3DC5A

Crystal structure of a manganese superoxide dismutases from caenorhabditis elegans
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
194
structure length
194
Chain Sequence
KHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn] 2
publication title Purification, crystallization and X-ray structures of the two manganese superoxide dismutases from Caenorhabditis elegans
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 76
structure length 194
sequence length 194
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3dc5A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3dc5A02
1PL4A 1MA1A 1EN4A 1XILA 1BS3A 1LUVA 4F6EA 4JZ2A 1ZUQA 2QKCA 1MMMA 3K9SA 3OT7A 4BR6A 4X9QA 2QKAA 4JZGA 3C3SA 1AR4A 3RN4A 1VEWA 1GN6A 1XDCA 1MNGA 1IX9A 1I0HA 3DC6A 3CEIA 1AVMA 1WB8A 3KKYA 2GDSA 1EM1A 1XREA 3LSUA 3QVNA 1I08A 1P7GA 4C7UA 2ADQB 4YIOA 4YIPA 1IXBA 1JA8A 1GN4A 2CDYA 4E4EA 1AP5A 2P4KA 1JR9A 1XUQA 1ZSPA 3EVKA 4JYYA 1GN2A 1SZXA 1MSDA 3IC9A 1VARA 3C3TA 4FFKA 1B06A 1AR5A 1N0JA 3MDSA 1IDSA 1EN6A 3TJTA 1WB7A 1BT8A 1AP6A 1KKCA 1PM9A 3AK2A 1QNMA 2AW9A 4GUNA 2CE4A 3DC5A 5AG2A 1ZLZA 1D5NA 3AK1A 3BFRA 1N0NA 1Y67A 1EN5A 1ZTEA 2RCVA 1GN3A 1BSMA 5A9GA 1LUWA 2ADPA 3AK3A
chains in the Genus database with same CATH superfamily
1E1RG 5CA1A 1BHBA 1Y74A 4DV6O 1Q6UA 1RPRA 4DUZB 1HWYA 3IAYA 5IYZA 2QKCA 2EILC 3HKDB 4F6RB 1QR8A 2LQTA 2Y69C 4R6ZA 2LGWA 4XDJA 1VQNV 1P4RA 2DYSC 1GKFA 2Z3YA 4LF8O 1W2BU 2P5OA 4DW0A 1Q7YW 5KHIA 3RFRA 4RQFA 1DF4A 3RYIB 4Q20A 4LBEC 2GHYA 1NS1A 3JAKA 1Q8IA 1B04A 2CUGA 2R9RB 5KAIZ 1PD3A 4QGPA 2W0FC 2P6JA 3Q4HA 1WB8A 3SR2C 2YEVA 1BCCH 4FPPA 3SJQC 2EINB 2WLJA 1NBMG 3E89A 1FXKA 2DWDC 1DGSA 4JYAB 3ZMVA 4YXWG 4GT1A 5CBFA 1MOFA 5CA3A 4OX9O 1AP5A 2N74A 1XUQA 1F4NA 1WAZA 4O4LA 4KXRA 5FNVA 2OCCB 4LF4O 4R7CA 5LBQA 3BRCA 5KA5A 4X66B 3PJSK 1Y76A 4JGSA 1N36B 3WFVA 4KP4A 4YHHB 3UT5B 3K79A 2VWJA 3SGIA 3FB5C 5BMVB 5L3DA 2ARHA 5B1NA 2MW2B 1JX9A 4JYBA 5H5NA 4UCOA 3J80N 4CH4A 2ZE8A 1I94O 4PJ0Z 4GUNA 2HG5C 2PUSA 4JV5O 4ZKIA 1GO3F 1D5NA 4MVZA 3P32A 3JALA 1ZTEA 4LF9B 3P30A 2PTMA 4MVSA 1XNQB 4NXNB 2LFSA 3BAAA 2XTAA 4NVPA 2PYJA 1BGYH 5LHGA 2Y4TA 1PNLA 4JTCB 2Q69A 3SPHA 4LFAO 4JI0O 1ZUQA 2RN9A 2P90A 1BE3H 2NLJC 4JI1B 4X9QA 4FFBA 4CS2A 3CCQV 1K7DA 3E8GA 3B8MA 3K9AA 4DR4B 3N2KB 5EZYB 4E2LA 1K3EA 4Z2WA 4IIJA 1YJNV 4ZOLA 4J10A 3SPCA 2JGDB 3CCSV 4FM0A 3T1CA 1FAFA 3QO7A 3LDDA 1V55C 2DW4A 3BABA 3TXQA 2CGNA 4MTGA 2E76B 4U3JA 3LSQA 3JD4A 3E35A 1KYOF 2P4KA 4TUYA 3D3QA 2IU0A 3N2GA 2WLLA 4DR6B 1SQQH 1M1KW 1N34O 3OD4A 4ZBMA 4EKWA 2QKSA 1N0JA 1VF6C 4FJCC 3FAVB 2OT5A 2CH7B 3J7AU 4WFHA 2HHHB 4MVQA 4PDLA 1KMIZ 2DQ0A 3ABMB 3M8AA 4O4JA 4UVBA 1KKCA 1PNMA 2EBOA 1IZ3A 4LWSA 2HLDG 3AK2A 1BL8A 5AG2A 2CTPA 2E75B 3T1YB 4GCZA 3RT3C 4DK0A 3MAQA 3B8NA 1IXMA 4W4LA 2EIJB 5CA0B 1J5EB 1YTFD 2R9IA 3ASNB 4CZZA 1GTOA 1L0LH 4J9ZB 3THOA 1OCRC 2EX3A 4DUYO 1YTFB 5EYPB 1QQCA 2JEXA 5LP6B 5JH7A 2V7QG 4FLTA 3AG1B 3RYFB 1X59A 1NH2D 4R50A 5EC2C 2KB1A 3LNMB 3OMIB 1NH2B 1D5AA 1UPGA 3W7XA 4O2AA 1GN6A 4UB6Z 1KECA 3F7VC 4J9YB 2RQ6A 4KL1A 1IBLB 3C90A 4X1KA 5CBGA 3BHPA 1ORQC 1SC5B 2JS3A 4IHJB 4LF7B 4X65B 1ZL8B 4I9QA 1FJGB 2CAZC 4PI0A 4U3FH 1XHXA 3HR0A 3WB0A 2EILB 4C7UA 2Y69B 1JFFB 2Y4UA 2DYSB 1SZXA 2VS0A 4ABMA 3KDRA 3CRCA 1DK1A 3OUFA 4JPRA 2ZR2A 1NKDA 3GWKC 5C8YB 3B09A 4UCVA 1SRYA 3CD6V 1SESA 3CMAV 4DR2O 2UXDO 3NR7A 5EIBC 4B3MO 1HNWB 5EBMC 1F51A 2RNBA 1WB7A 2VQEB 4PDRA 4FLYA 4QPKA 2AHZA 2IH1C 2PI5A 2BE3A 4I55A 1YI2V 3OR7C 3DC5A 1ZLZA 4LFBB 3ZN1A 2XOKG 1IBKO 4CH6A 5L3CA 2A9HA 1H8EG 4K35A 2WLKA 2YXLA 4JI4O 2ITCC 4J7KA 4BIUA 4G28B 2WPDG 2E3CA 1IJGA 3G4SV 5JJNB 3CX5F 3BA9A 5D5PA 1K33A 3BEHA 4KFMA 1IVSA 4JAVA 1JJOA 1HNZB 3OT7A 1JOYA 4B3RB 3L73H 1E79G 5J9PC 3C3SA 4P9PA 1K92A 4DR5O 1XOUA 4F6RA 3HKDA 5GONB 3SDLA 5J2TB 4DR3O 2QWOB 1I0HA 2ZDIA 1H5WA 1US6A 2Q6AA 4CS3A 3CRQA 3RYIA 3LDCA 2AXTZ 2G38A 3LSUA 4ZIBA 2ZQMA 1G6UA 2UXCO 4PI2A 2ADQB 2H8PC 2P06A 4MVRA 2UUBO 1YDXA 1H2NA 1JR9A 4CC5A 1S5HC 3ABUA 2X6BA 4PHZA 1MSDA 2Z5UA 1VARA 2JK5C 3TCUA 4GKJB 5LL6Y 5IYBO 4LF6O 1V55B 3BY6A 4GLXA 1KU9A 2X0LA 2FTKA 3E8BA 3QNEA 4HZ3A 1OCZB 2L35A 3A2FA 3E8HA 2OTJV 1H38A 1VQ9V 3H9VA 4I4TB 3UT5A 3OEEG 3APOA 5LHIA 5BMVA 1XL6A 1KB9F 4HYOA 5LHHA 4PA9A 4N23A 4JI3O 2GV9A 2HJFC 1NR7A 4X20B 3LSSA 1Y67A 1I5YA 2EJRA 1A32A 3CC7V 2JDIG 1BSMA 1M5IA 1GM8A 1MG1A 2V1DA 2IJIA 1EN4A 1N32O 1BS3A 3T4ZA 2YUAA 5JCOC 1N4CA 4DV0O 3JASB 2NN4A 1M9NA 2A3QA 4PDVA 4NR1A 3DGEA 4JI6O 4R8CA 1QLEC 3SPJA 2JJ1G 2JS5A 4DYLA 4BIOA 1M93A 3AEIA 3RBZA 4JV5B 3SYAA 3SJBC 4MS2A 3JATB 1FPOA 5EZYA 1NR1A 3JAMN 5GTIZ 2JGDA 3CRAA 2YC0A 4DV7B 4AI8A 3D8CA 3CCVV 3K58A 4O4HB 4E4EA 3J81N 2KKWA 1H2KA 4FZ1A 5B5EZ 2PI4A 3CRRA 3OTOO 1ENVA 3C3TA 2WLHA 1B06A 2R72A 1KC8W 2QE7G 2F4VB 4TQFA 3MDSA 5BR8B 1Y66A 1SKVA 3CJHB 3PN1A 5FLXN 3VBBA 3NXSA 1O9HA 2QDOA 1K73W 2DMXA 3FAVA 4O2BB 2CH7A 1QNMA 1Q82W 1VQ8V 1SQFA 5J2UB 3CCJV 3WB2A 1G8MA 4H37A 3L74H 2LGQA 2RCVA 3SYCA 5CBHA 1L1FA 1I5XA 4TT3G 5EIBD 3HKEB 1H8HG 3CXHF 1MA1A 3K5MA 5CA0A 4DR7B 4JZ2A 1SZTA 3OFNG 5IE9A 3ZBHA 3ZHRA 1N33B 5LA6B 3RW0A 1OCCC 3JSNA 5EYPA 3R66A 5LP6A 3W7WA 4HNAB 3RYFA 5KLVH 3F5TA 2KQXA 4I5SA 4DV4B 4LFCO 1FS0G 1WNSA 4EB6B 4FLVA 2ZM6O 5FPRA 4BW9A 2JIZG 1E1QG 4PV1B 2DQ3A 5HFLA 1VP7A 3KKYA 3ZHUA 1EM1A 5LGUA 4IT5A 4B3TO 4DUYB 4IHJA 3FB6C 3HKCB 1K5QA 1TA8A 1ZL8A 5F2VO 5LMNO 3RVZA 2UUAO 3JCZA 4QE7A 4CC6A 3D36C 1PL0A 5JJEB 1KBHA 3IC7A 4QIWF 1EN6A 2ZIMA 4H33A 5C8YA 3CRMA 4TSFG 1PM9A 2JEUA 1Y6XA 4X62O 2GSMB 1SERA 1QBZA 2WLMA 3FFQA 4UCTA 5ITZB 2ZD9A 2VQFO 3AG4B 2E74B 1XNRB 1R6TA 5GTHZ 2CK3G 4GX5A 1S5JA 2WLIB 3ZRVA 5LGTA 4W4KA 2N04A 4PA4A 3UO2A 4XBFA 2F43G 3BPZA 2ADPA 3AK3A 1MZEA 1RM1C 4IYHA 1WPXA 1COWG 1XQ8A 2LO1A 4BWAA 5JWPA 3JD3A 3ZS8C 3ZHSA 4EEQA 4ASUG 3T1HO 3A8TA 2Q9LA 3A0HZ 1KUQA 5B1BC 4FLXA 3HKBB 4LH6A 4NXMB 1RP3B 5KHJA 2CTQA 4B3MB 1EBOA 4WFGA 3FB8C 1VQ7V 3ZJZA 2OWOA 2DE0X 4EFEA 1Q5OA 5B1AC 3ZCCA 3FX7A 2QTSA 2HFEC 1NU1H 2BTQA 1TGOA 3OGIB 1IBKB 2UU9O 2Y0IA 3CC4V 3WU2Z 4X1YB 2UUCO 1XMOO 1EZJA 3SPIA 2E5LO 4JI4B 4TWKA 2GDSA 4FLUA 1YEWA 1SS3A 3DXRB 5J2TA 2LJ2A 1LNQA 4DXWA 1AI6A 1AI4A 3ZHTA 2R9AA 4B08A 3H1JH 1K4DC 2HKOA 1B3QA 3IFXA 1QLEB 3ZIAG 1HR0B 1G4YB 1K4CC 3STZC 3ZHVA 1T5EA 4BW5A 4PA6A 4KHPO 4RQEA 1XMQO 1U97A 1OCZC 1AJNA 4JYCA 3CCUV 1M90W 3BA8A 5LYJB 2XT9A 3G6EV 1AR1B 4UCSA 4DV5O 2HR3A 4UVAA 4GKKB 1R3LC 4UV8A 3BFRA 3ZMTA 4TOIA 1F23A 2AZ2A 3VOUA 3CWBH 2UXCB 3CCRV 1SQXH 3SJCC 4JF3A 3VQYA 4K8ZA 2IH3C 2YXHA 4X20A 3L72H 1IBMB 1H2LA 2X6CA 2XAJA 1AB3A 2IM9A 1PL4A 5LMUO 4MTOA 1XILA 2K1EA 4MVOA 2P22C 3CXCU 1PP9H 4X1IB 5EBWC 1VF6A 2UXXA 2OIEA 2DYRC 4DV2O 2CTWA 4K3AA 1WA8B 4JI8O 2X7RB 1LR1A 3K5OA 1XL4A 4MTXA 1S77D 3JASA 2QEXV 3I5DA 5KA6A 5KHHA 2OYQA 3P3NA 1UFIA 2LP7A 1MNGA 3L70H 1R73A 1K5SA 3JAWB 1AVMA 2A7WA 5KHGA 1L0NH 3JATA 4J41A 4DUZO 3ABKC 5DM6V 3O65A 3N27A 4U7OA 2GUZB 5IWAB 1OCCB 2Q4PA 1IXBA 3FKSG 1OZ0A 2DOSA 2ZXWC 1P49A 1ZSPA 3S3XA 2RMKB 1KP2A 4FFKA 4O4HA 5KUKA 1IURA 2QM7A 3A0RA 4YY3B 1Y74B 1IDSA 4CBCA 2XAFA 2QGNA 4A5UB 1BT8A 3E83A 4JYAO 3CJHA 4I0XB 3OEHG 2H3OA 5BXZA 1OCOC 1FXVA 1GM7A 4O2BA 5CN0A 1YITV 2ILMA 4J7ZA 3WB1A 5J2UA 4X66O 5EC1C 2F1MA 1N36O 3OTOB 2VRZA 3TETA 1AILA 2FB5A 4UCUA 5L3GA 3U10A 4ICGA 3ZMUA 3HKEA 2ZKOA 1VMGA 4O4IB 4JZGA 2W6JG 4PDMA 3KG2A 5JQGB 1XEQA 4IGGA 2LW7A 1SQVH 3RN4A 1XNQO 3FD9A 3UCSC 2BTOA 4JI5O 3ETQA 4JAUA 3E8FA 4NXNO 4DR1B 3EHBB 4HNAA 2D3OW 4DV1O 2MK3A 1IX9A 3DC6A 1RM1B 1JQ0A 4OXSA 3JARB 4EB6A 1P84F 2FL4A 3K5NA 3ZN0A 2FMLA 4D7SA 5B1BB 3EXAA 2QWPB 4PA3A 1Q6HA 1JA8A 1GN4A 1Z5VA 1YHQV 5B1AB 4G2KA 2WSSG 3HKCA 3ZMZA 2GTAA 2YICA 5EK0A 4NTXA 3MD0A 2BSKB 1BZKA 5H6QA 4Z1MG 3FB7C 4WFBV 2BCCH 3TXSA 3JD1A 2DN9A 2C2AA 2PF4E 3OR6C 4DV6B 3KZIZ 4MTFA 3AG4C 3UKMA 3ZX6A 3JD0A 4TV8B 1Z2GA 3OAAG 1FD9A 4FFBB 4B3TB 4WFEA 1EZVH 4WBNB 4LF8B 3STLC 1DLBA 4Q6GA 4DR6O 4YJ2B 2QM8A 5ITZA 4WF9V 5KUMA 3ABLC 3G80A 2EJ7A 1CPYA 2ETNA 1M56C 2WLIA 3G71V 1FFTB 2ZE5A 4U3JB 2KSDA 1KD1W 3K03A 5H2FZ 2QWQB 5KAFZ 3S3WA 2UXBO 1V54C 4NTWA 4D6TH 4BR6A 4WFAV 1XBLA 2AHYA 1WN7A 4DRXB 3I55V 3WG7C 3K59A 4OX9B 3T1YO 4X62B 3HKBA 4RUEA 4K0KO 4AHCA 2QM4A 1J5EO 4HBNA 4LF4B 3ETGA 4LH7A 4FM2A 2ZIOA 2A79B 1ZAUA 2LW1A 2DJVA 1XREA 2XNDG 4FLWA 4K8XA 2Y48A 4X1YA 1VF5B 3RWRD 1RPOA 2Y0PA 1ROPA 3T1HB 1I94B 2RJZA 1UJWB 5HFMA 3UO3A 5JCOA 3DXRA 2DYRB 4J42A 1XI1A 1NQTA 4J11A 5KX5B 4MW3A 2VWKA 3B40A 4JYYA 2F66C 3N2KA 1JVMA 1QVGU 1VF7A 1IBLO 3H1IH 4LF7O 1K34A 4J80A 1S3JA 3ICXA 4B3SO 1TVKB 3GB7C 1YF2A 4LFAB 2W6IG 4JI0B 3SPGA 4DV3O 4RUFA 5IJ0B 3ABKB 4CH3A 2PGGA 4TQDA 5LYJA 3SJAC 1SF9A 5GW7A 5IDJA 4ZHQB 2ZXWB 3ETDA 1ZX3A 1TAEA 1EN5A 3ZRXA 5IYDO 5KHKA 1BQ0A 5IY5C 4UB8Z 3X2QC 4P2ZA 3RVYA 1ZWIC 3JSLA 2HVKC 4X64O 3OMNB 5LOVB 3JD2A 4KHPB 3KCYA 2VQEO 4DO2A 4ZI7B 2Z0AA 1WP8A 3FYIB 2IU3A 2YDEA 3VQWA 4X1IA 2HJDA 2XUMA 4LFBO 2JGUA 1HNXO 4DV5B 1OCOB 3H01A 1HW7A 1N34B 1WA8A 1N8RW 1MZFA 4TV9B 4WCEV 5B66Z 1VIBA 1VQ5V 2QA4V 2ODMA 3JAWA 3G67A 4B3RO 2Q7GA 3OE7G 4H44B 1H2MA 2DWEC 2Q67A 3LDEA 3CSXA 1R6KA 2GUZA 3K08A 3IC9A 1F4MA 5B1OA 4OPHA 1TUEB 4JI8B 1QVFU 1AJPA 4LC1A 3AG2C 2EZPA 3LNNA 5E1AC 2BOBC 3O9OA 4RWUA 3ZRWB 2KG7B 4FIPC 4X89A 3H1LH 1PV0A 1DTOA 2WA3A 2A06H 3CCLV 4P9OA 2CE4A 1NT2B 2YIAA 1QCEA 2F23A 4D7TA 1JFFA 1SETA 1NTMH 4I0XA 2NR5A 4NTYA 4MSWC 1FXKC 1GN3A 1M57C 5A9GA 4GKJO 3SYPA 4XDLA 2Q0AA 2IJHA 5DN6G 4YJ3B 1YJWV 1FFXB 3I56V 3MHHC 3D36A 2A0LA 3IJ4A 3ZHQA 5KMGB 4O4IA 3EFFK 3ABLB 2EIKB 5JQGA 2XHBA 1XDCA 2ZCEA 5H9CA 3K06A 1M56B 4PA7A 3CEIA 3R65A 1Z5WA 2UXDB 4DR2B 3UM7A 1YSCA 2QWNB 3RYHB 3CC2V 1SA0B 4HAMA 5B3SC 3E22B 2B1IA 2M7WA 1WP7A 1V54B 4JI7O 3JARA 5LGNA 5DEDA 3WG7B 1R3KC 1DF5A 3LUTB 1NTZH 2Q7EA 4FK5C 5GONA 3F7YC 4AQYO 5K1XA 3DSQA 4H0LB 2AZ0A 5JVDB 4JI5B 4WFFA 1NVPD 3GWOA 4DV7O 2BSKA 4DV1B 2ZNJA 2ZINA 1NVPB 2B1GA 4QPJA 2EIMC 4MVMA 4NKGB 5L3FA 1S5LZ 3RYCB 1W59A 1N0NA 4I9WA 4JTAB 4DR5B 2Q7HA 4TV8A 1AJQA 1U96A 5CB4B 4WBNA 3QO5A 2F4VO 5FL7G 5BR8O 4DR3B 4YJ2A 1CXZB 4EFBA 3CCMV 5A2QN 1RSOB 2YIBD 1FXHA 2XAHA 3A0BZ 1CEZA 1K8AW 5IYCO 4LF5O 3L71H 2ITDC 4I50B 2P4VA 4L87A 4I4TA 1OV9A 5L3EA 2UUBB 2YSUB 4UCRA 3RGBA 1VEWA 2ZE6A 4LNUB 4DRXA 3CHXA 1JMKC 2ZT9B 5BZBA 5C93A 5IY5B 3X2QB 2IBZH 1VQ4V 3H1KH 4FM1A 4GX2A 3VQVA 3CP1A 4H13B 4LF6B 4DR7O 3OMAB 1SQPH 2YI8A 4FVMA 1N33O 4L8JA 4JASA 1AI7A 3QVNA 3W7TA 5K1PA 3W7SA 1KQSU 4JI2O 3SYOA 5L3BA 4YIOA 4YIPA 1VQLV 4JI3B 5D5QA 2UXBB 5IJ9B 1AI5A 3KCXA 2RDCA 4DV4O 4LCUC 2WAMA 4MW8A 1AR5A 1JPXA 2WWWA 1K97A 2M6YA 1URFA 1V9PA 3AG3C 5KX5A 3F5WC 1R3IC 1CP9A 4K0KB 2OCHA 1VQ6V 2V4DA 1R1BA 3SYQA 1EFRG 1N32B 4LR3A 1YIJV 3T2MA 1Y4MA 3QG5A 5LXTB 4UUJC 4DV0B 1PPJH 1TUBB 2PY5A 4UXNA 1TVKA 1RFYA 2QR4A 4Z1VA 4JI6B 2IW5A 5IJ0A 4G27B 4GZRB 2GTSA 3CCEV 5CA1B 3K0DA 1MABG 2F95B 4ZHQA 1LUWA 4FZ0A 4NB5A 5IYZB 3U11A 3AG2B 3IGAC 2K9PA 2D2CB 4UV9A 2JJ2G 2R70A 2PYLA 3JCUZ 1JNBA 2Q0OC 2UXNA 5LOVA 4IL6Z 4B3SB 1JJ2U 3P3PA 1HP8A 5BY1A 5H6RA 4DV3B 4BAYA 1XNRO 4OGQB 2QSAA 4ZI7A 3OW2U 3CE2A 3JAKB 1WJZA 2OIGA 3M99B 1PKXA 3Q4HB 2YEVB 1YVWA 3BVOA 4YHHO 3CMEV 1FXKB 1M57B 4AILC 2FKXA 4BIZA 1S0VA 1FOUA 3T4DA 3OTFA 4X64B 2F93B 4NXMO 1I08A 2LFRA 3ASOC 4O4LB 4TV9A 2JRIA 2L6LA 5LA6A 5FNVB 1I7FA 4LF9O 2GBOA 2ZR3A 1GAXA 1Y76B 1YXBA 1H2GA 1GN2A 2W0XA 1MSWD 3G6BA 1HNXB 4QE9A 4U7NA 4RO2A 2FYUH 1X4TA 4KUMA 1Q90D 3ZEDA 1G1XB 1QR9A 3H1HH 4JI1O 1R3JC 5B3SB 2X6AA 5TISZ 4DR4O 3JALB 4DK1A 2PZSA 1FYJA 2AW9A 4IYIA 3ZRWA 2KG7A 1HDJA 2YI9A 1VQKV 4B7KA 3AK1A 4QNHB 1R6NA 2ZDIC 1AROP 3GVMA 1HR0O 2BTQB 2O57A 4LFCB 1YJ9V 4OPAA 2B5UA 3ML0A 2YS8A 2YIDA 2ZM6B 2EINC 4MVUA 1LUVA 3E2EA 4P30A 1KP3A 4MT8A 1H2SB 3B77A 4YJ3A 1MMMA 3K9SA 2EZOA 3U0ZA 4IIJB 4PELA 1FFXA 3W7UA 4ZOLB 2Q68A 3JYCA 5LMNB 4GKKO 2EIMB 2QKAA 3TK1A 2H94A 2EIKC 2P67A 3K0GA 2Q5ZA 2N05A 3FYEB 1Q86W 1P7BA 2OCCC 1AR4A 2JVDA 2UUAB 1L8DA 2HHHO 1JCHA 1IBMO 1S76D 1KKDA 3L75H 1B6QA 2IJJA 3CPWU 2XAQA 5KMGA 1NI8A 2ZE7A 3MHSC 4TUYB 3N2GB 4B7EA 2WLLB 1NJIW 1P7GA 1Q6IA 2CDYA 2VQFB 2HVJC 2NNUA 1SA0A 4UVCA 3RYHA 3AG7A 3E22A 3EVKA 3B2EE 4FLZA 3QTCA 3L9DA 2ATKC 2YXYA 3QO8A 3M7MX 4F4LA 3DTUB 3B4SA 4O4JB 1QHTA 1QU7A 4LWSB 1YZBA 1BHAA 2IJKA 3TGUH 2CTRA 1SQBH 5IT9N 5DECA 1M4UA 5JVDA 2HEPA 1SQGA 4QJFB 5IWAO 1WPBA 2XAGA 3K5LA 5E79Z 4DW1A 1XHZA 1FKAO 2ZNIA 3ETEA 4JTDB 1W0JG 4JI7B 1WLEA 3APQA 1GMGA 3UQ8A 3RYCA 3BCCH 3CB2A 4X65O 2UU9B 4YY3O 5JH7B 1FJGO 3AG3B 4N21A 3QF7A 1PNKA 4I7ZB 5CB4A 4AQYB 2UUCB 4NYKA 1XMOB 2E5LB 4F6EA 4GYCB 3CS5A 1OHHG 4PD4F 2BOCC 2B9ZA 1THZA 1RSOA 1OCRB 2HP8A 2Q8VA 4UFZA 1BMFG 4O2AB 1NTKH 1Q43A 3CYOA 2YIBA 2WA4A 3D3IA 4GX0A 4X1KB 4I50A 3ZMSA 4J7JA 2QTOA 3ABTA 1HNWO 1W0KG 2XASA 1XMQB 3HPLC 4JAAA 2Q73A 2P7TC 1VQMV 4LNUA 1J95A 3ABMC 1BQZA 1QLNA 3VQXA 4CH5A 5JJJB 4XDKA 2WLNA 3K3WA 2OTLV 1GK9A 4LF5B 4FMTA 2EIJC 1OJHA 3OUSA 4LP8A 1GRJA 3K04A 1K9MW 1VQOV 1D2DA 4DR1O 3ASNC 1NZ6A 5IJ9A 4X8AA 5LMUB 4RAIA 4I55B 4GX1A 1HNZO 5LP6C 1Q3EA 3TJTA 1AP6A 2EULA 3HB3B 3AG1C 1F7YA 5CMUA 1S72V 3ASOB 1YCIA 3K57A 3ZRSA 4DV2B 1VQPV 1O9GA 4X88A 4JI2B 5LXTA 2QJ1A 2AGAA 5EBLC 1TUBA 3OGCC 3OM3B 5FPOA 1Q81W 1GM9A 4CS4A 2CGOA 3E86A 2QWRB 1GH6A
chains in the Genus database with same CATH topology
1PL4A 1MA1A 1EN4A 1XILA 1BS3A 1LUVA 4F6EA 4JZ2A 1ZUQA 2QKCA 1MMMA 3K9SA 3OT7A 4BR6A 4X9QA 2QKAA 4JZGA 3C3SA 1AR4A 3RN4A 1VEWA 1GN6A 1XDCA 1MNGA 1IX9A 1I0HA 3DC6A 3CEIA 1AVMA 1WB8A 3KKYA 2GDSA 1EM1A 1XREA 3LSUA 3QVNA 1I08A 1P7GA 4C7UA 2ADQB 4YIOA 4YIPA 1IXBA 1JA8A 1GN4A 2CDYA 4E4EA 1AP5A 2P4KA 1JR9A 1XUQA 1ZSPA 3EVKA 4JYYA 1GN2A 1SZXA 1MSDA 3IC9A 1VARA 3C3TA 3KDRA 4FFKA 1B06A 1AR5A 1N0JA 3MDSA 1IDSA 1EN6A 3TJTA 1WB7A 1BT8A 1AP6A 1KKCA 1PM9A 3AK2A 1QNMA 2AW9A 4GUNA 2CE4A 3DC5A 5AG2A 1ZLZA 1D5NA 3AK1A 3BFRA 1N0NA 1Y67A 1EN5A 1ZTEA 2RCVA 1GN3A 1BSMA 5A9GA 1LUWA 2ADPA 3AK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PL4 A;  1MA1 A;  1EN4 A;  1XIL A;  1BS3 A;  1LUV A;  4F6E A;  4JZ2 A;  1ZUQ A;  2QKC A;  1MMM A;  3K9S A;  3OT7 A;  4BR6 A;  4X9Q A;  2QKA A;  4JZG A;  3C3S A;  1AR4 A;  3RN4 A;  1VEW A;  1GN6 A;  1XDC A;  1MNG A;  1IX9 A;  1I0H A;  3DC6 A;  3CEI A;  1AVM A;  1WB8 A;  3KKY A;  2GDS A;  1EM1 A;  1XRE A;  3LSU A;  3QVN A;  1I08 A;  1P7G A;  4C7U A;  2ADQ B;  4YIO A;  4YIP A;  1IXB A;  1JA8 A;  1GN4 A;  2CDY A;  4E4E A;  1AP5 A;  2P4K A;  1JR9 A;  1XUQ A;  1ZSP A;  3EVK A;  4JYY A;  1GN2 A;  1SZX A;  1MSD A;  3IC9 A;  1VAR A;  3C3T A;  4FFK A;  1B06 A;  1AR5 A;  1N0J A;  3MDS A;  1IDS A;  1EN6 A;  3TJT A;  1WB7 A;  1BT8 A;  1AP6 A;  1KKC A;  1PM9 A;  3AK2 A;  1QNM A;  2AW9 A;  4GUN A;  2CE4 A;  3DC5 A;  5AG2 A;  1ZLZ A;  1D5N A;  3AK1 A;  3BFR A;  1N0N A;  1Y67 A;  1EN5 A;  1ZTE A;  2RCV A;  1GN3 A;  1BSM A;  5A9G A;  1LUW A;  2ADP A;  3AK3 A; 
#chains in the Genus database with same CATH topology
 1E1R G;  5CA1 A;  1BHB A;  1Y74 A;  4DV6 O;  1Q6U A;  1RPR A;  4DUZ B;  1HWY A;  3IAY A;  5IYZ A;  2QKC A;  2EIL C;  3HKD B;  4F6R B;  1QR8 A;  2LQT A;  2Y69 C;  4R6Z A;  2LGW A;  4XDJ A;  1VQN V;  1P4R A;  2DYS C;  1GKF A;  2Z3Y A;  4LF8 O;  1W2B U;  2P5O A;  4DW0 A;  1Q7Y W;  5KHI A;  3RFR A;  4RQF A;  1DF4 A;  3RYI B;  4Q20 A;  4LBE C;  2GHY A;  1NS1 A;  3JAK A;  1Q8I A;  1B04 A;  2CUG A;  2R9R B;  5KAI Z;  1PD3 A;  4QGP A;  2W0F C;  2P6J A;  3Q4H A;  1WB8 A;  3SR2 C;  2YEV A;  1BCC H;  4FPP A;  3SJQ C;  2EIN B;  2WLJ A;  1NBM G;  3E89 A;  1FXK A;  2DWD C;  1DGS A;  4JYA B;  3ZMV A;  4YXW G;  4GT1 A;  5CBF A;  1MOF A;  5CA3 A;  4OX9 O;  1AP5 A;  2N74 A;  1XUQ A;  1F4N A;  1WAZ A;  4O4L A;  4KXR A;  5FNV A;  2OCC B;  4LF4 O;  4R7C A;  5LBQ A;  3BRC A;  5KA5 A;  4X66 B;  3PJS K;  1Y76 A;  4JGS A;  1N36 B;  3WFV A;  4KP4 A;  4YHH B;  3UT5 B;  3K79 A;  2VWJ A;  3SGI A;  3FB5 C;  5BMV B;  5L3D A;  2ARH A;  5B1N A;  2MW2 B;  1JX9 A;  4JYB A;  5H5N A;  4UCO A;  3J80 N;  4CH4 A;  2ZE8 A;  1I94 O;  4PJ0 Z;  4GUN A;  2HG5 C;  2PUS A;  4JV5 O;  4ZKI A;  1GO3 F;  1D5N A;  4MVZ A;  3P32 A;  3JAL A;  1ZTE A;  4LF9 B;  3P30 A;  2PTM A;  4MVS A;  1XNQ B;  4NXN B;  2LFS A;  3BAA A;  2XTA A;  4NVP A;  2PYJ A;  1BGY H;  5LHG A;  2Y4T A;  1PNL A;  4JTC B;  2Q69 A;  3SPH A;  4LFA O;  4JI0 O;  1ZUQ A;  2RN9 A;  2P90 A;  1BE3 H;  2NLJ C;  4JI1 B;  4X9Q A;  4FFB A;  4CS2 A;  3CCQ V;  1K7D A;  3E8G A;  3B8M A;  3K9A A;  4DR4 B;  3N2K B;  5EZY B;  4E2L A;  1K3E A;  4Z2W A;  4IIJ A;  1YJN V;  4ZOL A;  4J10 A;  3SPC A;  2JGD B;  3CCS V;  4FM0 A;  3T1C A;  1FAF A;  3QO7 A;  3LDD A;  1V55 C;  2DW4 A;  3BAB A;  3TXQ A;  2CGN A;  4MTG A;  2E76 B;  4U3J A;  3LSQ A;  3JD4 A;  3E35 A;  1KYO F;  2P4K A;  4TUY A;  3D3Q A;  2IU0 A;  3N2G A;  2WLL A;  4DR6 B;  1SQQ H;  1M1K W;  1N34 O;  3OD4 A;  4ZBM A;  4EKW A;  2QKS A;  1N0J A;  1VF6 C;  4FJC C;  3FAV B;  2OT5 A;  2CH7 B;  3J7A U;  4WFH A;  2HHH B;  4MVQ A;  4PDL A;  1KMI Z;  2DQ0 A;  3ABM B;  3M8A A;  4O4J A;  4UVB A;  1KKC A;  1PNM A;  2EBO A;  1IZ3 A;  4LWS A;  2HLD G;  3AK2 A;  1BL8 A;  5AG2 A;  2CTP A;  2E75 B;  3T1Y B;  4GCZ A;  3RT3 C;  4DK0 A;  3MAQ A;  3B8N A;  1IXM A;  4W4L A;  2EIJ B;  5CA0 B;  1J5E B;  1YTF D;  2R9I A;  3ASN B;  4CZZ A;  1GTO A;  1L0L H;  4J9Z B;  3THO A;  1OCR C;  2EX3 A;  4DUY O;  1YTF B;  5EYP B;  1QQC A;  2JEX A;  5LP6 B;  5JH7 A;  2V7Q G;  4FLT A;  3AG1 B;  3RYF B;  1X59 A;  1NH2 D;  4R50 A;  5EC2 C;  2KB1 A;  3LNM B;  3OMI B;  1NH2 B;  1D5A A;  1UPG A;  3W7X A;  4O2A A;  1GN6 A;  4UB6 Z;  1KEC A;  3F7V C;  4J9Y B;  2RQ6 A;  4KL1 A;  1IBL B;  3C90 A;  4X1K A;  5CBG A;  3BHP A;  1ORQ C;  1SC5 B;  2JS3 A;  4IHJ B;  4LF7 B;  4X65 B;  1ZL8 B;  4I9Q A;  1FJG B;  2CAZ C;  4PI0 A;  4U3F H;  1XHX A;  3HR0 A;  3WB0 A;  2EIL B;  4C7U A;  2Y69 B;  1JFF B;  2Y4U A;  2DYS B;  1SZX A;  2VS0 A;  4ABM A;  3KDR A;  3CRC A;  1DK1 A;  3OUF A;  4JPR A;  2ZR2 A;  1NKD A;  3GWK C;  5C8Y B;  3B09 A;  4UCV A;  1SRY A;  3CD6 V;  1SES A;  3CMA V;  4DR2 O;  2UXD O;  3NR7 A;  5EIB C;  4B3M O;  1HNW B;  5EBM C;  1F51 A;  2RNB A;  1WB7 A;  2VQE B;  4PDR A;  4FLY A;  4QPK A;  2AHZ A;  2IH1 C;  2PI5 A;  2BE3 A;  4I55 A;  1YI2 V;  3OR7 C;  3DC5 A;  1ZLZ A;  4LFB B;  3ZN1 A;  2XOK G;  1IBK O;  4CH6 A;  5L3C A;  2A9H A;  1H8E G;  4K35 A;  2WLK A;  2YXL A;  4JI4 O;  2ITC C;  4J7K A;  4BIU A;  4G28 B;  2WPD G;  2E3C A;  1IJG A;  3G4S V;  5JJN B;  3CX5 F;  3BA9 A;  5D5P A;  1K33 A;  3BEH A;  4KFM A;  1IVS A;  4JAV A;  1JJO A;  1HNZ B;  3OT7 A;  1JOY A;  4B3R B;  3L73 H;  1E79 G;  5J9P C;  3C3S A;  4P9P A;  1K92 A;  4DR5 O;  1XOU A;  4F6R A;  3HKD A;  5GON B;  3SDL A;  5J2T B;  4DR3 O;  2QWO B;  1I0H A;  2ZDI A;  1H5W A;  1US6 A;  2Q6A A;  4CS3 A;  3CRQ A;  3RYI A;  3LDC A;  2AXT Z;  2G38 A;  3LSU A;  4ZIB A;  2ZQM A;  1G6U A;  2UXC O;  4PI2 A;  2ADQ B;  2H8P C;  2P06 A;  4MVR A;  2UUB O;  1YDX A;  1H2N A;  1JR9 A;  4CC5 A;  1S5H C;  3ABU A;  2X6B A;  4PHZ A;  1MSD A;  2Z5U A;  1VAR A;  2JK5 C;  3TCU A;  4GKJ B;  5LL6 Y;  5IYB O;  4LF6 O;  1V55 B;  3BY6 A;  4GLX A;  1KU9 A;  2X0L A;  2FTK A;  3E8B A;  3QNE A;  4HZ3 A;  1OCZ B;  2L35 A;  3A2F A;  3E8H A;  2OTJ V;  1H38 A;  1VQ9 V;  3H9V A;  4I4T B;  3UT5 A;  3OEE G;  3APO A;  5LHI A;  5BMV A;  1XL6 A;  1KB9 F;  4HYO A;  5LHH A;  4PA9 A;  4N23 A;  4JI3 O;  2GV9 A;  2HJF C;  1NR7 A;  4X20 B;  3LSS A;  1Y67 A;  1I5Y A;  2EJR A;  1A32 A;  3CC7 V;  2JDI G;  1BSM A;  1M5I A;  1GM8 A;  1MG1 A;  2V1D A;  2IJI A;  1EN4 A;  1N32 O;  1BS3 A;  3T4Z A;  2YUA A;  5JCO C;  1N4C A;  4DV0 O;  3JAS B;  2NN4 A;  1M9N A;  2A3Q A;  4PDV A;  4NR1 A;  3DGE A;  4JI6 O;  4R8C A;  1QLE C;  3SPJ A;  2JJ1 G;  2JS5 A;  4DYL A;  4BIO A;  1M93 A;  3AEI A;  3RBZ A;  4JV5 B;  3SYA A;  3SJB C;  4MS2 A;  3JAT B;  1FPO A;  5EZY A;  1NR1 A;  3JAM N;  5GTI Z;  2JGD A;  3CRA A;  2YC0 A;  4DV7 B;  4AI8 A;  3D8C A;  3CCV V;  3K58 A;  4O4H B;  4E4E A;  3J81 N;  2KKW A;  1H2K A;  4FZ1 A;  5B5E Z;  2PI4 A;  3CRR A;  3OTO O;  1ENV A;  3C3T A;  2WLH A;  1B06 A;  2R72 A;  1KC8 W;  2QE7 G;  2F4V B;  4TQF A;  3MDS A;  5BR8 B;  1Y66 A;  1SKV A;  3CJH B;  3PN1 A;  5FLX N;  3VBB A;  3NXS A;  1O9H A;  2QDO A;  1K73 W;  2DMX A;  3FAV A;  4O2B B;  2CH7 A;  1QNM A;  1Q82 W;  1VQ8 V;  1SQF A;  5J2U B;  3CCJ V;  3WB2 A;  1G8M A;  4H37 A;  3L74 H;  2LGQ A;  2RCV A;  3SYC A;  5CBH A;  1L1F A;  1I5X A;  4TT3 G;  5EIB D;  3HKE B;  1H8H G;  3CXH F;  1MA1 A;  3K5M A;  5CA0 A;  4DR7 B;  4JZ2 A;  1SZT A;  3OFN G;  5IE9 A;  3ZBH A;  3ZHR A;  1N33 B;  5LA6 B;  3RW0 A;  1OCC C;  3JSN A;  5EYP A;  3R66 A;  5LP6 A;  3W7W A;  4HNA B;  3RYF A;  5KLV H;  3F5T A;  2KQX A;  4I5S A;  4DV4 B;  4LFC O;  1FS0 G;  1WNS A;  4EB6 B;  4FLV A;  2ZM6 O;  5FPR A;  4BW9 A;  2JIZ G;  1E1Q G;  4PV1 B;  2DQ3 A;  5HFL A;  1VP7 A;  3KKY A;  3ZHU A;  1EM1 A;  5LGU A;  4IT5 A;  4B3T O;  4DUY B;  4IHJ A;  3FB6 C;  3HKC B;  1K5Q A;  1TA8 A;  1ZL8 A;  5F2V O;  5LMN O;  3RVZ A;  2UUA O;  3JCZ A;  4QE7 A;  4CC6 A;  3D36 C;  1PL0 A;  5JJE B;  1KBH A;  3IC7 A;  4QIW F;  1EN6 A;  2ZIM A;  4H33 A;  5C8Y A;  3CRM A;  4TSF G;  1PM9 A;  2JEU A;  1Y6X A;  4X62 O;  2GSM B;  1SER A;  1QBZ A;  2WLM A;  3FFQ A;  4UCT A;  5ITZ B;  2ZD9 A;  2VQF O;  3AG4 B;  2E74 B;  1XNR B;  1R6T A;  5GTH Z;  2CK3 G;  4GX5 A;  1S5J A;  2WLI B;  3ZRV A;  5LGT A;  4W4K A;  2N04 A;  4PA4 A;  3UO2 A;  4XBF A;  2F43 G;  3BPZ A;  2ADP A;  3AK3 A;  1MZE A;  1RM1 C;  4IYH A;  1WPX A;  1COW G;  1XQ8 A;  2LO1 A;  4BWA A;  5JWP A;  3JD3 A;  3ZS8 C;  3ZHS A;  4EEQ A;  4ASU G;  3T1H O;  3A8T A;  2Q9L A;  3A0H Z;  1KUQ A;  5B1B C;  4FLX A;  3HKB B;  4LH6 A;  4NXM B;  1RP3 B;  5KHJ A;  2CTQ A;  4B3M B;  1EBO A;  4WFG A;  3FB8 C;  1VQ7 V;  3ZJZ A;  2OWO A;  2DE0 X;  4EFE A;  1Q5O A;  5B1A C;  3ZCC A;  3FX7 A;  2QTS A;  2HFE C;  1NU1 H;  2BTQ A;  1TGO A;  3OGI B;  1IBK B;  2UU9 O;  2Y0I A;  3CC4 V;  3WU2 Z;  4X1Y B;  2UUC O;  1XMO O;  1EZJ A;  3SPI A;  2E5L O;  4JI4 B;  4TWK A;  2GDS A;  4FLU A;  1YEW A;  1SS3 A;  3DXR B;  5J2T A;  2LJ2 A;  1LNQ A;  4DXW A;  1AI6 A;  1AI4 A;  3ZHT A;  2R9A A;  4B08 A;  3H1J H;  1K4D C;  2HKO A;  1B3Q A;  3IFX A;  1QLE B;  3ZIA G;  1HR0 B;  1G4Y B;  1K4C C;  3STZ C;  3ZHV A;  1T5E A;  4BW5 A;  4PA6 A;  4KHP O;  4RQE A;  1XMQ O;  1U97 A;  1OCZ C;  1AJN A;  4JYC A;  3CCU V;  1M90 W;  3BA8 A;  5LYJ B;  2XT9 A;  3G6E V;  1AR1 B;  4UCS A;  4DV5 O;  2HR3 A;  4UVA A;  4GKK B;  1R3L C;  4UV8 A;  3BFR A;  3ZMT A;  4TOI A;  1F23 A;  2AZ2 A;  3VOU A;  3CWB H;  2UXC B;  3CCR V;  1SQX H;  3SJC C;  4JF3 A;  3VQY A;  4K8Z A;  2IH3 C;  2YXH A;  4X20 A;  3L72 H;  1IBM B;  1H2L A;  2X6C A;  2XAJ A;  1AB3 A;  2IM9 A;  1PL4 A;  5LMU O;  4MTO A;  1XIL A;  2K1E A;  4MVO A;  2P22 C;  3CXC U;  1PP9 H;  4X1I B;  5EBW C;  1VF6 A;  2UXX A;  2OIE A;  2DYR C;  4DV2 O;  2CTW A;  4K3A A;  1WA8 B;  4JI8 O;  2X7R B;  1LR1 A;  3K5O A;  1XL4 A;  4MTX A;  1S77 D;  3JAS A;  2QEX V;  3I5D A;  5KA6 A;  5KHH A;  2OYQ A;  3P3N A;  1UFI A;  2LP7 A;  1MNG A;  3L70 H;  1R73 A;  1K5S A;  3JAW B;  1AVM A;  2A7W A;  5KHG A;  1L0N H;  3JAT A;  4J41 A;  4DUZ O;  3ABK C;  5DM6 V;  3O65 A;  3N27 A;  4U7O A;  2GUZ B;  5IWA B;  1OCC B;  2Q4P A;  1IXB A;  3FKS G;  1OZ0 A;  2DOS A;  2ZXW C;  1P49 A;  1ZSP A;  3S3X A;  2RMK B;  1KP2 A;  4FFK A;  4O4H A;  5KUK A;  1IUR A;  2QM7 A;  3A0R A;  4YY3 B;  1Y74 B;  1IDS A;  4CBC A;  2XAF A;  2QGN A;  4A5U B;  1BT8 A;  3E83 A;  4JYA O;  3CJH A;  4I0X B;  3OEH G;  2H3O A;  5BXZ A;  1OCO C;  1FXV A;  1GM7 A;  4O2B A;  5CN0 A;  1YIT V;  2ILM A;  4J7Z A;  3WB1 A;  5J2U A;  4X66 O;  5EC1 C;  2F1M A;  1N36 O;  3OTO B;  2VRZ A;  3TET A;  1AIL A;  2FB5 A;  4UCU A;  5L3G A;  3U10 A;  4ICG A;  3ZMU A;  3HKE A;  2ZKO A;  1VMG A;  4O4I B;  4JZG A;  2W6J G;  4PDM A;  3KG2 A;  5JQG B;  1XEQ A;  4IGG A;  2LW7 A;  1SQV H;  3RN4 A;  1XNQ O;  3FD9 A;  3UCS C;  2BTO A;  4JI5 O;  3ETQ A;  4JAU A;  3E8F A;  4NXN O;  4DR1 B;  3EHB B;  4HNA A;  2D3O W;  4DV1 O;  2MK3 A;  1IX9 A;  3DC6 A;  1RM1 B;  1JQ0 A;  4OXS A;  3JAR B;  4EB6 A;  1P84 F;  2FL4 A;  3K5N A;  3ZN0 A;  2FML A;  4D7S A;  5B1B B;  3EXA A;  2QWP B;  4PA3 A;  1Q6H A;  1JA8 A;  1GN4 A;  1Z5V A;  1YHQ V;  5B1A B;  4G2K A;  2WSS G;  3HKC A;  3ZMZ A;  2GTA A;  2YIC A;  5EK0 A;  4NTX A;  3MD0 A;  2BSK B;  1BZK A;  5H6Q A;  4Z1M G;  3FB7 C;  4WFB V;  2BCC H;  3TXS A;  3JD1 A;  2DN9 A;  2C2A A;  2PF4 E;  3OR6 C;  4DV6 B;  3KZI Z;  4MTF A;  3AG4 C;  3UKM A;  3ZX6 A;  3JD0 A;  4TV8 B;  1Z2G A;  3OAA G;  1FD9 A;  4FFB B;  4B3T B;  4WFE A;  1EZV H;  4WBN B;  4LF8 B;  3STL C;  1DLB A;  4Q6G A;  4DR6 O;  4YJ2 B;  2QM8 A;  5ITZ A;  4WF9 V;  5KUM A;  3ABL C;  3G80 A;  2EJ7 A;  1CPY A;  2ETN A;  1M56 C;  2WLI A;  3G71 V;  1FFT B;  2ZE5 A;  4U3J B;  2KSD A;  1KD1 W;  3K03 A;  5H2F Z;  2QWQ B;  5KAF Z;  3S3W A;  2UXB O;  1V54 C;  4NTW A;  4D6T H;  4BR6 A;  4WFA V;  1XBL A;  2AHY A;  1WN7 A;  4DRX B;  3I55 V;  3WG7 C;  3K59 A;  4OX9 B;  3T1Y O;  4X62 B;  3HKB A;  4RUE A;  4K0K O;  4AHC A;  2QM4 A;  1J5E O;  4HBN A;  4LF4 B;  3ETG A;  4LH7 A;  4FM2 A;  2ZIO A;  2A79 B;  1ZAU A;  2LW1 A;  2DJV A;  1XRE A;  2XND G;  4FLW A;  4K8X A;  2Y48 A;  4X1Y A;  1VF5 B;  3RWR D;  1RPO A;  2Y0P A;  1ROP A;  3T1H B;  1I94 B;  2RJZ A;  1UJW B;  5HFM A;  3UO3 A;  5JCO A;  3DXR A;  2DYR B;  4J42 A;  1XI1 A;  1NQT A;  4J11 A;  5KX5 B;  4MW3 A;  2VWK A;  3B40 A;  4JYY A;  2F66 C;  3N2K A;  1JVM A;  1QVG U;  1VF7 A;  1IBL O;  3H1I H;  4LF7 O;  1K34 A;  4J80 A;  1S3J A;  3ICX A;  4B3S O;  1TVK B;  3GB7 C;  1YF2 A;  4LFA B;  2W6I G;  4JI0 B;  3SPG A;  4DV3 O;  4RUF A;  5IJ0 B;  3ABK B;  4CH3 A;  2PGG A;  4TQD A;  5LYJ A;  3SJA C;  1SF9 A;  5GW7 A;  5IDJ A;  4ZHQ B;  2ZXW B;  3ETD A;  1ZX3 A;  1TAE A;  1EN5 A;  3ZRX A;  5IYD O;  5KHK A;  1BQ0 A;  5IY5 C;  4UB8 Z;  3X2Q C;  4P2Z A;  3RVY A;  1ZWI C;  3JSL A;  2HVK C;  4X64 O;  3OMN B;  5LOV B;  3JD2 A;  4KHP B;  3KCY A;  2VQE O;  4DO2 A;  4ZI7 B;  2Z0A A;  1WP8 A;  3FYI B;  2IU3 A;  2YDE A;  3VQW A;  4X1I A;  2HJD A;  2XUM A;  4LFB O;  2JGU A;  1HNX O;  4DV5 B;  1OCO B;  3H01 A;  1HW7 A;  1N34 B;  1WA8 A;  1N8R W;  1MZF A;  4TV9 B;  4WCE V;  5B66 Z;  1VIB A;  1VQ5 V;  2QA4 V;  2ODM A;  3JAW A;  3G67 A;  4B3R O;  2Q7G A;  3OE7 G;  4H44 B;  1H2M A;  2DWE C;  2Q67 A;  3LDE A;  3CSX A;  1R6K A;  2GUZ A;  3K08 A;  3IC9 A;  1F4M A;  5B1O A;  4OPH A;  1TUE B;  4JI8 B;  1QVF U;  1AJP A;  4LC1 A;  3AG2 C;  2EZP A;  3LNN A;  5E1A C;  2BOB C;  3O9O A;  4RWU A;  3ZRW B;  2KG7 B;  4FIP C;  4X89 A;  3H1L H;  1PV0 A;  1DTO A;  2WA3 A;  2A06 H;  3CCL V;  4P9O A;  2CE4 A;  1NT2 B;  2YIA A;  1QCE A;  2F23 A;  4D7T A;  1JFF A;  1SET A;  1NTM H;  4I0X A;  2NR5 A;  4NTY A;  4MSW C;  1FXK C;  1GN3 A;  1M57 C;  5A9G A;  4GKJ O;  3SYP A;  4XDL A;  2Q0A A;  2IJH A;  5DN6 G;  4YJ3 B;  1YJW V;  1FFX B;  3I56 V;  3MHH C;  3D36 A;  2A0L A;  3IJ4 A;  3ZHQ A;  5KMG B;  4O4I A;  3EFF K;  3ABL B;  2EIK B;  5JQG A;  2XHB A;  1XDC A;  2ZCE A;  5H9C A;  3K06 A;  1M56 B;  4PA7 A;  3CEI A;  3R65 A;  1Z5W A;  2UXD B;  4DR2 B;  3UM7 A;  1YSC A;  2QWN B;  3RYH B;  3CC2 V;  1SA0 B;  4HAM A;  5B3S C;  3E22 B;  2B1I A;  2M7W A;  1WP7 A;  1V54 B;  4JI7 O;  3JAR A;  5LGN A;  5DED A;  3WG7 B;  1R3K C;  1DF5 A;  3LUT B;  1NTZ H;  2Q7E A;  4FK5 C;  5GON A;  3F7Y C;  4AQY O;  5K1X A;  3DSQ A;  4H0L B;  2AZ0 A;  5JVD B;  4JI5 B;  4WFF A;  1NVP D;  3GWO A;  4DV7 O;  2BSK A;  4DV1 B;  2ZNJ A;  2ZIN A;  1NVP B;  2B1G A;  4QPJ A;  2EIM C;  4MVM A;  4NKG B;  5L3F A;  1S5L Z;  3RYC B;  1W59 A;  1N0N A;  4I9W A;  4JTA B;  4DR5 B;  2Q7H A;  4TV8 A;  1AJQ A;  1U96 A;  5CB4 B;  4WBN A;  3QO5 A;  2F4V O;  5FL7 G;  5BR8 O;  4DR3 B;  4YJ2 A;  1CXZ B;  4EFB A;  3CCM V;  5A2Q N;  1RSO B;  2YIB D;  1FXH A;  2XAH A;  3A0B Z;  1CEZ A;  1K8A W;  5IYC O;  4LF5 O;  3L71 H;  2ITD C;  4I50 B;  2P4V A;  4L87 A;  4I4T A;  1OV9 A;  5L3E A;  2UUB B;  2YSU B;  4UCR A;  3RGB A;  1VEW A;  2ZE6 A;  4LNU B;  4DRX A;  3CHX A;  1JMK C;  2ZT9 B;  5BZB A;  5C93 A;  5IY5 B;  3X2Q B;  2IBZ H;  1VQ4 V;  3H1K H;  4FM1 A;  4GX2 A;  3VQV A;  3CP1 A;  4H13 B;  4LF6 B;  4DR7 O;  3OMA B;  1SQP H;  2YI8 A;  4FVM A;  1N33 O;  4L8J A;  4JAS A;  1AI7 A;  3QVN A;  3W7T A;  5K1P A;  3W7S A;  1KQS U;  4JI2 O;  3SYO A;  5L3B A;  4YIO A;  4YIP A;  1VQL V;  4JI3 B;  5D5Q A;  2UXB B;  5IJ9 B;  1AI5 A;  3KCX A;  2RDC A;  4DV4 O;  4LCU C;  2WAM A;  4MW8 A;  1AR5 A;  1JPX A;  2WWW A;  1K97 A;  2M6Y A;  1URF A;  1V9P A;  3AG3 C;  5KX5 A;  3F5W C;  1R3I C;  1CP9 A;  4K0K B;  2OCH A;  1VQ6 V;  2V4D A;  1R1B A;  3SYQ A;  1EFR G;  1N32 B;  4LR3 A;  1YIJ V;  3T2M A;  1Y4M A;  3QG5 A;  5LXT B;  4UUJ C;  4DV0 B;  1PPJ H;  1TUB B;  2PY5 A;  4UXN A;  1TVK A;  1RFY A;  2QR4 A;  4Z1V A;  4JI6 B;  2IW5 A;  5IJ0 A;  4G27 B;  4GZR B;  2GTS A;  3CCE V;  5CA1 B;  3K0D A;  1MAB G;  2F95 B;  4ZHQ A;  1LUW A;  4FZ0 A;  4NB5 A;  5IYZ B;  3U11 A;  3AG2 B;  3IGA C;  2K9P A;  2D2C B;  4UV9 A;  2JJ2 G;  2R70 A;  2PYL A;  3JCU Z;  1JNB A;  2Q0O C;  2UXN A;  5LOV A;  4IL6 Z;  4B3S B;  1JJ2 U;  3P3P A;  1HP8 A;  5BY1 A;  5H6R A;  4DV3 B;  4BAY A;  1XNR O;  4OGQ B;  2QSA A;  4ZI7 A;  3OW2 U;  3CE2 A;  3JAK B;  1WJZ A;  2OIG A;  3M99 B;  1PKX A;  3Q4H B;  2YEV B;  1YVW A;  3BVO A;  4YHH O;  3CME V;  1FXK B;  1M57 B;  4AIL C;  2FKX A;  4BIZ A;  1S0V A;  1FOU A;  3T4D A;  3OTF A;  4X64 B;  2F93 B;  4NXM O;  1I08 A;  2LFR A;  3ASO C;  4O4L B;  4TV9 A;  2JRI A;  2L6L A;  5LA6 A;  5FNV B;  1I7F A;  4LF9 O;  2GBO A;  2ZR3 A;  1GAX A;  1Y76 B;  1YXB A;  1H2G A;  1GN2 A;  2W0X A;  1MSW D;  3G6B A;  1HNX B;  4QE9 A;  4U7N A;  4RO2 A;  2FYU H;  1X4T A;  4KUM A;  1Q90 D;  3ZED A;  1G1X B;  1QR9 A;  3H1H H;  4JI1 O;  1R3J C;  5B3S B;  2X6A A;  5TIS Z;  4DR4 O;  3JAL B;  4DK1 A;  2PZS A;  1FYJ A;  2AW9 A;  4IYI A;  3ZRW A;  2KG7 A;  1HDJ A;  2YI9 A;  1VQK V;  4B7K A;  3AK1 A;  4QNH B;  1R6N A;  2ZDI C;  1ARO P;  3GVM A;  1HR0 O;  2BTQ B;  2O57 A;  4LFC B;  1YJ9 V;  4OPA A;  2B5U A;  3ML0 A;  2YS8 A;  2YID A;  2ZM6 B;  2EIN C;  4MVU A;  1LUV A;  3E2E A;  4P30 A;  1KP3 A;  4MT8 A;  1H2S B;  3B77 A;  4YJ3 A;  1MMM A;  3K9S A;  2EZO A;  3U0Z A;  4IIJ B;  4PEL A;  1FFX A;  3W7U A;  4ZOL B;  2Q68 A;  3JYC A;  5LMN B;  4GKK O;  2EIM B;  2QKA A;  3TK1 A;  2H94 A;  2EIK C;  2P67 A;  3K0G A;  2Q5Z A;  2N05 A;  3FYE B;  1Q86 W;  1P7B A;  2OCC C;  1AR4 A;  2JVD A;  2UUA B;  1L8D A;  2HHH O;  1JCH A;  1IBM O;  1S76 D;  1KKD A;  3L75 H;  1B6Q A;  2IJJ A;  3CPW U;  2XAQ A;  5KMG A;  1NI8 A;  2ZE7 A;  3MHS C;  4TUY B;  3N2G B;  4B7E A;  2WLL B;  1NJI W;  1P7G A;  1Q6I A;  2CDY A;  2VQF B;  2HVJ C;  2NNU A;  1SA0 A;  4UVC A;  3RYH A;  3AG7 A;  3E22 A;  3EVK A;  3B2E E;  4FLZ A;  3QTC A;  3L9D A;  2ATK C;  2YXY A;  3QO8 A;  3M7M X;  4F4L A;  3DTU B;  3B4S A;  4O4J B;  1QHT A;  1QU7 A;  4LWS B;  1YZB A;  1BHA A;  2IJK A;  3TGU H;  2CTR A;  1SQB H;  5IT9 N;  5DEC A;  1M4U A;  5JVD A;  2HEP A;  1SQG A;  4QJF B;  5IWA O;  1WPB A;  2XAG A;  3K5L A;  5E79 Z;  4DW1 A;  1XHZ A;  1FKA O;  2ZNI A;  3ETE A;  4JTD B;  1W0J G;  4JI7 B;  1WLE A;  3APQ A;  1GMG A;  3UQ8 A;  3RYC A;  3BCC H;  3CB2 A;  4X65 O;  2UU9 B;  4YY3 O;  5JH7 B;  1FJG O;  3AG3 B;  4N21 A;  3QF7 A;  1PNK A;  4I7Z B;  5CB4 A;  4AQY B;  2UUC B;  4NYK A;  1XMO B;  2E5L B;  4F6E A;  4GYC B;  3CS5 A;  1OHH G;  4PD4 F;  2BOC C;  2B9Z A;  1THZ A;  1RSO A;  1OCR B;  2HP8 A;  2Q8V A;  4UFZ A;  1BMF G;  4O2A B;  1NTK H;  1Q43 A;  3CYO A;  2YIB A;  2WA4 A;  3D3I A;  4GX0 A;  4X1K B;  4I50 A;  3ZMS A;  4J7J A;  2QTO A;  3ABT A;  1HNW O;  1W0K G;  2XAS A;  1XMQ B;  3HPL C;  4JAA A;  2Q73 A;  2P7T C;  1VQM V;  4LNU A;  1J95 A;  3ABM C;  1BQZ A;  1QLN A;  3VQX A;  4CH5 A;  5JJJ B;  4XDK A;  2WLN A;  3K3W A;  2OTL V;  1GK9 A;  4LF5 B;  4FMT A;  2EIJ C;  1OJH A;  3OUS A;  4LP8 A;  1GRJ A;  3K04 A;  1K9M W;  1VQO V;  1D2D A;  4DR1 O;  3ASN C;  1NZ6 A;  5IJ9 A;  4X8A A;  5LMU B;  4RAI A;  4I55 B;  4GX1 A;  1HNZ O;  5LP6 C;  1Q3E A;  3TJT A;  1AP6 A;  2EUL A;  3HB3 B;  3AG1 C;  1F7Y A;  5CMU A;  1S72 V;  3ASO B;  1YCI A;  3K57 A;  3ZRS A;  4DV2 B;  1VQP V;  1O9G A;  4X88 A;  4JI2 B;  5LXT A;  2QJ1 A;  2AGA A;  5EBL C;  1TUB A;  3OGC C;  3OM3 B;  5FPO A;  1Q81 W;  1GM9 A;  4CS4 A;  2CGO A;  3E86 A;  2QWR B;  1GH6 A; 
#chains in the Genus database with same CATH homology
 1PL4 A;  1MA1 A;  1EN4 A;  1XIL A;  1BS3 A;  1LUV A;  4F6E A;  4JZ2 A;  1ZUQ A;  2QKC A;  1MMM A;  3K9S A;  3OT7 A;  4BR6 A;  4X9Q A;  2QKA A;  4JZG A;  3C3S A;  1AR4 A;  3RN4 A;  1VEW A;  1GN6 A;  1XDC A;  1MNG A;  1IX9 A;  1I0H A;  3DC6 A;  3CEI A;  1AVM A;  1WB8 A;  3KKY A;  2GDS A;  1EM1 A;  1XRE A;  3LSU A;  3QVN A;  1I08 A;  1P7G A;  4C7U A;  2ADQ B;  4YIO A;  4YIP A;  1IXB A;  1JA8 A;  1GN4 A;  2CDY A;  4E4E A;  1AP5 A;  2P4K A;  1JR9 A;  1XUQ A;  1ZSP A;  3EVK A;  4JYY A;  1GN2 A;  1SZX A;  1MSD A;  3IC9 A;  1VAR A;  3C3T A;  3KDR A;  4FFK A;  1B06 A;  1AR5 A;  1N0J A;  3MDS A;  1IDS A;  1EN6 A;  3TJT A;  1WB7 A;  1BT8 A;  1AP6 A;  1KKC A;  1PM9 A;  3AK2 A;  1QNM A;  2AW9 A;  4GUN A;  2CE4 A;  3DC5 A;  5AG2 A;  1ZLZ A;  1D5N A;  3AK1 A;  3BFR A;  1N0N A;  1Y67 A;  1EN5 A;  1ZTE A;  2RCV A;  1GN3 A;  1BSM A;  5A9G A;  1LUW A;  2ADP A;  3AK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...