA 5LP6B 2YI9A 1US6A 2VWKA 2ZD9A 4F6RB 1HNZB 4GX1A 4IL6Z 5B3SB 4TV9B 3KZIZ 3K0DA 5LP6A 3L9DA 4QIWF 4F6RA 1FFTB 3H9VA 3JYCA 4JI4O 4I0XB 5LOVB 4TV9A 3U10A 2PGGA 1R3LC 2YEVB 1AJNA 5K1XA 4JI3O 3QF7A 1L0NH 3K58A 5D5QA 3LDEA 4I0XA 5LOVA 2UXDO 3F7VC 2YEVA 2BE3A 1M56B 4LF6B 1XOUA 4CH4A 3FYIB 4CZZA 2DYSC 1UPGA 4B3TO 1B04A 3ABKC 3VQYA 1VF6C 3P30A 5EIBD 4E4EA 4CH5A 1I7FA 3H1LH 4FM2A 1NTKH 4RQEA 2JEUA 4O4JB 4OPAA 2UUBO 2EINC 2HKOA 4JZGA 4PA9A 3OMAB 4J7JA 1O9HA 4O4JA 2WPDG 1WB8A 4OXSA 3E83A 4H37A 2DOSA 1OCOB 2JJ2G 3ABLC 4UCRA 4LP8A 3FB5C 3RN4A 3AEIA 3K5OA 5DM6V 4C7UA 1XL6A 1GKFA 2Q7GA 4X66B 3UQ8A 3L70H 1WNSA 1BL8A 1MNGA 2A0LA 4DXWA 3FFQA 1XMOB 4J9ZB 1K33A 2RN9A 2WWWA 1Z2GA 2E5LO 4D7SA 4DV1O 1TVKB 4JAVA 5LA6B 1R73A 4PHZA 2AHZA 1HWYA 2B9ZA 4R6ZA 4NR1A 5JWPA 5C93A 3LDDA 1TVKA 5LA6A 1QHTA 1YI2V 5LMUB 3B8NA 3FX7A 4PA6A 1EZJA 4YIOA 1XDCA 1ZTEA 4GUNA 4JI2O 2OCHA 4JI8B 1Q86W 3ABMC 4JI1O 3D36C 4PDMA 3ZN1A 1Y66A 3S3WA 4DR2O 2A3QA 3JALB 2KQXA 1G6UA 3AG4B 2QM8A 5L3FA 1QVGU 3SJCC 4OX9B 3JALA 1XREA 2H94A 2CTWA 4XDJA 1TUBB 4FMTA 4B7KA 5IYCO 3OGIB 1M57C 3SPHA 3K08A 1TUBA 4BW9A 4RAIA 1AVMA 1NVPB 2L6LA 3SJAC 3JARB 3UO3A 1JFFB 3ZX6A 3FKSG 3ZMZA 2IH1C 5CBGA 2Q69A 1GN2A 2WLMA 2R9AA 3WB1A 4TV8B 3JARA 3P32A 1JFFA 1SS3A 1Z5WA 3QO5A 4JF3A 4KHPB 4JGSA 2PF4E 1GO3F 5CA1B 3OD4A 1QCEA 4TV8A 1SQXH 2XAFA 2Q7HA 3OW2U 2Y69B 4ZKIA 3RYFB 4JAAA 4LF9B 1QNMA 3C3TA 5CA1A 1BGYH 3CCVV 3ABTA 4PDRA 1FXKB 4B3SB 3RYFA 1Q3EA 4WFEA 5GW7A 4LF4O 2CAZC 2AHYA 5KLVH 1N4CA 2AGAA 3K9AA 3B40A 5JCOA 1FXKA 2ZM6O 4JI7O 5L3BA 4E2LA 4YHHB 1ZUQA 4K8ZA 1Y4MA 2LO1A 3CXHF 2F4VO 1IBKO 1M9NA 5B1BB 3QNEA 3OUFA 4ABMA 3CCUV 1P4RA 1RM1B 2JDIG 2UUAB 1NS1A 3JCUZ 2C2AA 1KKCA 4UCTA 3OE7G 4LNUB 3M7MX 2CGOA 3Q4HB 3CC4V 1YTFB 1YSCA 1L8DA 1S5HC 1PNKA 4LNUA 4FIPC 3Q4HA 2HVKC 2LGWA 5AG2A 4TWKA 2WLNA 5CBFA 1NTMH 2Q6AA 1NKDA 2P67A 2DW4A 1JJ2U 1NTZH 1G4YB 2ZDIA 3E22B 1WJZA 3C3SA 4FLZA 4DR3O 2P6JA 4HBNA 2FTKA 2XAQA 3K0GA 1ZWIC 4NTXA 3LSSA 2AZ2A 3OUSA 3E22A 3BEHA 1N36B 1R6TA 2JRIA 4F6EA 4O4LB 4PDVA 3G80A 2YIBA 2PTMA 3SYOA 1K4CC 2ZINA 4MVQA 1N34B 1N33O 4O4LA 2EBOA 4XDLA 2QWQB 1VQ5V 2QKCA 3FB7C 5K1PA 4Z1VA 5BY1A 1W2BU 1S5JA 2A7WA 3NR7A 2XAGA 2JGDB 4P30A 5GONB 3U11A 1Q5OA 4X64O 2GV9A 1Q81W 5IWAB 2JGDA 3CJHB 5GONA 5LGTA 1YIJV 4DR6O 2WA4A 1W0KG 4LF7B 2R9IA 1SESA 4GKKO 4JI6O 3E8FA 3W7SA 2UUCB 3CJHA 1GH6A 4U7OA 4FZ1A 4Q20A 5L3EA 1EM1A 2E3CA 5LMNO 2P4KA 4D6TH 3JD1A 2QKSA 1XILA 2CK3G 1YJ9V 2JS3A 3VQVA 3T1HB 1K5SA 1P84F 4MVSA 2FYUH 2HHHO 3PN1A 1S5LZ 1KC8W 1EN6A 3O9OA 2DQ0A 2IU0A 1MG1A 4X8AA 2X6BA 3ETQA 1G8MA 3B09A 4PA7A 1R3JC 2ETNA 2FL4A 4DO2A 4DUZO 4FLTA 3P3NA 4OGQB 2QDOA 4DR1O 4KP4A 1QQCA 2ADPA 1WP8A 4QNHB 1BCCH 4MSWC 4XBFA 3D3IA 1DF5A 3VOUA 1ZSPA 4UVBA 2VQEB 2VS0A 1H2SB 4MTOA 3B2EE 1SC5B 4DV2O 1TA8A 4DUYO 1QLEC 4DV6B 4PV1B 3SPGA 3TETA 5JJNB 2H3OA 1B6QA 4JYBA 2NR5A 1FJGB 2QTOA 2CGNA 1T5EA 2PY5A 4FLXA 2HEPA 2RDCA 1L0LH 3BPZA 4EFBA 1QLEB 1M5IA 3SPJA 2ZR3A 4MTXA 2ZE8A 1WB7A 2ZNIA 5LBQA 3CMEV 4UCVA 2QWRB 2MK3A 2P22C 4NVPA 4EKWA 1Q8IA 4LF8O 2QEXV 2AXTZ 3QG5A 2CH7B 2Q68A 4AILC 5B5EZ 4DV7O 3H1JH 2CH7A 2YIAA 4ICGA 3MAQA 5BR8B 4YY3B 3WFVA 1FS0G 1Y6XA 1L1FA 5CMUA 1WA8B 4L8JA 3GWOA 1HNZO 3QTCA 2BOCC 3CRMA 3SR2C 1HR0B 3SYQA 4J11A 1BHAA 1BT8A 2L35A 1YJWV 4MTFA 2JIZG 1WA8A 2ZXWC 3JD4A 4PD4F 4LC1A 4GLXA 2QA4V 4GZRB 4DV0B 5IDJA 1FOUA 2BCCH 2PZSA 1MABG 2OTLV 5JJJB 1KUQA 1VQ8V 1H8EG 3SYPA 5B1AB 4UCOA 5IT9N 2OT5A 4KUMA 4DRXB 4LF6O 2DE0X 1MMMA 4FFBB 2WLLB 4AQYB 3ASOB 4DRXA 2E76B 1EFRG 4W4LA 5KHIA 2HP8A 1SZTA 3HKDB 4FFBA 2ZIOA 2WLLA 1SQGA 3NXSA 2JJ1G 3ZHSA 3G6BA 4X65B 1ORQC 3CD6V 4UUJC 3L75H 3HKDA 4F4LA 2XT9A 1R1BA 4RWUA 1XHZA 1IDSA 3CXCU 2ZT9B 5FPOA 1GMGA 1FKAO 4TT3G 4X66O 4I7ZB 4EEQA 3ZMVA 1N0JA 3APQA 1NZ6A 5H5NA 1XMOO 3BA9A 1SERA 2YUAA 4MVOA 4IYIA 1DF4A 3SJBC 3FB6C 4ZIBA 1YVWA 4AHCA 4MVZA 2XAJA 5KX5B 3CRAA 3CRQA 4YIPA 3JSLA 3MHSC 2X6CA 4JV5B 1D5AA 5JVDB 2EZOA 3K5LA 1E1RG 2VWJA 1IBMB 1SQFA 5KX5A 5LMUO 4ASUG 5DEDA 4JI5B 1V54C 3BRCA 3E8GA 1PD3A 4J10A 5JVDA 2DYSB 4DYLA 3ABKB 4TSFG 4JI8O 1AI7A 3CCRV 1JJOA 2Z5UA 1NVPD 2UXXA 5KHHA 5A2QN 1BHBA 1ZX3A 1SETA 2EINB 2ZE7A 3MDSA 3GWKC 1VF6A 3DTUB 2CTRA 3K06A 3C90A 1AILA 4X1KB 5J2TB 2XTAA 4OX9O 3KDRA 3T1YO 2IH3C 4RQFA 3IC9A 4FZ0A 1KECA 4X1KA 5EBMC 2FKXA 3ABLB 5L3GA 5J2TA 4DW1A 4PJ0Z 4QE9A 5EC1C 1MSDA 4JI3B 1GN3A 1GK9A 3JCZA 1FXHA 3D3QA 1N32O 2Q9LA 4Z2WA 2UXDB 2ZIMA 3CRCA 1EN5A 1UFIA 3B4SA 3JD0A 2LJ2A 1IZ3A 1H2GA 5BMVB 1NT2B 4B3TB 1F23A 3N2KB 4IIJB 1KQSU 5LHHA 1VQ4V 4DR7B 1OCCC 3ZRSA 4B3RO 5BMVA 2KKWA 3N2KA 4IIJA 3HKEB 3E2EA 1AJQA 1AR1B 4JTCB 2RCVA 1COWG 3DXRB 4CBCA 1LNQA 3CRRA 3HKEA 3SPIA 3VBBA 2W6JG 1DGSA 2K1EA 1YTFD 2D3OW 2QWNB 1GTOA 1OCCB 5IY5C 3DXRA 4B3SO 2LP7A 2Q7EA 2YC0A 4U3JB 3ABMB 5CN0A 2EX3A 1S0VA 3ZIAG 2DN9A 4DV3O 3HR0A 3E89A 5H2FZ 3A8TA 3WB0A 4B08A 4RO2A 3AK2A 2PI4A 4U3JA 4MVMA 1K8AW 3D36A 4CH6A 1YHQV 5A9GA 1IBLB 4NXNO 2M7WA 3T1CA 4X62B 1D5NA 4X1YB 4MS2A 1S77D 4DV5O 1LUVA 1WPXA 2UUAO 3RVYA 3L71H 3TK1A 2Q5ZA 4X1YA 2YIBD 1M57B 1OCZC 4O2BB 3O65A 1SF9A 4IT5A 2PYJA 4NB5A 4Q6GA 2KSDA 3TCUA 1H2NA 4ZI7B 3R65A 4O2BA 5CA3A 2QSAA 4Z1MG 2QR4A 3LNMB 4MVRA 4ZI7A 4J42A 3STLC 3AG2C 1QBZA 2K9PA 3CCSV 1OCZB 3AG3C 1ZAUA 1MZEA 3CE2A 1XNRO 1V55C 4QPKA 2ZNJA 2WSSG 3JASB 3G4SV 3GB7C 4CS4A 2VQFB 1KD1W 2YICA 2EIJC 2EILC 4EFEA 1BZKA 4W4KA 2HJFC 3JASA 3VQWA 3ICXA 2WLIB 1BQZA 1F4NA 1IXMA 1N36O 2Y4UA 2B5UA 1SQVH 4GT1A 2IM9A 3MD0A 2WLIA 1R6NA 1V55B 4K8XA 2QTSA 1NBMG 2HLDG 3K3WA 1N34O 1BS3A 3A2FA 2DWDC 2QKAA 2XOKG 2D2CB 5TISZ 4X1IB 2Y48A 1HNXB 2UXCO 2YS8A 2XUMA 2YDEA 2EIKC 4LFCB 2UXBB 3BABA 2M6YA 4HYOA 4JZ2A 4X1IA 3U0ZA 3RWRD 1WAZA 4TUYB 5IYDO 2UU9B 3OTOB 3CPWU 1GN4A 3CS5A 1GAXA 2Z3YA 4TUYA 5H9CA 1FD9A 3OM3B 4B3MB 3ZHQA 2FB5A 3CYOA 4IGGA 3THOA 3QO8A 3WB2A 4UCUA 2E75B 2WAMA 4LF4B 5KHGA 1O9GA 1MOFA 4UFZA 4JASA 2RQ6A 3BCCH 3RYHB 4JI7B 1YITV 1RP3B 4GKJO 5JQGB 3RYHA 2F4VB 3JAKB 1W59A 3CCEV 3OTFA 2ZE5A 3UKMA 4RUEA 5JQGA 1YJNV 2GBOA 2GUZB 4P9PA 3JAKA 4CS3A 3N2GB 4BAYA 2VQEO 4IHJB 1IVSA 4WFHA 2GUZA 3K57A 1GN6A 4LFAO 1IJGA 2Y0IA 4I9WA 5ITZB 1VARA 4YJ2B 3D8CA 3L73H 3N2GA 4FVMA 4BWAA 2DWEC 4IHJA 1FJGO 1XNQB 3K5MA 2DYRC 3EXAA 2F66C 5ITZA 3F7YC 4DR5O 2JGUA 2F93B 4DR3B 4CC5A 2LQTA 2KG7B 4PA4A 5KUMA 1M1KW 1TUEB 1VQLV 1Q7YW 4QJFB 1JPXA 2XHBA 1R3KC 2JVDA 4ZBMA 1OZ0A 2KG7A 4J41A 1PL0A 2X6AA 3LNNA 4UXNA 3IC7A 3SGIA 3RYCB 1XHXA 1DLBA 4FLWA 4UCSA 2OIEA 2WLHA 3AK3A 2DYRB 1NH2B 2F23A 4LF5B 4PI2A 3RYCA 1IURA 1E1QG 1IX9A 1YF2A 1VQ7V 1M90W 5E79Z 3KCXA 3W7WA 3AK1A 3CX5F 4I9QA 2CTQA 3CB2A 3JD3A 4BW5A 2YIDA 3OEHG 2OWOA 1XMQB 5C8YB 2ITCC 3AG1C 4X64B 3JAWB 1N0NA 5BR8O 4YY3O 1VQOV 1JA8A 1AROP 4HZ3A 3N27A 3E8HA 5B66Z 4MTGA 3CSXA 5LL6Y 5C8YA 4DR6B 3JAWA 3M8AA 4GYCB 4U7NA 1HR0O 4GKKB 1LUWA 3FD9A 1NR7A 2GDSA 4JI6B 4DK0A 3OR7C 3J80N 2FMLA 3WG7C 2MW2B 5LMNB 5EBWC 3S3XA 1KYOF 1X4TA 3L74H 4LFBO 1ZLZA 2ITDC 4RUFA 5IYBO 3OAAG 1ZL8B 2HHHB 3X2QC 1OJHA 5EBLC 3TJTA 3H01A 2GSMB 2EULA 3QO7A 2Y0PA 1ZL8A 4JI0B 1J5EB 4FLYA 3KCYA 2XASA 2ILMA 5BXZA 4AQYO 2XNDG 2EZPA 2RMKB 2Q67A 5EC2C 2V4DA 1PKXA 2NLJC 3JD2A 1P49A 1QVFU 1CPYA 2QE7G 3E35A 4DR1B 3RYIB 1EN4A 5HFMA 4X65O 2GHYA 5LGUA 2AZ0A 1HNWB 4LH7A 3FYEB 1VQMV 1FPOA 3RYIA 2JK5C 1R6KA 1YDXA 1QR8A 4NXMB 3ZRXA 3T4DA 3K03A 2IJHA 5LXTB 5J9PC 2GTSA 3JATB 2Q0AA 3CHXA 3K59A 3ZEDA 1Q6UA 3DC6A 5LHGA 4J80A 3OMNB 4O4IB 1THZA 5LXTA 3H1HH 4JYYA 3ZMSA 1W0JG 1OHHG 3JATA 1Q6IA 4K0KB 2ZXWB 2P90A 5KA6A 4O4IA 4IYHA 3CMAV 4PI0A 4FK5C 5BZBA 1J95A 2WA3A 1IBMO 4OPHA 1GM7A 3CP1A 4X9QA 1JNBA 2EIMC 2QJ1A 1AB3A 3RVZA 2HVJC 4JI5O 5KA5A 3BFRA 1YCIA 1SA0B 4DV7B 1I08A 5FPRA 3P3PA 1H5WA 4LBEC 2Q8VA 1F4MA 1JOYA 1JCHA 1AI4A 3W7XA 1KMIZ 1SA0A 2BSKB 2BOBC 3DGEA 1I94B 2A9HA 5KMGB 1AR4A 1DTOA 1MA1A 4NTYA 4JTAB 2EIMB 2PI5A 3G6EV 1M56C 3A0BZ 2BSKA 2F95B 2ZCEA 4LH6A 1A32A 5KHJA 4MT8A 5IJ9B 3ZHRA 5KMGA 4DR4B 3OT7A 2IJKA 1K5QA 4XDKA 3ETGA 1QR9A 5IJ9A 4MW3A 4I5SA 4JYAB 2CUGA 3CCJV 4CC6A 1Q82W 3TXQA 2X0LA 3UO2A 1PNLA 4UVCA 1YXBA 4K3AA 1K97A 4J7KA 1URFA 1XBLA 5CBHA 1ENVA 1BQ0A 4DR7O 1OCOC 4HAMA 3ZHTA 3STZC 4DV4B 1XQ8A 1KKDA 2YXYA 4QE7A 3WU2Z 2EJRA 3KG2A 1K3EA 4PA3A 4R7CA 3BA8A 1V54B 1Y67A 2WLKA 4LCUC 2LW1A 1B06A 4WFBV 2G38A 2F43G 4TQFA 2A79B 4JI4B 2H8PC 3ABUA 3AG7A 4JYCA 2Y4TA 4FM1A 3ZCCA 1K92A 1CXZB 1P7BA 3F5TA 3LUTB 1BSMA 1IBLO 3RW0A 3HPLC 4G2KA 3ZS8C 4JTDB 5JJEB 4X62O 4H0LB 2YXLA 1SRYA 1HP8A 4FLVA 4R8CA 1JVMA 4UV8A 5EYPB 3GVMA 2R9RB 2P4VA 1VF5B 4DK1A 2QM7A 4CS2A 4EB6B 4KHPO 2GTAA 4WCEV 2UUBB 1VEWA 5DECA 5EYPA 1KBHA 2O57A 3ZBHA 2HFEC 3AG4C 3CCQV 4DW0A 5CB4B 1DK1A 2ZE6A 5EIBC 4EB6A 4WFAV 5KAIZ 2IJIA 4BIZA 3E86A 1GM9A 4YJ3B 5LYJB 4LF9O 1PPJH 3OR6C 5CB4A 4YJ3A 5LYJA 3BHPA 3HKCB 4WF9V 1Q90D 2ODMA 5B1NA 2IJJA 4GX2A 2QWPB 2VQFO 2XAHA 1S3JA 5KUKA 4N23A 4TQDA 3HKCA 3FB8C 4CH3A 5IYZB 3W7UA 4YHHO 3EVKA 1VQPV 3T1YB 3CEIA 5H6QA 3F5WC 5LGNA 3CC7V 5IY5B 3UCSC 2E5LB 2P7TC 1R3IC 3IAYA 5IYZA 2YI8A 4WBNB 5H6RA 4PELA 4A5UB 4DV1B 2DJVA 1N32B 3CC2V 3HKBB 3UM7A 1OCRC 1YEWA 4MVUA 1H2LA 1Q43A 1U97A 4WBNA 4JAUA 1RSOB 3JSNA 4I4TB 2W6IG 1FFXB 1HDJA 2BTOA 2Y69C 3HKBA 2ATKC 5J2UB 1HNXO 1EBOA 1M4UA 1XL4A 4JI2B 1RFYA 2P5OA 4LFCO 3TGUH 1RSOA 2UXBO 2IW5A 1Z5VA 5JCOC 4I4TA 1FFXA 1FXKC 4B3RB 3H1IH 5J2UA 2JS5A 3K04A 4JI1B 3VQXA 2UU9O 1OCRB 3OTOO 2IBZH 4O2AB 1VMGA 1N8RW 4DR2B 1AP6A 2UXNA 3G67A 4R50A 3KKYA 2R72A 4B3MO 4O2AA 1GM8A 1GRJA 3ML0A 5JH7B 1JMKC 3A0HZ 1RPRA 1FYJA 3L72H 5B1BC 4MW8A 1AJPA 2YSUB 1KU9A 1VQ6V 1RM1C 3RGBA 3AG2B 2N74A 4NYKA 5FLXN 4LR3A 3AG3B 5JH7A 2LW7A 2PUSA 4DV3B 4X88A 4KXRA 1BE3H 4GCZA 1SKVA 1X59A 1SQPH 4KL1A 2EIJB 2EILB 1S76D 1NI8A 2A06H 2V1DA 4NXNB 1VQNV 1MSWD 1JR9A 1KP2A 1K9MW 3ASNC 3ETDA 4U3FH 1K7DA 2ZDIC 1WN7A 4DV5B 1PP9H 1H2MA 3CWBH 1VQKV 4L87A 1BMFG 2OIGA 5IWAO 3UT5B 2DMXA 3QVNA 2HG5C 4LF7O 1K34A 1NH2D 2PYLA 4P9OA 3ZMUA 3ZHUA 3UT5A 4FFKA 3ASNB 2UUCO 3I5DA 1F7YA 2QM4A 2EIKB 1QU7A 3RT3C 3APOA 4K35A 1NU1H 2Z0AA 1XNQO 1PL4A 4I50B 2Q73A 4QGPA 3T1HO 1MZFA 1XNRB 5LHIA 5CA0B 1VQ9V 5IJ0B 4FM0A 3LSUA 3G71V 4UVAA 4LWSB 2N04A 4I50A 5L3CA 2ZM6B 2LFRA 5FNVB 5CA0A 1HW7A 2ZKOA 5IJ0A 1AP5A 3E8BA 4LWSA 3BAAA 1IBKB 5FNVA 5E1AC 3HB3B 3T4ZA 3M99B 3J81N 4LF5O 1XI1A 4UB8Z 3K79A 2VRZA 2F1MA 1P7GA 2B1IA 3I56V 1XUQA 4ZOLB 2ZQMA 1PM9A 2QGNA 4H33A 1IXBA 4O4HB 3OFNG 1LR1A 1EZVH 1ROPA 3EFFK 3RFRA 2UXCB 1OV9A 4ZOLA 1UJWB 4G28B 4DV6O 1XMQO 3B8MA 1AR5A 2W0FC 4O4HA 2Q0OC 2V7QG 2NN4A 3R66A 2ARHA 4JPRA 4YJ2A 3SPCA 1K73W 5IE9A 3ETEA 4B7EA 1E79G 1I0HA 2BTQB 4BIOA 5D5PA 1KP3A 1QLNA 2CTPA 1CEZA 4WFGA 2P06A 2B1GA 2CDYA 5GTIZ 4BIUA 1H2KA 3SYCA 2BTQA 2OYQA 1AI5A 4NKGB 3CCLV 4D7TA 2AW9A 4JI0O 1N33B 1J5EO 1SQQH 2JEXA 5HFLA 2X7RB 4HNAB 4GKJB
chains in the Genus database with same CATH topology
1KKCA 1EM1A 1B06A 2GDSA 1PL4A 2P4KA 4BR6A 1XREA 4X9QA 1XILA 4JZGA 3LSUA 1N0JA 1EN6A 3BFRA 1ZLZA 1I08A 5AG2A 1AP5A 3DC5A 1WB8A 3TJTA 1BSMA 2ADQB 1GN6A 2RCVA 1VARA 1AP6A 4YIPA 1AVMA 1BS3A 3C3SA 3KKYA 1BT8A 1AR4A 1MA1A 2QKAA 3RN4A 4C7UA 2ADPA 1P7GA 1XUQA 1GN2A 1VEWA 1PM9A 1IXBA 1SZXA 3OT7A 1MNGA 1EN4A 3AK2A 4JZ2A 1ZSPA 4F6EA 1AR5A 5A9GA 1GN4A 1D5NA 3AK3A 1QNMA 3C3TA 3MDSA 1MMMA 1JR9A 1LUVA 2QKCA 1IX9A 3K9SA 3KDRA 3AK1A 2CE4A 3IC9A 4YIOA 1XDCA 1ZTEA 3DC6A 4GUNA 3EVKA 1I0HA 3CEIA 3QVNA 4JYYA 1MSDA 1WB7A 1GN3A 1N0NA 1ZUQA 2CDYA 1JA8A 4FFKA 2AW9A 1EN5A 1IDSA 1Y67A 1LUWA 4E4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKC A;  1EM1 A;  1B06 A;  2GDS A;  1PL4 A;  2P4K A;  4BR6 A;  1XRE A;  4X9Q A;  1XIL A;  4JZG A;  3LSU A;  1N0J A;  1EN6 A;  3BFR A;  1ZLZ A;  1I08 A;  5AG2 A;  1AP5 A;  3DC5 A;  1WB8 A;  3TJT A;  1BSM A;  2ADQ B;  1GN6 A;  2RCV A;  1VAR A;  1AP6 A;  4YIP A;  1AVM A;  1BS3 A;  3C3S A;  3KKY A;  1BT8 A;  1AR4 A;  1MA1 A;  2QKA A;  3RN4 A;  4C7U A;  2ADP A;  1P7G A;  1XUQ A;  1GN2 A;  1VEW A;  1PM9 A;  1IXB A;  1SZX A;  3OT7 A;  1MNG A;  1EN4 A;  3AK2 A;  4JZ2 A;  1ZSP A;  4F6E A;  1AR5 A;  5A9G A;  1GN4 A;  1D5N A;  3AK3 A;  1QNM A;  3C3T A;  3MDS A;  1MMM A;  1JR9 A;  1LUV A;  2QKC A;  1IX9 A;  3K9S A;  3AK1 A;  2CE4 A;  3IC9 A;  4YIO A;  1XDC A;  1ZTE A;  3DC6 A;  4GUN A;  3EVK A;  1I0H A;  3CEI A;  3QVN A;  4JYY A;  1MSD A;  1WB7 A;  1GN3 A;  1N0N A;  1ZUQ A;  2CDY A;  1JA8 A;  4FFK A;  2AW9 A;  1EN5 A;  1IDS A;  1Y67 A;  1LUW A;  4E4E A; 
#chains in the Genus database with same CATH topology
 1TAE A;  4WFF A;  1U96 A;  4BR6 A;  1VP7 A;  1VF7 A;  1WP7 A;  1JQ0 A;  3DSQ A;  4HNA A;  3SDL A;  3CCM V;  4FJC C;  3IJ4 A;  3ZN0 A;  2IU3 A;  4ZHQ B;  5EZY B;  2EJ7 A;  1HNW O;  1K4D C;  2ADQ B;  3TXS A;  3EHB B;  4ZHQ A;  5EZY A;  1H8H G;  4LFA B;  4NXM O;  3H1K H;  1H38 A;  3W7T A;  1NJI W;  1XEQ A;  2Q4P A;  1SQB H;  5B1O A;  5DN6 G;  3AG1 B;  4DV0 O;  5F2V O;  4AI8 A;  1Q6H A;  4DR5 B;  1I5Y A;  1FXV A;  3ZRW B;  3B77 A;  4G27 B;  4N21 A;  2OTJ V;  4PDL A;  3OGC C;  4FPP A;  4K0K O;  3I55 V;  3LSQ A;  3ZRW A;  3FAV B;  3BVO A;  3MHH C;  4QPJ A;  3WG7 B;  4UV9 A;  4DUZ B;  4J9Y B;  2KB1 A;  3SYA A;  1JX9 A;  1M93 A;  4I55 B;  3FAV A;  3K9S A;  4H13 B;  3X2Q B;  1KB9 F;  1FAF A;  2LFS A;  3IFX A;  2RNB A;  5KAF Z;  2CE4 A;  3OEE G;  2HR3 A;  4H44 B;  1TGO A;  4X89 A;  2QWO B;  4I55 A;  3LDC A;  3JAM N;  2R70 A;  2DQ3 A;  1B3Q A;  5L3D A;  1NQT A;  1AI6 A;  2LGQ A;  4GX0 A;  4DV2 B;  1V9P A;  4DUY B;  3ZRV A;  1PV0 A;  2YXH A;  3ZHV A;  3ZJZ A;  4TOI A;  2HJD A;  3ZMT A;  3OMI B;  2OCC C;  3J7A U;  1WLE A;  1VIB A;  4X20 B;  1I94 O;  1NR1 A;  4KFM A;  2N05 A;  5B1A C;  5GTH Z;  4X20 A;  1YZB A;  1G1X B;  4DR4 O;  1Y76 B;  4YXW G;  3ASO C;  3PJS K;  4FLU A;  3DC5 A;  4LFB B;  5EK0 A;  2RJZ A;  2OCC B;  1CP9 A;  1Y76 A;  4JYA O;  4JV5 O;  2E74 B;  4P2Z A;  1WPB A;  5LP6 C;  2W0X A;  1I5X A;  4LF8 B;  4GX5 A;  5B3S C;  4NTW A;  3A0R A;  3IGA C;  5FL7 G;  5KHK A;  1RPO A;  3SJQ C;  2NNU A;  2ZR2 A;  1Y74 B;  1D2D A;  1SZX A;  3K5N A;  4J7Z A;  2WLJ A;  1F51 A;  1PNM A;  1S72 V;  3RBZ A;  4UB6 Z;  3BY6 A;  4DV4 O;  1Y74 A;  3T2M A;  5LP6 B;  2YI9 A;  1US6 A;  2VWK A;  2ZD9 A;  4F6R B;  1HNZ B;  4GX1 A;  4IL6 Z;  5B3S B;  4TV9 B;  3KZI Z;  3K0D A;  5LP6 A;  3L9D A;  4QIW F;  4F6R A;  1FFT B;  3H9V A;  3JYC A;  4JI4 O;  4I0X B;  5LOV B;  4TV9 A;  3U10 A;  2PGG A;  1R3L C;  2YEV B;  1AJN A;  5K1X A;  4JI3 O;  3QF7 A;  1L0N H;  3K58 A;  5D5Q A;  3LDE A;  4I0X A;  5LOV A;  2UXD O;  3F7V C;  2YEV A;  2BE3 A;  1M56 B;  4LF6 B;  1XOU A;  4CH4 A;  3FYI B;  4CZZ A;  2DYS C;  1UPG A;  4B3T O;  1B04 A;  3ABK C;  3VQY A;  1VF6 C;  3P30 A;  5EIB D;  4E4E A;  4CH5 A;  1I7F A;  3H1L H;  4FM2 A;  1NTK H;  4RQE A;  2JEU A;  4O4J B;  4OPA A;  2UUB O;  2EIN C;  2HKO A;  4JZG A;  4PA9 A;  3OMA B;  4J7J A;  1O9H A;  4O4J A;  2WPD G;  1WB8 A;  4OXS A;  3E83 A;  4H37 A;  2DOS A;  1OCO B;  2JJ2 G;  3ABL C;  4UCR A;  4LP8 A;  3FB5 C;  3RN4 A;  3AEI A;  3K5O A;  5DM6 V;  4C7U A;  1XL6 A;  1GKF A;  2Q7G A;  4X66 B;  3UQ8 A;  3L70 H;  1WNS A;  1BL8 A;  1MNG A;  2A0L A;  4DXW A;  3FFQ A;  1XMO B;  4J9Z B;  1K33 A;  2RN9 A;  2WWW A;  1Z2G A;  2E5L O;  4D7S A;  4DV1 O;  1TVK B;  4JAV A;  5LA6 B;  1R73 A;  4PHZ A;  2AHZ A;  1HWY A;  2B9Z A;  4R6Z A;  4NR1 A;  5JWP A;  5C93 A;  3LDD A;  1TVK A;  5LA6 A;  1QHT A;  1YI2 V;  5LMU B;  3B8N A;  3FX7 A;  4PA6 A;  1EZJ A;  4YIO A;  1XDC A;  1ZTE A;  4GUN A;  4JI2 O;  2OCH A;  4JI8 B;  1Q86 W;  3ABM C;  4JI1 O;  3D36 C;  4PDM A;  3ZN1 A;  1Y66 A;  3S3W A;  4DR2 O;  2A3Q A;  3JAL B;  2KQX A;  1G6U A;  3AG4 B;  2QM8 A;  5L3F A;  1QVG U;  3SJC C;  4OX9 B;  3JAL A;  1XRE A;  2H94 A;  2CTW A;  4XDJ A;  1TUB B;  4FMT A;  4B7K A;  5IYC O;  3OGI B;  1M57 C;  3SPH A;  3K08 A;  1TUB A;  4BW9 A;  4RAI A;  1AVM A;  1NVP B;  2L6L A;  3SJA C;  3JAR B;  3UO3 A;  1JFF B;  3ZX6 A;  3FKS G;  3ZMZ A;  2IH1 C;  5CBG A;  2Q69 A;  1GN2 A;  2WLM A;  2R9A A;  3WB1 A;  4TV8 B;  3JAR A;  3P32 A;  1JFF A;  1SS3 A;  1Z5W A;  3QO5 A;  4JF3 A;  4KHP B;  4JGS A;  2PF4 E;  1GO3 F;  5CA1 B;  3OD4 A;  1QCE A;  4TV8 A;  1SQX H;  2XAF A;  2Q7H A;  3OW2 U;  2Y69 B;  4ZKI A;  3RYF B;  4JAA A;  4LF9 B;  1QNM A;  3C3T A;  5CA1 A;  1BGY H;  3CCV V;  3ABT A;  4PDR A;  1FXK B;  4B3S B;  3RYF A;  1Q3E A;  4WFE A;  5GW7 A;  4LF4 O;  2CAZ C;  2AHY A;  5KLV H;  1N4C A;  2AGA A;  3K9A A;  3B40 A;  5JCO A;  1FXK A;  2ZM6 O;  4JI7 O;  5L3B A;  4E2L A;  4YHH B;  1ZUQ A;  4K8Z A;  1Y4M A;  2LO1 A;  3CXH F;  2F4V O;  1IBK O;  1M9N A;  5B1B B;  3QNE A;  3OUF A;  4ABM A;  3CCU V;  1P4R A;  1RM1 B;  2JDI G;  2UUA B;  1NS1 A;  3JCU Z;  2C2A A;  1KKC A;  4UCT A;  3OE7 G;  4LNU B;  3M7M X;  2CGO A;  3Q4H B;  3CC4 V;  1YTF B;  1YSC A;  1L8D A;  1S5H C;  1PNK A;  4LNU A;  4FIP C;  3Q4H A;  2HVK C;  2LGW A;  5AG2 A;  4TWK A;  2WLN A;  5CBF A;  1NTM H;  2Q6A A;  1NKD A;  2P67 A;  2DW4 A;  1JJ2 U;  1NTZ H;  1G4Y B;  2ZDI A;  3E22 B;  1WJZ A;  3C3S A;  4FLZ A;  4DR3 O;  2P6J A;  4HBN A;  2FTK A;  2XAQ A;  3K0G A;  1ZWI C;  4NTX A;  3LSS A;  2AZ2 A;  3OUS A;  3E22 A;  3BEH A;  1N36 B;  1R6T A;  2JRI A;  4F6E A;  4O4L B;  4PDV A;  3G80 A;  2YIB A;  2PTM A;  3SYO A;  1K4C C;  2ZIN A;  4MVQ A;  1N34 B;  1N33 O;  4O4L A;  2EBO A;  4XDL A;  2QWQ B;  1VQ5 V;  2QKC A;  3FB7 C;  5K1P A;  4Z1V A;  5BY1 A;  1W2B U;  1S5J A;  2A7W A;  3NR7 A;  2XAG A;  2JGD B;  4P30 A;  5GON B;  3U11 A;  1Q5O A;  4X64 O;  2GV9 A;  1Q81 W;  5IWA B;  2JGD A;  3CJH B;  5GON A;  5LGT A;  1YIJ V;  4DR6 O;  2WA4 A;  1W0K G;  4LF7 B;  2R9I A;  1SES A;  4GKK O;  4JI6 O;  3E8F A;  3W7S A;  2UUC B;  3CJH A;  1GH6 A;  4U7O A;  4FZ1 A;  4Q20 A;  5L3E A;  1EM1 A;  2E3C A;  5LMN O;  2P4K A;  4D6T H;  3JD1 A;  2QKS A;  1XIL A;  2CK3 G;  1YJ9 V;  2JS3 A;  3VQV A;  3T1H B;  1K5S A;  1P84 F;  4MVS A;  2FYU H;  2HHH O;  3PN1 A;  1S5L Z;  1KC8 W;  1EN6 A;  3O9O A;  2DQ0 A;  2IU0 A;  1MG1 A;  4X8A A;  2X6B A;  3ETQ A;  1G8M A;  3B09 A;  4PA7 A;  1R3J C;  2ETN A;  2FL4 A;  4DO2 A;  4DUZ O;  4FLT A;  3P3N A;  4OGQ B;  2QDO A;  4DR1 O;  4KP4 A;  1QQC A;  2ADP A;  1WP8 A;  4QNH B;  1BCC H;  4MSW C;  4XBF A;  3D3I A;  1DF5 A;  3VOU A;  1ZSP A;  4UVB A;  2VQE B;  2VS0 A;  1H2S B;  4MTO A;  3B2E E;  1SC5 B;  4DV2 O;  1TA8 A;  4DUY O;  1QLE C;  4DV6 B;  4PV1 B;  3SPG A;  3TET A;  5JJN B;  2H3O A;  1B6Q A;  4JYB A;  2NR5 A;  1FJG B;  2QTO A;  2CGN A;  1T5E A;  2PY5 A;  4FLX A;  2HEP A;  2RDC A;  1L0L H;  3BPZ A;  4EFB A;  1QLE B;  1M5I A;  3SPJ A;  2ZR3 A;  4MTX A;  2ZE8 A;  1WB7 A;  2ZNI A;  5LBQ A;  3CME V;  4UCV A;  2QWR B;  2MK3 A;  2P22 C;  4NVP A;  4EKW A;  1Q8I A;  4LF8 O;  2QEX V;  2AXT Z;  3QG5 A;  2CH7 B;  2Q68 A;  4AIL C;  5B5E Z;  4DV7 O;  3H1J H;  2CH7 A;  2YIA A;  4ICG A;  3MAQ A;  5BR8 B;  4YY3 B;  3WFV A;  1FS0 G;  1Y6X A;  1L1F A;  5CMU A;  1WA8 B;  4L8J A;  3GWO A;  1HNZ O;  3QTC A;  2BOC C;  3CRM A;  3SR2 C;  1HR0 B;  3SYQ A;  4J11 A;  1BHA A;  1BT8 A;  2L35 A;  1YJW V;  4MTF A;  2JIZ G;  1WA8 A;  2ZXW C;  3JD4 A;  4PD4 F;  4LC1 A;  4GLX A;  2QA4 V;  4GZR B;  4DV0 B;  5IDJ A;  1FOU A;  2BCC H;  2PZS A;  1MAB G;  2OTL V;  5JJJ B;  1KUQ A;  1VQ8 V;  1H8E G;  3SYP A;  5B1A B;  4UCO A;  5IT9 N;  2OT5 A;  4KUM A;  4DRX B;  4LF6 O;  2DE0 X;  1MMM A;  4FFB B;  2WLL B;  4AQY B;  3ASO B;  4DRX A;  2E76 B;  1EFR G;  4W4L A;  5KHI A;  2HP8 A;  1SZT A;  3HKD B;  4FFB A;  2ZIO A;  2WLL A;  1SQG A;  3NXS A;  2JJ1 G;  3ZHS A;  3G6B A;  4X65 B;  1ORQ C;  3CD6 V;  4UUJ C;  3L75 H;  3HKD A;  4F4L A;  2XT9 A;  1R1B A;  4RWU A;  1XHZ A;  1IDS A;  3CXC U;  2ZT9 B;  5FPO A;  1GMG A;  1FKA O;  4TT3 G;  4X66 O;  4I7Z B;  4EEQ A;  3ZMV A;  1N0J A;  3APQ A;  1NZ6 A;  5H5N A;  1XMO O;  3BA9 A;  1SER A;  2YUA A;  4MVO A;  4IYI A;  1DF4 A;  3SJB C;  3FB6 C;  4ZIB A;  1YVW A;  4AHC A;  4MVZ A;  2XAJ A;  5KX5 B;  3CRA A;  3CRQ A;  4YIP A;  3JSL A;  3MHS C;  2X6C A;  4JV5 B;  1D5A A;  5JVD B;  2EZO A;  3K5L A;  1E1R G;  2VWJ A;  1IBM B;  1SQF A;  5KX5 A;  5LMU O;  4ASU G;  5DED A;  4JI5 B;  1V54 C;  3BRC A;  3E8G A;  1PD3 A;  4J10 A;  5JVD A;  2DYS B;  4DYL A;  3ABK B;  4TSF G;  4JI8 O;  1AI7 A;  3CCR V;  1JJO A;  2Z5U A;  1NVP D;  2UXX A;  5KHH A;  5A2Q N;  1BHB A;  1ZX3 A;  1SET A;  2EIN B;  2ZE7 A;  3MDS A;  3GWK C;  1VF6 A;  3DTU B;  2CTR A;  3K06 A;  3C90 A;  1AIL A;  4X1K B;  5J2T B;  2XTA A;  4OX9 O;  3KDR A;  3T1Y O;  2IH3 C;  4RQF A;  3IC9 A;  4FZ0 A;  1KEC A;  4X1K A;  5EBM C;  2FKX A;  3ABL B;  5L3G A;  5J2T A;  4DW1 A;  4PJ0 Z;  4QE9 A;  5EC1 C;  1MSD A;  4JI3 B;  1GN3 A;  1GK9 A;  3JCZ A;  1FXH A;  3D3Q A;  1N32 O;  2Q9L A;  4Z2W A;  2UXD B;  2ZIM A;  3CRC A;  1EN5 A;  1UFI A;  3B4S A;  3JD0 A;  2LJ2 A;  1IZ3 A;  1H2G A;  5BMV B;  1NT2 B;  4B3T B;  1F23 A;  3N2K B;  4IIJ B;  1KQS U;  5LHH A;  1VQ4 V;  4DR7 B;  1OCC C;  3ZRS A;  4B3R O;  5BMV A;  2KKW A;  3N2K A;  4IIJ A;  3HKE B;  3E2E A;  1AJQ A;  1AR1 B;  4JTC B;  2RCV A;  1COW G;  3DXR B;  4CBC A;  1LNQ A;  3CRR A;  3HKE A;  3SPI A;  3VBB A;  2W6J G;  1DGS A;  2K1E A;  1YTF D;  2D3O W;  2QWN B;  1GTO A;  1OCC B;  5IY5 C;  3DXR A;  4B3S O;  2LP7 A;  2Q7E A;  2YC0 A;  4U3J B;  3ABM B;  5CN0 A;  2EX3 A;  1S0V A;  3ZIA G;  2DN9 A;  4DV3 O;  3HR0 A;  3E89 A;  5H2F Z;  3A8T A;  3WB0 A;  4B08 A;  4RO2 A;  3AK2 A;  2PI4 A;  4U3J A;  4MVM A;  1K8A W;  3D36 A;  4CH6 A;  1YHQ V;  5A9G A;  1IBL B;  4NXN O;  2M7W A;  3T1C A;  4X62 B;  1D5N A;  4X1Y B;  4MS2 A;  1S77 D;  4DV5 O;  1LUV A;  1WPX A;  2UUA O;  3RVY A;  3L71 H;  3TK1 A;  2Q5Z A;  4X1Y A;  2YIB D;  1M57 B;  1OCZ C;  4O2B B;  3O65 A;  1SF9 A;  4IT5 A;  2PYJ A;  4NB5 A;  4Q6G A;  2KSD A;  3TCU A;  1H2N A;  4ZI7 B;  3R65 A;  4O2B A;  5CA3 A;  2QSA A;  4Z1M G;  2QR4 A;  3LNM B;  4MVR A;  4ZI7 A;  4J42 A;  3STL C;  3AG2 C;  1QBZ A;  2K9P A;  3CCS V;  1OCZ B;  3AG3 C;  1ZAU A;  1MZE A;  3CE2 A;  1XNR O;  1V55 C;  4QPK A;  2ZNJ A;  2WSS G;  3JAS B;  3G4S V;  3GB7 C;  4CS4 A;  2VQF B;  1KD1 W;  2YIC A;  2EIJ C;  2EIL C;  4EFE A;  1BZK A;  4W4K A;  2HJF C;  3JAS A;  3VQW A;  3ICX A;  2WLI B;  1BQZ A;  1F4N A;  1IXM A;  1N36 O;  2Y4U A;  2B5U A;  1SQV H;  4GT1 A;  2IM9 A;  3MD0 A;  2WLI A;  1R6N A;  1V55 B;  4K8X A;  2QTS A;  1NBM G;  2HLD G;  3K3W A;  1N34 O;  1BS3 A;  3A2F A;  2DWD C;  2QKA A;  2XOK G;  2D2C B;  5TIS Z;  4X1I B;  2Y48 A;  1HNX B;  2UXC O;  2YS8 A;  2XUM A;  2YDE A;  2EIK C;  4LFC B;  2UXB B;  3BAB A;  2M6Y A;  4HYO A;  4JZ2 A;  4X1I A;  3U0Z A;  3RWR D;  1WAZ A;  4TUY B;  5IYD O;  2UU9 B;  3OTO B;  3CPW U;  1GN4 A;  3CS5 A;  1GAX A;  2Z3Y A;  4TUY A;  5H9C A;  1FD9 A;  3OM3 B;  4B3M B;  3ZHQ A;  2FB5 A;  3CYO A;  4IGG A;  3THO A;  3QO8 A;  3WB2 A;  4UCU A;  2E75 B;  2WAM A;  4LF4 B;  5KHG A;  1O9G A;  1MOF A;  4UFZ A;  4JAS A;  2RQ6 A;  3BCC H;  3RYH B;  4JI7 B;  1YIT V;  1RP3 B;  4GKJ O;  5JQG B;  3RYH A;  2F4V B;  3JAK B;  1W59 A;  3CCE V;  3OTF A;  2ZE5 A;  3UKM A;  4RUE A;  5JQG A;  1YJN V;  2GBO A;  2GUZ B;  4P9P A;  3JAK A;  4CS3 A;  3N2G B;  4BAY A;  2VQE O;  4IHJ B;  1IVS A;  4WFH A;  2GUZ A;  3K57 A;  1GN6 A;  4LFA O;  1IJG A;  2Y0I A;  4I9W A;  5ITZ B;  1VAR A;  4YJ2 B;  3D8C A;  3L73 H;  3N2G A;  4FVM A;  4BWA A;  2DWE C;  4IHJ A;  1FJG O;  1XNQ B;  3K5M A;  2DYR C;  3EXA A;  2F66 C;  5ITZ A;  3F7Y C;  4DR5 O;  2JGU A;  2F93 B;  4DR3 B;  4CC5 A;  2LQT A;  2KG7 B;  4PA4 A;  5KUM A;  1M1K W;  1TUE B;  1VQL V;  1Q7Y W;  4QJF B;  1JPX A;  2XHB A;  1R3K C;  2JVD A;  4ZBM A;  1OZ0 A;  2KG7 A;  4J41 A;  1PL0 A;  2X6A A;  3LNN A;  4UXN A;  3IC7 A;  3SGI A;  3RYC B;  1XHX A;  1DLB A;  4FLW A;  4UCS A;  2OIE A;  2WLH A;  3AK3 A;  2DYR B;  1NH2 B;  2F23 A;  4LF5 B;  4PI2 A;  3RYC A;  1IUR A;  1E1Q G;  1IX9 A;  1YF2 A;  1VQ7 V;  1M90 W;  5E79 Z;  3KCX A;  3W7W A;  3AK1 A;  3CX5 F;  4I9Q A;  2CTQ A;  3CB2 A;  3JD3 A;  4BW5 A;  2YID A;  3OEH G;  2OWO A;  1XMQ B;  5C8Y B;  2ITC C;  3AG1 C;  4X64 B;  3JAW B;  1N0N A;  5BR8 O;  4YY3 O;  1VQO V;  1JA8 A;  1ARO P;  4HZ3 A;  3N27 A;  3E8H A;  5B66 Z;  4MTG A;  3CSX A;  5LL6 Y;  5C8Y A;  4DR6 B;  3JAW A;  3M8A A;  4GYC B;  4U7N A;  1HR0 O;  4GKK B;  1LUW A;  3FD9 A;  1NR7 A;  2GDS A;  4JI6 B;  4DK0 A;  3OR7 C;  3J80 N;  2FML A;  3WG7 C;  2MW2 B;  5LMN B;  5EBW C;  3S3X A;  1KYO F;  1X4T A;  3L74 H;  4LFB O;  1ZLZ A;  2ITD C;  4RUF A;  5IYB O;  3OAA G;  1ZL8 B;  2HHH B;  3X2Q C;  1OJH A;  5EBL C;  3TJT A;  3H01 A;  2GSM B;  2EUL A;  3QO7 A;  2Y0P A;  1ZL8 A;  4JI0 B;  1J5E B;  4FLY A;  3KCY A;  2XAS A;  2ILM A;  5BXZ A;  4AQY O;  2XND G;  2EZP A;  2RMK B;  2Q67 A;  5EC2 C;  2V4D A;  1PKX A;  2NLJ C;  3JD2 A;  1P49 A;  1QVF U;  1CPY A;  2QE7 G;  3E35 A;  4DR1 B;  3RYI B;  1EN4 A;  5HFM A;  4X65 O;  2GHY A;  5LGU A;  2AZ0 A;  1HNW B;  4LH7 A;  3FYE B;  1VQM V;  1FPO A;  3RYI A;  2JK5 C;  1R6K A;  1YDX A;  1QR8 A;  4NXM B;  3ZRX A;  3T4D A;  3K03 A;  2IJH A;  5LXT B;  5J9P C;  2GTS A;  3JAT B;  2Q0A A;  3CHX A;  3K59 A;  3ZED A;  1Q6U A;  3DC6 A;  5LHG A;  4J80 A;  3OMN B;  4O4I B;  1THZ A;  5LXT A;  3H1H H;  4JYY A;  3ZMS A;  1W0J G;  1OHH G;  3JAT A;  1Q6I A;  4K0K B;  2ZXW B;  2P90 A;  5KA6 A;  4O4I A;  4IYH A;  3CMA V;  4PI0 A;  4FK5 C;  5BZB A;  1J95 A;  2WA3 A;  1IBM O;  4OPH A;  1GM7 A;  3CP1 A;  4X9Q A;  1JNB A;  2EIM C;  2QJ1 A;  1AB3 A;  3RVZ A;  2HVJ C;  4JI5 O;  5KA5 A;  3BFR A;  1YCI A;  1SA0 B;  4DV7 B;  1I08 A;  5FPR A;  3P3P A;  1H5W A;  4LBE C;  2Q8V A;  1F4M A;  1JOY A;  1JCH A;  1AI4 A;  3W7X A;  1KMI Z;  1SA0 A;  2BSK B;  2BOB C;  3DGE A;  1I94 B;  2A9H A;  5KMG B;  1AR4 A;  1DTO A;  1MA1 A;  4NTY A;  4JTA B;  2EIM B;  2PI5 A;  3G6E V;  1M56 C;  3A0B Z;  2BSK A;  2F95 B;  2ZCE A;  4LH6 A;  1A32 A;  5KHJ A;  4MT8 A;  5IJ9 B;  3ZHR A;  5KMG A;  4DR4 B;  3OT7 A;  2IJK A;  1K5Q A;  4XDK A;  3ETG A;  1QR9 A;  5IJ9 A;  4MW3 A;  4I5S A;  4JYA B;  2CUG A;  3CCJ V;  4CC6 A;  1Q82 W;  3TXQ A;  2X0L A;  3UO2 A;  1PNL A;  4UVC A;  1YXB A;  4K3A A;  1K97 A;  4J7K A;  1URF A;  1XBL A;  5CBH A;  1ENV A;  1BQ0 A;  4DR7 O;  1OCO C;  4HAM A;  3ZHT A;  3STZ C;  4DV4 B;  1XQ8 A;  1KKD A;  2YXY A;  4QE7 A;  3WU2 Z;  2EJR A;  3KG2 A;  1K3E A;  4PA3 A;  4R7C A;  3BA8 A;  1V54 B;  1Y67 A;  2WLK A;  4LCU C;  2LW1 A;  1B06 A;  4WFB V;  2G38 A;  2F43 G;  4TQF A;  2A79 B;  4JI4 B;  2H8P C;  3ABU A;  3AG7 A;  4JYC A;  2Y4T A;  4FM1 A;  3ZCC A;  1K92 A;  1CXZ B;  1P7B A;  3F5T A;  3LUT B;  1BSM A;  1IBL O;  3RW0 A;  3HPL C;  4G2K A;  3ZS8 C;  4JTD B;  5JJE B;  4X62 O;  4H0L B;  2YXL A;  1SRY A;  1HP8 A;  4FLV A;  4R8C A;  1JVM A;  4UV8 A;  5EYP B;  3GVM A;  2R9R B;  2P4V A;  1VF5 B;  4DK1 A;  2QM7 A;  4CS2 A;  4EB6 B;  4KHP O;  2GTA A;  4WCE V;  2UUB B;  1VEW A;  5DEC A;  5EYP A;  1KBH A;  2O57 A;  3ZBH A;  2HFE C;  3AG4 C;  3CCQ V;  4DW0 A;  5CB4 B;  1DK1 A;  2ZE6 A;  5EIB C;  4EB6 A;  4WFA V;  5KAI Z;  2IJI A;  4BIZ A;  3E86 A;  1GM9 A;  4YJ3 B;  5LYJ B;  4LF9 O;  1PPJ H;  3OR6 C;  5CB4 A;  4YJ3 A;  5LYJ A;  3BHP A;  3HKC B;  4WF9 V;  1Q90 D;  2ODM A;  5B1N A;  2IJJ A;  4GX2 A;  2QWP B;  2VQF O;  2XAH A;  1S3J A;  5KUK A;  4N23 A;  4TQD A;  3HKC A;  3FB8 C;  4CH3 A;  5IYZ B;  3W7U A;  4YHH O;  3EVK A;  1VQP V;  3T1Y B;  3CEI A;  5H6Q A;  3F5W C;  5LGN A;  3CC7 V;  5IY5 B;  3UCS C;  2E5L B;  2P7T C;  1R3I C;  3IAY A;  5IYZ A;  2YI8 A;  4WBN B;  5H6R A;  4PEL A;  4A5U B;  4DV1 B;  2DJV A;  1N32 B;  3CC2 V;  3HKB B;  3UM7 A;  1OCR C;  1YEW A;  4MVU A;  1H2L A;  1Q43 A;  1U97 A;  4WBN A;  4JAU A;  1RSO B;  3JSN A;  4I4T B;  2W6I G;  1FFX B;  1HDJ A;  2BTO A;  2Y69 C;  3HKB A;  2ATK C;  5J2U B;  1HNX O;  1EBO A;  1M4U A;  1XL4 A;  4JI2 B;  1RFY A;  2P5O A;  4LFC O;  3TGU H;  1RSO A;  2UXB O;  2IW5 A;  1Z5V A;  5JCO C;  4I4T A;  1FFX A;  1FXK C;  4B3R B;  3H1I H;  5J2U A;  2JS5 A;  3K04 A;  4JI1 B;  3VQX A;  2UU9 O;  1OCR B;  3OTO O;  2IBZ H;  4O2A B;  1VMG A;  1N8R W;  4DR2 B;  1AP6 A;  2UXN A;  3G67 A;  4R50 A;  3KKY A;  2R72 A;  4B3M O;  4O2A A;  1GM8 A;  1GRJ A;  3ML0 A;  5JH7 B;  1JMK C;  3A0H Z;  1RPR A;  1FYJ A;  3L72 H;  5B1B C;  4MW8 A;  1AJP A;  2YSU B;  1KU9 A;  1VQ6 V;  1RM1 C;  3RGB A;  3AG2 B;  2N74 A;  4NYK A;  5FLX N;  4LR3 A;  3AG3 B;  5JH7 A;  2LW7 A;  2PUS A;  4DV3 B;  4X88 A;  4KXR A;  1BE3 H;  4GCZ A;  1SKV A;  1X59 A;  1SQP H;  4KL1 A;  2EIJ B;  2EIL B;  1S76 D;  1NI8 A;  2A06 H;  2V1D A;  4NXN B;  1VQN V;  1MSW D;  1JR9 A;  1KP2 A;  1K9M W;  3ASN C;  3ETD A;  4U3F H;  1K7D A;  2ZDI C;  1WN7 A;  4DV5 B;  1PP9 H;  1H2M A;  3CWB H;  1VQK V;  4L87 A;  1BMF G;  2OIG A;  5IWA O;  3UT5 B;  2DMX A;  3QVN A;  2HG5 C;  4LF7 O;  1K34 A;  1NH2 D;  2PYL A;  4P9O A;  3ZMU A;  3ZHU A;  3UT5 A;  4FFK A;  3ASN B;  2UUC O;  3I5D A;  1F7Y A;  2QM4 A;  2EIK B;  1QU7 A;  3RT3 C;  3APO A;  4K35 A;  1NU1 H;  2Z0A A;  1XNQ O;  1PL4 A;  4I50 B;  2Q73 A;  4QGP A;  3T1H O;  1MZF A;  1XNR B;  5LHI A;  5CA0 B;  1VQ9 V;  5IJ0 B;  4FM0 A;  3LSU A;  3G71 V;  4UVA A;  4LWS B;  2N04 A;  4I50 A;  5L3C A;  2ZM6 B;  2LFR A;  5FNV B;  5CA0 A;  1HW7 A;  2ZKO A;  5IJ0 A;  1AP5 A;  3E8B A;  4LWS A;  3BAA A;  1IBK B;  5FNV A;  5E1A C;  3HB3 B;  3T4Z A;  3M99 B;  3J81 N;  4LF5 O;  1XI1 A;  4UB8 Z;  3K79 A;  2VRZ A;  2F1M A;  1P7G A;  2B1I A;  3I56 V;  1XUQ A;  4ZOL B;  2ZQM A;  1PM9 A;  2QGN A;  4H33 A;  1IXB A;  4O4H B;  3OFN G;  1LR1 A;  1EZV H;  1ROP A;  3EFF K;  3RFR A;  2UXC B;  1OV9 A;  4ZOL A;  1UJW B;  4G28 B;  4DV6 O;  1XMQ O;  3B8M A;  1AR5 A;  2W0F C;  4O4H A;  2Q0O C;  2V7Q G;  2NN4 A;  3R66 A;  2ARH A;  4JPR A;  4YJ2 A;  3SPC A;  1K73 W;  5IE9 A;  3ETE A;  4B7E A;  1E79 G;  1I0H A;  2BTQ B;  4BIO A;  5D5P A;  1KP3 A;  1QLN A;  2CTP A;  1CEZ A;  4WFG A;  2P06 A;  2B1G A;  2CDY A;  5GTI Z;  4BIU A;  1H2K A;  3SYC A;  2BTQ A;  2OYQ A;  1AI5 A;  4NKG B;  3CCL V;  4D7T A;  2AW9 A;  4JI0 O;  1N33 B;  1J5E O;  1SQQ H;  2JEX A;  5HFL A;  2X7R B;  4HNA B;  4GKJ B; 
#chains in the Genus database with same CATH homology
 1KKC A;  1EM1 A;  1B06 A;  2GDS A;  1PL4 A;  2P4K A;  4BR6 A;  1XRE A;  4X9Q A;  1XIL A;  4JZG A;  3LSU A;  1N0J A;  1EN6 A;  3BFR A;  1ZLZ A;  1I08 A;  5AG2 A;  1AP5 A;  3DC5 A;  1WB8 A;  3TJT A;  1BSM A;  2ADQ B;  1GN6 A;  2RCV A;  1VAR A;  1AP6 A;  4YIP A;  1AVM A;  1BS3 A;  3C3S A;  3KKY A;  1BT8 A;  1AR4 A;  1MA1 A;  2QKA A;  3RN4 A;  4C7U A;  2ADP A;  1P7G A;  1XUQ A;  1GN2 A;  1VEW A;  1PM9 A;  1IXB A;  1SZX A;  3OT7 A;  1MNG A;  1EN4 A;  3AK2 A;  4JZ2 A;  1ZSP A;  4F6E A;  1AR5 A;  5A9G A;  1GN4 A;  1D5N A;  3AK3 A;  1QNM A;  3C3T A;  3MDS A;  1MMM A;  1JR9 A;  1LUV A;  2QKC A;  1IX9 A;  3K9S A;  3KDR A;  3AK1 A;  2CE4 A;  3IC9 A;  4YIO A;  1XDC A;  1ZTE A;  3DC6 A;  4GUN A;  3EVK A;  1I0H A;  3CEI A;  3QVN A;  4JYY A;  1MSD A;  1WB7 A;  1GN3 A;  1N0N A;  1ZUQ A;  2CDY A;  1JA8 A;  4FFK A;  2AW9 A;  1EN5 A;  1IDS A;  1Y67 A;  1LUW A;  4E4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...