1D5NA

Crystal structure of e. coli mnsod at 100k
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (MANGANESE SUPEROXIDE DISMUTASE)
publication title Cryo-trapping the six-coordinate, distorted-octahedral active site of manganese superoxide dismutase.
pubmed doi rcsb
total genus 72
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1999-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1d5nA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1d5nA02
1GN6A 1ZLZA 2QKAA 1AP6A 1ZUQA 2AW9A 1PM9A 1KKCA 1PL4A 3C3SA 1AR4A 1XILA 1SZXA 3KKYA 1VEWA 1I0HA 4YIOA 1BT8A 1QNMA 2CE4A 2ADQB 1GN3A 1JR9A 3AK2A 1XREA 4JYYA 3LSUA 3DC6A 1P7GA 3QVNA 1N0JA 4BR6A 5A9GA 1EN4A 2CDYA 4F6EA 1MA1A 2RCVA 1IXBA 1AP5A 3C3TA 1MMMA 4GUNA 4JZ2A 1EN6A 3MDSA 3AK3A 1VARA 1I08A 1WB7A 1EN5A 1IDSA 1MSDA 4FFKA 1D5NA 3K9SA 1AR5A 1BSMA 1GN2A 1MNGA 1ZSPA 4YIPA 3BFRA 1IX9A 3RN4A 3IC9A 1EM1A 1Y67A 3TJTA 1GN4A 4JZGA 3CEIA 4X9QA 2ADPA 5AG2A 3AK1A 1XUQA 1LUWA 1AVMA 4E4EA 2GDSA 2QKCA 3EVKA 1N0NA 1WB8A 1XDCA 1ZTEA 1B06A 3DC5A 1LUVA 2P4KA 4C7UA 1BS3A 3OT7A 1JA8A
chains in the Genus database with same CATH superfamily
1YSCA 2Y0PA 1LR1A 1SS3A 1EZVH 1OCCC 2LGQA 2RDCA 3G6BA 4PD4F 2O57A 2Q0OC 3ABLC 2CGNA 2ZM6O 1YHQV 5GONB 1PM9A 2X7RB 4JPRA 4JTDB 3ASNC 2P6JA 1VMGA 2PI5A 4J11A 1FFXA 2F95B 4MT8A 5BY1A 3W7WA 4KUMA 2P67A 3ABUA 1JFFA 2JGDA 4PELA 4JI1B 4CH5A 3UCSC 1HNXO 5J2TA 2Q7GA 4PA3A 2IJHA 3JAWA 1B04A 4NXMO 2JDIG 1S5HC 4OXSA 2WLIB 3N2GB 2JGUA 3OMNB 5FNVB 1EN6A 3M8AA 3WU2Z 2BTOA 5LOVB 5JCOC 3K06A 3SDLA 1EN5A 1OCCB 1UJWB 1IDSA 1D5NA 1AR5A 3MHHC 3ABLB 3SYQA 4B3SO 4MVOA 1FKAO 2QM8A 5LMNO 1UFIA 3OMAB 1Q81W 4K35A 1BMFG 5LA6A 4MVQA 3RW0A 4NR1A 3BRCA 4IL6Z 3ASNB 5KHHA 5GONA 4X1IB 4I50B 2YUAA 5L3FA 4KL1A 1MG1A 1AVMA 2ZR3A 2PYJA 4DR4O 1NS1A 1R6TA 3K5NA 4DV6B 4WBNB 3IFXA 4JASA 3CRAA 5JJEB 2OTLV 3THOA 3OT7A 3CHXA 2HG5C 1VF6A 3F7YC 1IBKO 1BE3H 3OAAG 5C93A 2YEVB 2EILB 3ZHSA 4MVRA 4N23A 4JYAO 4H33A 2XAGA 3N2GA 1K7DA 2QJ1A 5FNVA 4DR5O 1SQFA 2Z5UA 1JQ0A 5B1NA 4UXNA 5LOVA 1J5EB 1FYJA 1GKFA 3FB7C 1JJOA 2FMLA 4G28B 2GBOA 1R6NA 1YVWA 1AJQA 3CXCU 1Q7YW 1MOFA 3B8MA 1I5YA 2OYQA 3QO5A 3ZHTA 1RSOB 1R6KA 5EC1C 3IGAC 1EN4A 1VQ9V 4X1IA 4I50A 4EFBA 1PNMA 1MMMA 1G1XB 3L74H 4WBNA 1N34B 3A0RA 2DOSA 2Q4PA 5BR8B 2IJJA 5LBQA 4QE7A 1MSDA 4FFKA 2JS3A 2QKSA 2DQ0A 3JYCA 1SRYA 2YEVA 2V7QG 1OV9A 1FXVA 3F7VC 1WN7A 2VS0A 4DV1O 5JCOA 2JIZG 3CCMV 3E22B 1TGOA 4FM2A 3OUSA 3FB5C 2HVKC 2BTQB 1V9PA 1AI6A 3OEHG 4MTOA 3OTFA 1F23A 1WB8A 1JVMA 1RP3B 5L3EA 1QCEA 3WB0A 3ZCCA 5JVDB 2EJ7A 3A0BZ 1RSOA 2LQTA 4Q20A 3OGCC 4JI6O 3EXAA 4UFZA 1J95A 3UT5B 1YJNV 4J7JA 2X6CA 5KHJA 4LF7O 3K5LA 5LP6C 4JI0B 5F2VO 3JCUZ 1QNMA 2EJRA 4LFCO 1JR9A 3KDRA 2IU3A 3SPCA 2IJKA 4JYYA 4O2AB 3OTOB 2XAHA 1US6A 1YITV 4K0KB 4IYHA 2X6AA 1FFTB 1PL0A 3E22A 1SERA 4I0XB 5H6QA 2RN9A 3F5TA 3UO3A 2BTQA 2UXDB 3L71H 3N27A 2DMXA 4LFBB 1ZWIC 3ZIAG 3ETDA 2EINC 1AJNA 1SQXH 3S3XA 3W7TA 2ARHA 3RYCB 4X64B 2N74A 5JVDA 1JX9A 4K8ZA 1N33B 1L1FA 1HWYA 4H37A 1GMGA 4GX2A 4J9ZB 4NKGB 3ZMUA 3M99B 1M4UA 3FB8C 5LP6B 1GAXA 4RAIA 2QE7G 1K5SA 1GN4A 2F4VB 3UT5A 1NVPD 5LMUO 2YSUB 3CEIA 5C8YB 2QWNB 4TWKA 2HP8A 4LF5O 1CEZA 3CCQV 4UCOA 2QKCA 2JRIA 3ZRSA 3K0GA 5IJ9B 4J41A 3RFRA 5KA5A 3RT3C 4P30A 4FMTA 5KLVH 2UXCO 4O2AA 1M93A 3LNMB 3SYOA 3JAMN 4TV8B 1AILA 2ZXWB 3P32A 4QNHB 4FK5C 2NN4A 1HR0B 2E74B 4EB6B 1NT2B 2YS8A 2JJ1G 4I0XA 1SQVH 1VF5B 2EINB 4FJCC 3ICXA 2WWWA 1GTOA 2XAFA 4JGSA 4B3RO 3OR6C 1SZXA 1XL4A 5B1OA 2FYUH 5HFLA 4MVUA 3CC4V 3B77A 2LP7A 2XTAA 4AHCA 3TK1A 2CK3G 1HDJA 4DV7O 1XMQO 3QVNA 5LP6A 4FPPA 2A7WA 4UCTA 3N2KB 5C8YA 4X66O 4FLZA 4OX9B 1D2DA 1KYOF 3ZHQA 4Z2WA 3HPLC 3HKBB 4HNAA 5IYBO 2QTOA 4GYCB 2VQFB 2HFEC 4DV3O 4ZI7B 3OEEG 4GUNA 4XBFA 4DO2A 5IJ9A 4LF8O 1O9HA 4UVAA 4O4LB 4LF9B 4MVMA 3W7XA 1HW7A 3H1IH 3K9SA 5FLXN 1NR1A 4TV8A 4BIOA 4JI3O 2M7WA 2L6LA 1BQ0A 2ZINA 4EB6A 1H8EG 2Q68A 4HZ3A 4DR3B 1YDXA 4X64O 1KMIZ 1PD3A 1LUWA 4ZIBA 3ETGA 1VQ5V 4JI2O 2PI4A 5E79Z 2GDSA 4B3MO 1R3IC 2WLJA 2B1IA 4C7UA 3B8NA 5CA3A 2JJ2G 4LF6B 2DWEC 2LJ2A 5EBWC 2Y4TA 3TETA 2EZOA 4MSWC 2ILMA 3N2KA 3OUFA 1M56C 2QKAA 4NYKA 1SESA 4MTFA 3HKBA 2CTQA 1L0LH 4PA6A 3BCCH 3E8FA 4H0LB 4G27B 2HKOA 4ZI7A 5DECA 4GLXA 1WNSA 5TISZ 2NNUA 4O4LA 2G38A 4W4LA 2ZM6B 1IVSA 2ZKOA 4EFEA 2JEXA 2F1MA 4PJ0Z 4LWSA 1UPGA 2WAMA 4LCUC 1IZ3A 2ATKC 3FD9A 4DK0A 4U3JB 1BCCH 3AEIA 5L3BA 3L70H 3T1YO 1AR1B 1HNXB 3JCZA 2P22C 2XNDG 4NXMB 1M56B 1MNGA 5JH7B 1QU7A 5LGTA 4JAUA 1ZAUA 4GX5A 3J80N 1IXMA 3RN4A 5KHGA 4JF3A 4LF4O 1URFA 1XOUA 3K0DA 1Y67A 4L8JA 4B3SB 4DUYB 4I9WA 3UKMA 1QVGU 5LMNB 2GTAA 2WLMA 3JD3A 2ZIOA 3SPHA 2W0XA 5KX5B 5DM6V 1JJ2U 3J81N 3W7SA 2YXLA 2ITCC 1XBLA 3CCSV 3OM3B 3RYFB 3DC5A 4JTAB 1JA8A 3CCLV 2JGDB 4DR4B 1JPXA 1QLEC 1ZLZA 3LDCA 4UCVA 4O2BB 2CH7B 2QDOA 5IJ0B 3BY6A 3BHPA 3CCVV 4W4KA 4JI4O 4U3JA 3E8BA 2QEXV 3ZHUA 1XEQA 2EULA 1ZL8B 2PYLA 1Q86W 3G71V 3T2MA 2ZD9A 1K3EA 4RO2A 2DYSC 4J7ZA 1AB3A 4QPKA 5GTIZ 3K04A 2CE4A 2ADQB 5JH7A 4UB8Z 1XL6A 2WA4A 4DR5B 3E83A 2VWJA 5LA6B 3L72H 2JVDA 1Q8IA 4YJ2A 1GO3F 5B3SC 3D3QA 1H2LA 2XOKG 3H1HH 3SYAA 4WFEA 5KX5A 2X6BA 4QGPA 3ZN1A 2ZIMA 3ZMZA 2JS5A 3ZHVA 1SQBH 1QLEB 3RYFA 2EIKC 2HJDA 2W6JG 2BOBC 1W0KG 5CMUA 3IC9A 3L73H 1K92A 4O2BA 2CH7A 3VQYA 5IJ0A 2OT5A 2PZSA 2BSKB 3CX5F 2EILC 2DYSB 2AZ2A 2QSAA 1ZL8A 1PV0A 3SPJA 5JWPA 5CA0B 5CN0A 3CCUV 3X2QC 1SA0B 2OTJV 3BVOA 5CB4B 4DV1B 4DUYO 1XDCA 5B3SB 1OCRC 3U11A 2HR3A 4L87A 1K5QA 1SF9A 2NR5A 2WLKA 1ORQC 4UCRA 4DR7O 2QWPB 1S0VA 2BOCC 1KKCA 4I9QA 2EIKB 4RUFA 4P2ZA 4Z1VA 3G80A 2K1EA 3IC7A 4JI6B 4QJFB 1I0HA 2W0FC 3ZRVA 1R1BA 1DF4A 3TXSA 3AK2A 4LF7B 4FVMA 4DV2B 1CXZB 2CTPA 3QTCA 2HVJC 1E1QG 2WLLB 3ZRXA 2FKXA 3X2QB 1S5JA 2R72A 4LFCB 1Q5OA 2BSKA 3ML0A 1KC8W 5BMVB 5CA0A 5KUKA 1SA0A 1KP3A 5LHIA 3IJ4A 3MDSA 1TUBB 1OCRB 5CB4A 3CE2A 3JSLA 2HHHO 3JATB 1H5WA 3U10A 4NTYA 2VQEO 1KD1W 3KZIZ 2ZCEA 3SR2C 4BIZA 4X65O 3D3IA 1XNQO 1N32B 1W59A 2R9AA 5EBMC 1YJWV 1N8RW 4IT5A 2K9PA 2AZ0A 1NKDA 5KAFZ 4WFBV 1BZKA 3OE7G 2XAQA 1K33A 2KQXA 4LNUA 4LH7A 1EFRG 2KSDA 1DTOA 4OGQB 1KKDA 5LMUB 1G8MA 1B06A 2Y0IA 1LUVA 2P4KA 5KHKA 4IIJB 4X62O 4LF5B 2P7TC 3ZJZA 4QE9A 2WLLA 4FLTA 3JASB 1K4DC 2R70A 4DR1O 3CC7V 2B9ZA 3ZN0A 2UXCB 5IWAO 5BMVA 3ZBHA 3ABKB 1TUBA 2QWRB 1WJZA 3APOA 2XAJA 5JJNB 2AGAA 3U0ZA 2Z3YA 3E86A 1Q43A 2CUGA 1WPXA 3JATA 3VOUA 1NJIW 3SYCA 3B4SA 4B3RB 1QLNA 4R7CA 1P7GA 3L9DA 4AQYO 3RVZA 4NTWA 4U7OA 2ZT9B 1HNZO 4DV2O 1BGYH 1TUEB 1VQ7V 4R50A 1NH2D 3DXRA 1YTFD 1NR7A 1PNLA 4WFFA 4DV7B 1XMQB 1VQMV 2IW5A 4X66B 1VARA 1KU9A 1OHHG 2Q73A 4MW3A 3P30A 4IIJA 1GN2A 4DV3B 3CRRA 4XDLA 5L3CA 1FJGO 5GW7A 2YICA 4LF8B 1OCZC 3JASA 3UM7A 5KHIA 4YHHB 2FL4A 3K03A 2XASA 2Q7EA 4TQDA 2ZXWC 2VWKA 1THZA 4PDLA 5K1PA 2ADPA 4E2LA 1WP7A 4FLVA 2JK5C 4UB6Z 4JI3B 3T1HO 2L35A 3TGUH 1N32O 1AJPA 1TA8A 4X20B 3CPWU 5L3GA 4NXNO 3K58A 5L3DA 5IE9A 2QGNA 1NU1H 2QTSA 4X1KB 5KA6A 1H2SB 4NTXA 4JI2B 3ZRWB 2ZE5A 4B3MB 4D6TH 2DWDC 4K3AA 5H9CA 1YZBA 2DW4A 5D5PA 4HNAB 2DN9A 1F51A 1Y66A 1V55C 1ZUQA 4GKKO 3LUTB 1SZTA 3RWRD 1PL4A 3MAQA 4ICGA 1YI2V 1K8AW 4OPHA 5LXTB 1NBMG 4JAAA 1XILA 2F23A 1OCZB 3AG4C 3HKDB 4JAVA 3LSQA 4DV0O 4MS2A 1IBMO 3DTUB 1COWG 2GHYA 1IURA 2QA4V 4JYCA 4DW0A 2FB5A 4F6EA 4GZRB 2YIBD 2UU9O 3JD0A 2ZNJA 1IXBA 1KQSU 1AP5A 3E2EA 3C3TA 5LGUA 1HNWO 4X20A 1G6UA 1I94B 1E79G 1E1RG 3JD4A 3E89A 1YIJV 1V54C 1QR9A 1IBLO 4X1KA 1AI4A 1SQGA 4J80A 3CCJV 4DV4O 3ZRWA 1V55B 3PJSK 5CA1B 1DK1A 3T1YB 2Q9LA 3D8CA 1OZ0A 4B08A 1X59A 1WAZA 4BW5A 3EFFK 3DGEA 3KG2A 2DJVA 1VQ6V 5IDJA 4I4TB 3AG4B 2Y48A 1VQLV 4FFBB 3FYEB 5EIBD 4ZOLB 4X1YB 5LXTA 3RVYA 4LF4B 1TVKB 4YHHO 1YXBA 3RBZA 2Y4UA 1VQOV 2OIGA 1Y76B 3HKDA 2RJZA 4DV5B 4GKJO 1GK9A 3LNNA 2ZNIA 3VQXA 4UVCA 4LWSB 1VQKV 1GN6A 1RM1C 2WSSG 5B5EZ 3F5WC 5FPOA 2A79B 3LDEA 1V54B 1KBHA 2E76B 3RYHB 1Z2GA 1NH2B 5LYJB 1Q3EA 1SQPH 1YTFB 3KCXA 3K5OA 4XDKA 1FPOA 3ZS8C 5FL7G 1BT8A 1R3KC 2HJFC 1A32A 4DYLA 4JI4B 4R8CA 1N4CA 5CA1A 3OW2U 2ZDIA 1H2MA 4K8XA 2YI8A 1O9GA 3CD6V 2YIAA 4KXRA 4N21A 4RQFA 4H13B 4TSFG 4I4TA 1RPRA 3E8HA 5IY5C 1OCOC 4FFBA 2D2CB 2Q5ZA 4ZOLA 4X1YA 4AI8A 1TVKA 4D7SA 2N05A 1RM1B 4O4JA 1Y76A 4P9PA 1EZJA 2EBOA 4NB5A 1M1KW 5KAIZ 2A3QA 1P49A 2YXYA 1PP9H 1I94O 3I56V 1NTZH 5LGNA 5BXZA 1EM1A 2UUCO 4CC5A 4PDVA 1KUQA 2B1GA 3O65A 3BPZA 3RYHA 2OIEA 2R9RB 5A2QN 1MABG 5LYJA 2A9HA 1WA8B 4JV5O 4I55B 4CZZA 1L0NH 1SKVA 2OCCC 3K9AA 3QG5A 4GX1A 3B09A 1N0NA 4EEQA 2FTKA 1XNRO 1K34A 5HFMA 4B3TO 4RQEA 5EIBC 3D36C 4YJ2B 5IY5B 1OCOB 4CBCA 1XQ8A 1VQPV 4I7ZB 4DV5O 5LHGA 3QO7A 1F4NA 4RWUA 1QBZA 2QM7A 1VQ4V 1AR4A 2P4VA 2YI9A 4DUZO 1ZX3A 2JEUA 4DR7B 1FD9A 2IM9A 1GM8A 3SPGA 3ASOC 4PI2A 4JI8O 1FOUA 3ZMTA 3LSUA 2HLDG 2PGGA 1JMKC 3FAVA 2OCCB 2E3CA 1MA1A 2RCVA 4MTXA 1IJGA 4B7EA 1WA8A 5K1XA 2YIDA 4I55A 2UXXA 4O4HB 4X8AA 1P4RA 2IBZH 4UV8A 5EYPB 2D3OW 3JAKB 3ZHRA 4YY3B 1W0JG 1VQNV 2F66C 2IH3C 2DYRC 1CP9A 1G4YB 1BQZA 4LFAO 3CRMA 2RQ6A 1XHXA 4U3FH 1R3JC 4PV1B 3PN1A 3AG7A 1Z5VA 3TJTA 3CMEV 2HHHB 2YIBA 3R66A 3W7UA 4QIWF 3HKCA 1OJHA 2EX3A 1Z5WA 4DR6O 2P5OA 1FXHA 3VBBA 3ASOB 1WLEA 2VQEB 2C2AA 1AI7A 2P06A 3ETQA 4X65B 4KP4A 5DN6G 2Q7HA 5D5QA 1XNQB 2AHZA 2PUSA 3LDDA 4IHJB 3B40A 4YJ3B 5EZYB 1K4CC 4ABMA 5ITZB 3MHSC 1P84F 3K59A 4DXWA 3BABA 3A2FA 3AG1C 3AG2C 4BAYA 5B66Z 5JQGB 3SJCC 2OWOA 4X62B 2PTMA 1RPOA 2A06H 2DYRB 1PKXA 3ETEA 3K3WA 4KFMA 4F4LA 1N36O 1BL8A 2Y69C 4O4HA 3H9VA 1K97A 5EYPA 5CBHA 3JAKA 3R65A 3JARB 5IT9N 2E75B 3D36A 4FZ1A 3K79A 4TV9B 4DR1B 1VEWA 4DR2O 5IWAB 1F7YA 2E5LO 1Q6IA 3BA8A 4HBNA 3CWBH 4PA9A 3ZEDA 4MW8A 3RYIB 1F4MA 4WFAV 2H94A 4JI5O 2Q0AA 2OCHA 4CS2A 2LW7A 3DSQA 4FLUA 3A0HZ 2XHBA 4LNUB 4AQYB 4JI7B 1K9MW 4U7NA 3CS5A 2UUBO 4IHJA 1HNZB 3QO8A 4YJ3A 3ABMC 5EZYA 3IAYA 3AG1B 4LH6A 3AG2B 4TQFA 5ITZA 2MW2B 4DW1A 4YY3O 2Y69B 1CPYA 4FLXA 5JQGA 2QR4A 1SC5B 4MVSA 1NZ6A 1XMOO 4LP8A 5H2FZ 3CC2V 3I5DA 1SQQH 5AG2A 3AK1A 2UUAO 1FJGB 3JARA 4E4EA 4P9OA 4TV9A 4QPJA 2N04A 2WLIA 1YJ9V 3ABKC 2IU0A 4ZBMA 3EVKA 1Q82W 1M9NA 1ZTEA 2B5UA 3RYIA 4FLYA 3T1HB 5IYDO 2HEPA 4RUEA 1PPJH 2Q69A 4NXNB 1DF5A 1FXKC 4YXWG 5BZBA 3DXRB 2VRZA 2DE0X 3O9OA 3ABMB 2AW9A 1Q6HA 3HB3B 4HAMA 1JOYA 2Q8VA 2DQ3A 4WFHA 4X89A 3KKYA 4Q6GA 4YIOA 4GKKB 4JI1O 3BA9A 3FKSG 1K73W 4I5SA 5LHHA 1D5AA 2YDEA 1S5LZ 5A9GA 3CJHB 2YC0A 4CS4A 2EZPA 4DV0B 3JSNA 5GTHZ 1IBMB 2ETNA 1BHAA 4H44B 1HP8A 3NXSA 4JZ2A 1U96A 4A5UB 4LBEC 2EIJC 2A0LA 4OPAA 2UU9B 2RMKB 3SJBC 4PDMA 1X4TA 1FXKB 3KCYA 5LL6Y 1BSMA 4JI7O 1HNWB 1ENVA 1L8DA 3OGIB 3BFRA 5B1BC 1M90W 3TXQA 1YEWA 3OMIB 1IBLB 4DV6O 3CRCA 3E35A 4WFGA 2V1DA 1GM9A 4DV4B 5IYCO 2KKWA 1XUQA 3GVMA 4PDRA 1Y74B 1YF2A 2IH1C 1H2KA 4KHPB 4O4IB 2ZE7A 3STZC 4JYBA 5CBFA 1RFYA 2CGOA 3CCRV 3Q4HB 3CP1A 3L75H 4BWAA 3G67A 4BW9A 3C90A 1QR8A 4FIPC 4X88A 3SJQC 3P3NA 3QNEA 4PI0A 3ZMVA 3OR7C 3CJHA 3CMAV 3GB7C 1J5EO 2EIJB 2LFSA 4GKJB 4FLWA 2ZR2A 2H3OA 5EBLC 4Z1MG 3CCEV 1S77D 3SYPA 2EIMC 4GX0A 4LC1A 3S3WA 3FX7A 3K57A 4CC6A 2V4DA 5B1BB 3G4SV 1FXKA 3RGBA 2CTRA 4NVPA 1GN3A 1XREA 1T5EA 3WB1A 1NI8A 3EHBB 4DK1A 3ZX6A 3B2EE 1N34O 1N0JA 4BR6A 2ZDIC 2X0LA 5BR8O 4UVBA 3SJAC 2F93B 3UQ8A 1Y74A 1R3LC 2ITDC 4GCZA 4J10A 4CH6A 4R6ZA 1H38A 3GWKC 3AK3A 4O4IA 1WP8A 3VQWA 1QVFU 3Q4HA 4EKWA 1H2GA 3T4ZA 2UXBB 3CXHF 4CH3A 4YIPA 2P90A 3WG7C 3SGIA 1GH6A 1R73A 1IX9A 2EIMB 2GUZB 4B7KA 3FYIB 3JALB 2MK3A 2PY5A 3JD1A 3K08A 5CBGA 1Q6UA 4IGGA 3TCUA 2UUCB 1H2NA 1S3JA 1ROPA 1VQ8V 2KG7B 5J9PC 4JV5B 2IJIA 4KHPO 3RYCA 2XUMA 1VF7A 3J7AU 4ZHQB 2AHYA 1EBOA 1I7FA 4XDJA 3CSXA 4JI0O 4PHZA 5EC2C 1B6QA 1XNRB 4B3TB 4G2KA 4TUYB 5B1AC 4DRXB 2M6YA 1VP7A 3C3SA 4O4JB 3OTOO 3WG7B 3K5MA 3WFVA 4K0KO 5H5NA 3H1JH 1PNKA 3ABTA 2Q6AA 3VQVA 3HKEB 5KMGB 1KECA 4FZ0A 2QWQB 3DC6A 4DUZB 5KUMA 2GUZA 4CS3A 5EK0A 2UXDO 1QQCA 4LFBO 2ZE8A 3OD4A 2CDYA 3JALA 4JI8B 1DGSA 4UCUA 5JJJB 1S76D 3H1KH 1GRJA 1S72V 3NR7A 5DEDA 1KB9F 4D7TA 1N33O 4BIUA 1BHBA 4PA4A 4MVZA 1WB7A 2KG7A 3GWOA 3BEHA 2F4VO 3WB2A 1H8HG 3FB6C 4FM0A 3T1CA 3H01A 5J2UB 4ZHQA 5B1AB 3G6EV 3AG3C 5FPRA 3APQA 1VIBA 2KB1A 2UXBO 4JZGA 1AROP 4TUYA 4LFAB 3FFQA 4HYOA 4DRXA 4UCSA 2NLJC 4F6RB 2QM4A 1NQTA 4J7KA 2ZQMA 2XT9A 5IYZB 2WLHA 1NTKH 2UXNA 1XHZA 1HR0O 2WLNA 1U97A 1SETA 1NTMH 1P7BA 3HKEA 5KMGA 4DR6B 4FM1A 1TAEA 4WCEV 1Y4MA 2LFRA 1I5XA 3FAVB 3BAAA 2GTSA 3T4DA 1MSWD 3P3PA 3ZMSA 2BE3A 1M5IA 3HR0A 1AP6A 4JTCB 2PF4E 1JNBA 4PA7A 4TOIA 5H6RA 1M57C 3STLC 1NVPB 1LNQA 1MZEA 3AG3B 1Y6XA 2YXHA 1N36B 4OX9O 2WA3A 5E1AC 5J2UA 4WF9V 4MTGA 2VQFO 2GSMB 2W6IG 4DR2B 2E5LB 3HKCB 3OFNG 3M7MX 1Q90D 4TT3G 2AXTZ 2LW1A 2RNBA 2BCCH 4LF9O 1XI1A 3MD0A 4JI5B 1GM7A 4F6RA 2ODMA 4J42A 1QHTA 5IYZA 2R9IA 2QWOB 2CAZC 1I08A 2Q67A 2Z0AA 3LSSA 2WPDG 1DLBA 3CYOA 3CRQA 4CH4A 4DR3O 1AI5A 4IYIA 4UUJC 4UV9A 1FFXB 1ZSPA 1WPBA 4AILC 4ASUG 2UUBB 2LGWA 1M57B 3UO2A 4ZKIA 1JFFB 1B3QA 1W2BU 2LO1A 2CTWA 3SPIA 5J2TB 4X9QA 2F43G 4LR3A 1YCIA 1FAFA 1VF6C 3JAWB 1FS0G 1JCHA 4GT1A 3JD2A 3H1LH 3QF7A 2ZE6A 4LF6O 1MZFA 2GV9A 3CB2A 1IBKB 1XMOB 2H8PC 3A8TA 1KP2A 3E8GA 3I55V 2UUAB 1BS3A 4JYAB 4J9YB
chains in the Genus database with same CATH topology
1GN6A 1ZLZA 2QKAA 1AP6A 1ZUQA 2AW9A 1PM9A 1KKCA 1PL4A 3C3SA 1AR4A 1XILA 1SZXA 3KKYA 1VEWA 1I0HA 4YIOA 1BT8A 1QNMA 2CE4A 2ADQB 1GN3A 1JR9A 3KDRA 3AK2A 1XREA 4JYYA 3LSUA 3DC6A 1P7GA 3QVNA 1N0JA 4BR6A 5A9GA 1EN4A 2CDYA 4F6EA 1MA1A 2RCVA 1IXBA 1AP5A 3C3TA 1MMMA 4GUNA 4JZ2A 1EN6A 3MDSA 3AK3A 1VARA 1I08A 1WB7A 1EN5A 1IDSA 1MSDA 4FFKA 1D5NA 3K9SA 1AR5A 1BSMA 1GN2A 1MNGA 1ZSPA 4YIPA 3BFRA 1IX9A 3RN4A 3IC9A 1EM1A 1Y67A 3TJTA 1GN4A 4JZGA 3CEIA 4X9QA 2ADPA 5AG2A 3AK1A 1XUQA 1LUWA 1AVMA 4E4EA 2GDSA 2QKCA 3EVKA 1N0NA 1WB8A 1XDCA 1ZTEA 1B06A 3DC5A 1LUVA 2P4KA 4C7UA 1BS3A 3OT7A 1JA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GN6 A;  1ZLZ A;  2QKA A;  1AP6 A;  1ZUQ A;  2AW9 A;  1PM9 A;  1KKC A;  1PL4 A;  3C3S A;  1AR4 A;  1XIL A;  1SZX A;  3KKY A;  1VEW A;  1I0H A;  4YIO A;  1BT8 A;  1QNM A;  2CE4 A;  2ADQ B;  1GN3 A;  1JR9 A;  3AK2 A;  1XRE A;  4JYY A;  3LSU A;  3DC6 A;  1P7G A;  3QVN A;  1N0J A;  4BR6 A;  5A9G A;  1EN4 A;  2CDY A;  4F6E A;  1MA1 A;  2RCV A;  1IXB A;  1AP5 A;  3C3T A;  1MMM A;  4GUN A;  4JZ2 A;  1EN6 A;  3MDS A;  3AK3 A;  1VAR A;  1I08 A;  1WB7 A;  1EN5 A;  1IDS A;  1MSD A;  4FFK A;  1D5N A;  3K9S A;  1AR5 A;  1BSM A;  1GN2 A;  1MNG A;  1ZSP A;  4YIP A;  3BFR A;  1IX9 A;  3RN4 A;  3IC9 A;  1EM1 A;  1Y67 A;  3TJT A;  1GN4 A;  4JZG A;  3CEI A;  4X9Q A;  2ADP A;  5AG2 A;  3AK1 A;  1XUQ A;  1LUW A;  1AVM A;  4E4E A;  2GDS A;  2QKC A;  3EVK A;  1N0N A;  1WB8 A;  1XDC A;  1ZTE A;  1B06 A;  3DC5 A;  1LUV A;  2P4K A;  4C7U A;  1BS3 A;  3OT7 A;  1JA8 A; 
#chains in the Genus database with same CATH topology
 1YSC A;  2Y0P A;  1LR1 A;  1SS3 A;  1EZV H;  1OCC C;  2LGQ A;  2RDC A;  3G6B A;  4PD4 F;  2O57 A;  2Q0O C;  3ABL C;  2CGN A;  2ZM6 O;  1YHQ V;  5GON B;  1PM9 A;  2X7R B;  4JPR A;  4JTD B;  3ASN C;  2P6J A;  1VMG A;  2PI5 A;  4J11 A;  1FFX A;  2F95 B;  4MT8 A;  5BY1 A;  3W7W A;  4KUM A;  2P67 A;  3ABU A;  1JFF A;  2JGD A;  4PEL A;  4JI1 B;  4CH5 A;  3UCS C;  1HNX O;  5J2T A;  2Q7G A;  4PA3 A;  2IJH A;  3JAW A;  1B04 A;  4NXM O;  2JDI G;  1S5H C;  4OXS A;  2WLI B;  3N2G B;  2JGU A;  3OMN B;  5FNV B;  1EN6 A;  3M8A A;  3WU2 Z;  2BTO A;  5LOV B;  5JCO C;  3K06 A;  3SDL A;  1EN5 A;  1OCC B;  1UJW B;  1IDS A;  1D5N A;  1AR5 A;  3MHH C;  3ABL B;  3SYQ A;  4B3S O;  4MVO A;  1FKA O;  2QM8 A;  5LMN O;  1UFI A;  3OMA B;  1Q81 W;  4K35 A;  1BMF G;  5LA6 A;  4MVQ A;  3RW0 A;  4NR1 A;  3BRC A;  4IL6 Z;  3ASN B;  5KHH A;  5GON A;  4X1I B;  4I50 B;  2YUA A;  5L3F A;  4KL1 A;  1MG1 A;  1AVM A;  2ZR3 A;  2PYJ A;  4DR4 O;  1NS1 A;  1R6T A;  3K5N A;  4DV6 B;  4WBN B;  3IFX A;  4JAS A;  3CRA A;  5JJE B;  2OTL V;  3THO A;  3OT7 A;  3CHX A;  2HG5 C;  1VF6 A;  3F7Y C;  1IBK O;  1BE3 H;  3OAA G;  5C93 A;  2YEV B;  2EIL B;  3ZHS A;  4MVR A;  4N23 A;  4JYA O;  4H33 A;  2XAG A;  3N2G A;  1K7D A;  2QJ1 A;  5FNV A;  4DR5 O;  1SQF A;  2Z5U A;  1JQ0 A;  5B1N A;  4UXN A;  5LOV A;  1J5E B;  1FYJ A;  1GKF A;  3FB7 C;  1JJO A;  2FML A;  4G28 B;  2GBO A;  1R6N A;  1YVW A;  1AJQ A;  3CXC U;  1Q7Y W;  1MOF A;  3B8M A;  1I5Y A;  2OYQ A;  3QO5 A;  3ZHT A;  1RSO B;  1R6K A;  5EC1 C;  3IGA C;  1EN4 A;  1VQ9 V;  4X1I A;  4I50 A;  4EFB A;  1PNM A;  1MMM A;  1G1X B;  3L74 H;  4WBN A;  1N34 B;  3A0R A;  2DOS A;  2Q4P A;  5BR8 B;  2IJJ A;  5LBQ A;  4QE7 A;  1MSD A;  4FFK A;  2JS3 A;  2QKS A;  2DQ0 A;  3JYC A;  1SRY A;  2YEV A;  2V7Q G;  1OV9 A;  1FXV A;  3F7V C;  1WN7 A;  2VS0 A;  4DV1 O;  5JCO A;  2JIZ G;  3CCM V;  3E22 B;  1TGO A;  4FM2 A;  3OUS A;  3FB5 C;  2HVK C;  2BTQ B;  1V9P A;  1AI6 A;  3OEH G;  4MTO A;  3OTF A;  1F23 A;  1WB8 A;  1JVM A;  1RP3 B;  5L3E A;  1QCE A;  3WB0 A;  3ZCC A;  5JVD B;  2EJ7 A;  3A0B Z;  1RSO A;  2LQT A;  4Q20 A;  3OGC C;  4JI6 O;  3EXA A;  4UFZ A;  1J95 A;  3UT5 B;  1YJN V;  4J7J A;  2X6C A;  5KHJ A;  4LF7 O;  3K5L A;  5LP6 C;  4JI0 B;  5F2V O;  3JCU Z;  1QNM A;  2EJR A;  4LFC O;  1JR9 A;  3KDR A;  2IU3 A;  3SPC A;  2IJK A;  4JYY A;  4O2A B;  3OTO B;  2XAH A;  1US6 A;  1YIT V;  4K0K B;  4IYH A;  2X6A A;  1FFT B;  1PL0 A;  3E22 A;  1SER A;  4I0X B;  5H6Q A;  2RN9 A;  3F5T A;  3UO3 A;  2BTQ A;  2UXD B;  3L71 H;  3N27 A;  2DMX A;  4LFB B;  1ZWI C;  3ZIA G;  3ETD A;  2EIN C;  1AJN A;  1SQX H;  3S3X A;  3W7T A;  2ARH A;  3RYC B;  4X64 B;  2N74 A;  5JVD A;  1JX9 A;  4K8Z A;  1N33 B;  1L1F A;  1HWY A;  4H37 A;  1GMG A;  4GX2 A;  4J9Z B;  4NKG B;  3ZMU A;  3M99 B;  1M4U A;  3FB8 C;  5LP6 B;  1GAX A;  4RAI A;  2QE7 G;  1K5S A;  1GN4 A;  2F4V B;  3UT5 A;  1NVP D;  5LMU O;  2YSU B;  3CEI A;  5C8Y B;  2QWN B;  4TWK A;  2HP8 A;  4LF5 O;  1CEZ A;  3CCQ V;  4UCO A;  2QKC A;  2JRI A;  3ZRS A;  3K0G A;  5IJ9 B;  4J41 A;  3RFR A;  5KA5 A;  3RT3 C;  4P30 A;  4FMT A;  5KLV H;  2UXC O;  4O2A A;  1M93 A;  3LNM B;  3SYO A;  3JAM N;  4TV8 B;  1AIL A;  2ZXW B;  3P32 A;  4QNH B;  4FK5 C;  2NN4 A;  1HR0 B;  2E74 B;  4EB6 B;  1NT2 B;  2YS8 A;  2JJ1 G;  4I0X A;  1SQV H;  1VF5 B;  2EIN B;  4FJC C;  3ICX A;  2WWW A;  1GTO A;  2XAF A;  4JGS A;  4B3R O;  3OR6 C;  1SZX A;  1XL4 A;  5B1O A;  2FYU H;  5HFL A;  4MVU A;  3CC4 V;  3B77 A;  2LP7 A;  2XTA A;  4AHC A;  3TK1 A;  2CK3 G;  1HDJ A;  4DV7 O;  1XMQ O;  3QVN A;  5LP6 A;  4FPP A;  2A7W A;  4UCT A;  3N2K B;  5C8Y A;  4X66 O;  4FLZ A;  4OX9 B;  1D2D A;  1KYO F;  3ZHQ A;  4Z2W A;  3HPL C;  3HKB B;  4HNA A;  5IYB O;  2QTO A;  4GYC B;  2VQF B;  2HFE C;  4DV3 O;  4ZI7 B;  3OEE G;  4GUN A;  4XBF A;  4DO2 A;  5IJ9 A;  4LF8 O;  1O9H A;  4UVA A;  4O4L B;  4LF9 B;  4MVM A;  3W7X A;  1HW7 A;  3H1I H;  3K9S A;  5FLX N;  1NR1 A;  4TV8 A;  4BIO A;  4JI3 O;  2M7W A;  2L6L A;  1BQ0 A;  2ZIN A;  4EB6 A;  1H8E G;  2Q68 A;  4HZ3 A;  4DR3 B;  1YDX A;  4X64 O;  1KMI Z;  1PD3 A;  1LUW A;  4ZIB A;  3ETG A;  1VQ5 V;  4JI2 O;  2PI4 A;  5E79 Z;  2GDS A;  4B3M O;  1R3I C;  2WLJ A;  2B1I A;  4C7U A;  3B8N A;  5CA3 A;  2JJ2 G;  4LF6 B;  2DWE C;  2LJ2 A;  5EBW C;  2Y4T A;  3TET A;  2EZO A;  4MSW C;  2ILM A;  3N2K A;  3OUF A;  1M56 C;  2QKA A;  4NYK A;  1SES A;  4MTF A;  3HKB A;  2CTQ A;  1L0L H;  4PA6 A;  3BCC H;  3E8F A;  4H0L B;  4G27 B;  2HKO A;  4ZI7 A;  5DEC A;  4GLX A;  1WNS A;  5TIS Z;  2NNU A;  4O4L A;  2G38 A;  4W4L A;  2ZM6 B;  1IVS A;  2ZKO A;  4EFE A;  2JEX A;  2F1M A;  4PJ0 Z;  4LWS A;  1UPG A;  2WAM A;  4LCU C;  1IZ3 A;  2ATK C;  3FD9 A;  4DK0 A;  4U3J B;  1BCC H;  3AEI A;  5L3B A;  3L70 H;  3T1Y O;  1AR1 B;  1HNX B;  3JCZ A;  2P22 C;  2XND G;  4NXM B;  1M56 B;  1MNG A;  5JH7 B;  1QU7 A;  5LGT A;  4JAU A;  1ZAU A;  4GX5 A;  3J80 N;  1IXM A;  3RN4 A;  5KHG A;  4JF3 A;  4LF4 O;  1URF A;  1XOU A;  3K0D A;  1Y67 A;  4L8J A;  4B3S B;  4DUY B;  4I9W A;  3UKM A;  1QVG U;  5LMN B;  2GTA A;  2WLM A;  3JD3 A;  2ZIO A;  3SPH A;  2W0X A;  5KX5 B;  5DM6 V;  1JJ2 U;  3J81 N;  3W7S A;  2YXL A;  2ITC C;  1XBL A;  3CCS V;  3OM3 B;  3RYF B;  3DC5 A;  4JTA B;  1JA8 A;  3CCL V;  2JGD B;  4DR4 B;  1JPX A;  1QLE C;  1ZLZ A;  3LDC A;  4UCV A;  4O2B B;  2CH7 B;  2QDO A;  5IJ0 B;  3BY6 A;  3BHP A;  3CCV V;  4W4K A;  4JI4 O;  4U3J A;  3E8B A;  2QEX V;  3ZHU A;  1XEQ A;  2EUL A;  1ZL8 B;  2PYL A;  1Q86 W;  3G71 V;  3T2M A;  2ZD9 A;  1K3E A;  4RO2 A;  2DYS C;  4J7Z A;  1AB3 A;  4QPK A;  5GTI Z;  3K04 A;  2CE4 A;  2ADQ B;  5JH7 A;  4UB8 Z;  1XL6 A;  2WA4 A;  4DR5 B;  3E83 A;  2VWJ A;  5LA6 B;  3L72 H;  2JVD A;  1Q8I A;  4YJ2 A;  1GO3 F;  5B3S C;  3D3Q A;  1H2L A;  2XOK G;  3H1H H;  3SYA A;  4WFE A;  5KX5 A;  2X6B A;  4QGP A;  3ZN1 A;  2ZIM A;  3ZMZ A;  2JS5 A;  3ZHV A;  1SQB H;  1QLE B;  3RYF A;  2EIK C;  2HJD A;  2W6J G;  2BOB C;  1W0K G;  5CMU A;  3IC9 A;  3L73 H;  1K92 A;  4O2B A;  2CH7 A;  3VQY A;  5IJ0 A;  2OT5 A;  2PZS A;  2BSK B;  3CX5 F;  2EIL C;  2DYS B;  2AZ2 A;  2QSA A;  1ZL8 A;  1PV0 A;  3SPJ A;  5JWP A;  5CA0 B;  5CN0 A;  3CCU V;  3X2Q C;  1SA0 B;  2OTJ V;  3BVO A;  5CB4 B;  4DV1 B;  4DUY O;  1XDC A;  5B3S B;  1OCR C;  3U11 A;  2HR3 A;  4L87 A;  1K5Q A;  1SF9 A;  2NR5 A;  2WLK A;  1ORQ C;  4UCR A;  4DR7 O;  2QWP B;  1S0V A;  2BOC C;  1KKC A;  4I9Q A;  2EIK B;  4RUF A;  4P2Z A;  4Z1V A;  3G80 A;  2K1E A;  3IC7 A;  4JI6 B;  4QJF B;  1I0H A;  2W0F C;  3ZRV A;  1R1B A;  1DF4 A;  3TXS A;  3AK2 A;  4LF7 B;  4FVM A;  4DV2 B;  1CXZ B;  2CTP A;  3QTC A;  2HVJ C;  1E1Q G;  2WLL B;  3ZRX A;  2FKX A;  3X2Q B;  1S5J A;  2R72 A;  4LFC B;  1Q5O A;  2BSK A;  3ML0 A;  1KC8 W;  5BMV B;  5CA0 A;  5KUK A;  1SA0 A;  1KP3 A;  5LHI A;  3IJ4 A;  3MDS A;  1TUB B;  1OCR B;  5CB4 A;  3CE2 A;  3JSL A;  2HHH O;  3JAT B;  1H5W A;  3U10 A;  4NTY A;  2VQE O;  1KD1 W;  3KZI Z;  2ZCE A;  3SR2 C;  4BIZ A;  4X65 O;  3D3I A;  1XNQ O;  1N32 B;  1W59 A;  2R9A A;  5EBM C;  1YJW V;  1N8R W;  4IT5 A;  2K9P A;  2AZ0 A;  1NKD A;  5KAF Z;  4WFB V;  1BZK A;  3OE7 G;  2XAQ A;  1K33 A;  2KQX A;  4LNU A;  4LH7 A;  1EFR G;  2KSD A;  1DTO A;  4OGQ B;  1KKD A;  5LMU B;  1G8M A;  1B06 A;  2Y0I A;  1LUV A;  2P4K A;  5KHK A;  4IIJ B;  4X62 O;  4LF5 B;  2P7T C;  3ZJZ A;  4QE9 A;  2WLL A;  4FLT A;  3JAS B;  1K4D C;  2R70 A;  4DR1 O;  3CC7 V;  2B9Z A;  3ZN0 A;  2UXC B;  5IWA O;  5BMV A;  3ZBH A;  3ABK B;  1TUB A;  2QWR B;  1WJZ A;  3APO A;  2XAJ A;  5JJN B;  2AGA A;  3U0Z A;  2Z3Y A;  3E86 A;  1Q43 A;  2CUG A;  1WPX A;  3JAT A;  3VOU A;  1NJI W;  3SYC A;  3B4S A;  4B3R B;  1QLN A;  4R7C A;  1P7G A;  3L9D A;  4AQY O;  3RVZ A;  4NTW A;  4U7O A;  2ZT9 B;  1HNZ O;  4DV2 O;  1BGY H;  1TUE B;  1VQ7 V;  4R50 A;  1NH2 D;  3DXR A;  1YTF D;  1NR7 A;  1PNL A;  4WFF A;  4DV7 B;  1XMQ B;  1VQM V;  2IW5 A;  4X66 B;  1VAR A;  1KU9 A;  1OHH G;  2Q73 A;  4MW3 A;  3P30 A;  4IIJ A;  1GN2 A;  4DV3 B;  3CRR A;  4XDL A;  5L3C A;  1FJG O;  5GW7 A;  2YIC A;  4LF8 B;  1OCZ C;  3JAS A;  3UM7 A;  5KHI A;  4YHH B;  2FL4 A;  3K03 A;  2XAS A;  2Q7E A;  4TQD A;  2ZXW C;  2VWK A;  1THZ A;  4PDL A;  5K1P A;  2ADP A;  4E2L A;  1WP7 A;  4FLV A;  2JK5 C;  4UB6 Z;  4JI3 B;  3T1H O;  2L35 A;  3TGU H;  1N32 O;  1AJP A;  1TA8 A;  4X20 B;  3CPW U;  5L3G A;  4NXN O;  3K58 A;  5L3D A;  5IE9 A;  2QGN A;  1NU1 H;  2QTS A;  4X1K B;  5KA6 A;  1H2S B;  4NTX A;  4JI2 B;  3ZRW B;  2ZE5 A;  4B3M B;  4D6T H;  2DWD C;  4K3A A;  5H9C A;  1YZB A;  2DW4 A;  5D5P A;  4HNA B;  2DN9 A;  1F51 A;  1Y66 A;  1V55 C;  1ZUQ A;  4GKK O;  3LUT B;  1SZT A;  3RWR D;  1PL4 A;  3MAQ A;  4ICG A;  1YI2 V;  1K8A W;  4OPH A;  5LXT B;  1NBM G;  4JAA A;  1XIL A;  2F23 A;  1OCZ B;  3AG4 C;  3HKD B;  4JAV A;  3LSQ A;  4DV0 O;  4MS2 A;  1IBM O;  3DTU B;  1COW G;  2GHY A;  1IUR A;  2QA4 V;  4JYC A;  4DW0 A;  2FB5 A;  4F6E A;  4GZR B;  2YIB D;  2UU9 O;  3JD0 A;  2ZNJ A;  1IXB A;  1KQS U;  1AP5 A;  3E2E A;  3C3T A;  5LGU A;  1HNW O;  4X20 A;  1G6U A;  1I94 B;  1E79 G;  1E1R G;  3JD4 A;  3E89 A;  1YIJ V;  1V54 C;  1QR9 A;  1IBL O;  4X1K A;  1AI4 A;  1SQG A;  4J80 A;  3CCJ V;  4DV4 O;  3ZRW A;  1V55 B;  3PJS K;  5CA1 B;  1DK1 A;  3T1Y B;  2Q9L A;  3D8C A;  1OZ0 A;  4B08 A;  1X59 A;  1WAZ A;  4BW5 A;  3EFF K;  3DGE A;  3KG2 A;  2DJV A;  1VQ6 V;  5IDJ A;  4I4T B;  3AG4 B;  2Y48 A;  1VQL V;  4FFB B;  3FYE B;  5EIB D;  4ZOL B;  4X1Y B;  5LXT A;  3RVY A;  4LF4 B;  1TVK B;  4YHH O;  1YXB A;  3RBZ A;  2Y4U A;  1VQO V;  2OIG A;  1Y76 B;  3HKD A;  2RJZ A;  4DV5 B;  4GKJ O;  1GK9 A;  3LNN A;  2ZNI A;  3VQX A;  4UVC A;  4LWS B;  1VQK V;  1GN6 A;  1RM1 C;  2WSS G;  5B5E Z;  3F5W C;  5FPO A;  2A79 B;  3LDE A;  1V54 B;  1KBH A;  2E76 B;  3RYH B;  1Z2G A;  1NH2 B;  5LYJ B;  1Q3E A;  1SQP H;  1YTF B;  3KCX A;  3K5O A;  4XDK A;  1FPO A;  3ZS8 C;  5FL7 G;  1BT8 A;  1R3K C;  2HJF C;  1A32 A;  4DYL A;  4JI4 B;  4R8C A;  1N4C A;  5CA1 A;  3OW2 U;  2ZDI A;  1H2M A;  4K8X A;  2YI8 A;  1O9G A;  3CD6 V;  2YIA A;  4KXR A;  4N21 A;  4RQF A;  4H13 B;  4TSF G;  4I4T A;  1RPR A;  3E8H A;  5IY5 C;  1OCO C;  4FFB A;  2D2C B;  2Q5Z A;  4ZOL A;  4X1Y A;  4AI8 A;  1TVK A;  4D7S A;  2N05 A;  1RM1 B;  4O4J A;  1Y76 A;  4P9P A;  1EZJ A;  2EBO A;  4NB5 A;  1M1K W;  5KAI Z;  2A3Q A;  1P49 A;  2YXY A;  1PP9 H;  1I94 O;  3I56 V;  1NTZ H;  5LGN A;  5BXZ A;  1EM1 A;  2UUC O;  4CC5 A;  4PDV A;  1KUQ A;  2B1G A;  3O65 A;  3BPZ A;  3RYH A;  2OIE A;  2R9R B;  5A2Q N;  1MAB G;  5LYJ A;  2A9H A;  1WA8 B;  4JV5 O;  4I55 B;  4CZZ A;  1L0N H;  1SKV A;  2OCC C;  3K9A A;  3QG5 A;  4GX1 A;  3B09 A;  1N0N A;  4EEQ A;  2FTK A;  1XNR O;  1K34 A;  5HFM A;  4B3T O;  4RQE A;  5EIB C;  3D36 C;  4YJ2 B;  5IY5 B;  1OCO B;  4CBC A;  1XQ8 A;  1VQP V;  4I7Z B;  4DV5 O;  5LHG A;  3QO7 A;  1F4N A;  4RWU A;  1QBZ A;  2QM7 A;  1VQ4 V;  1AR4 A;  2P4V A;  2YI9 A;  4DUZ O;  1ZX3 A;  2JEU A;  4DR7 B;  1FD9 A;  2IM9 A;  1GM8 A;  3SPG A;  3ASO C;  4PI2 A;  4JI8 O;  1FOU A;  3ZMT A;  3LSU A;  2HLD G;  2PGG A;  1JMK C;  3FAV A;  2OCC B;  2E3C A;  1MA1 A;  2RCV A;  4MTX A;  1IJG A;  4B7E A;  1WA8 A;  5K1X A;  2YID A;  4I55 A;  2UXX A;  4O4H B;  4X8A A;  1P4R A;  2IBZ H;  4UV8 A;  5EYP B;  2D3O W;  3JAK B;  3ZHR A;  4YY3 B;  1W0J G;  1VQN V;  2F66 C;  2IH3 C;  2DYR C;  1CP9 A;  1G4Y B;  1BQZ A;  4LFA O;  3CRM A;  2RQ6 A;  1XHX A;  4U3F H;  1R3J C;  4PV1 B;  3PN1 A;  3AG7 A;  1Z5V A;  3TJT A;  3CME V;  2HHH B;  2YIB A;  3R66 A;  3W7U A;  4QIW F;  3HKC A;  1OJH A;  2EX3 A;  1Z5W A;  4DR6 O;  2P5O A;  1FXH A;  3VBB A;  3ASO B;  1WLE A;  2VQE B;  2C2A A;  1AI7 A;  2P06 A;  3ETQ A;  4X65 B;  4KP4 A;  5DN6 G;  2Q7H A;  5D5Q A;  1XNQ B;  2AHZ A;  2PUS A;  3LDD A;  4IHJ B;  3B40 A;  4YJ3 B;  5EZY B;  1K4C C;  4ABM A;  5ITZ B;  3MHS C;  1P84 F;  3K59 A;  4DXW A;  3BAB A;  3A2F A;  3AG1 C;  3AG2 C;  4BAY A;  5B66 Z;  5JQG B;  3SJC C;  2OWO A;  4X62 B;  2PTM A;  1RPO A;  2A06 H;  2DYR B;  1PKX A;  3ETE A;  3K3W A;  4KFM A;  4F4L A;  1N36 O;  1BL8 A;  2Y69 C;  4O4H A;  3H9V A;  1K97 A;  5EYP A;  5CBH A;  3JAK A;  3R65 A;  3JAR B;  5IT9 N;  2E75 B;  3D36 A;  4FZ1 A;  3K79 A;  4TV9 B;  4DR1 B;  1VEW A;  4DR2 O;  5IWA B;  1F7Y A;  2E5L O;  1Q6I A;  3BA8 A;  4HBN A;  3CWB H;  4PA9 A;  3ZED A;  4MW8 A;  3RYI B;  1F4M A;  4WFA V;  2H94 A;  4JI5 O;  2Q0A A;  2OCH A;  4CS2 A;  2LW7 A;  3DSQ A;  4FLU A;  3A0H Z;  2XHB A;  4LNU B;  4AQY B;  4JI7 B;  1K9M W;  4U7N A;  3CS5 A;  2UUB O;  4IHJ A;  1HNZ B;  3QO8 A;  4YJ3 A;  3ABM C;  5EZY A;  3IAY A;  3AG1 B;  4LH6 A;  3AG2 B;  4TQF A;  5ITZ A;  2MW2 B;  4DW1 A;  4YY3 O;  2Y69 B;  1CPY A;  4FLX A;  5JQG A;  2QR4 A;  1SC5 B;  4MVS A;  1NZ6 A;  1XMO O;  4LP8 A;  5H2F Z;  3CC2 V;  3I5D A;  1SQQ H;  5AG2 A;  3AK1 A;  2UUA O;  1FJG B;  3JAR A;  4E4E A;  4P9O A;  4TV9 A;  4QPJ A;  2N04 A;  2WLI A;  1YJ9 V;  3ABK C;  2IU0 A;  4ZBM A;  3EVK A;  1Q82 W;  1M9N A;  1ZTE A;  2B5U A;  3RYI A;  4FLY A;  3T1H B;  5IYD O;  2HEP A;  4RUE A;  1PPJ H;  2Q69 A;  4NXN B;  1DF5 A;  1FXK C;  4YXW G;  5BZB A;  3DXR B;  2VRZ A;  2DE0 X;  3O9O A;  3ABM B;  2AW9 A;  1Q6H A;  3HB3 B;  4HAM A;  1JOY A;  2Q8V A;  2DQ3 A;  4WFH A;  4X89 A;  3KKY A;  4Q6G A;  4YIO A;  4GKK B;  4JI1 O;  3BA9 A;  3FKS G;  1K73 W;  4I5S A;  5LHH A;  1D5A A;  2YDE A;  1S5L Z;  5A9G A;  3CJH B;  2YC0 A;  4CS4 A;  2EZP A;  4DV0 B;  3JSN A;  5GTH Z;  1IBM B;  2ETN A;  1BHA A;  4H44 B;  1HP8 A;  3NXS A;  4JZ2 A;  1U96 A;  4A5U B;  4LBE C;  2EIJ C;  2A0L A;  4OPA A;  2UU9 B;  2RMK B;  3SJB C;  4PDM A;  1X4T A;  1FXK B;  3KCY A;  5LL6 Y;  1BSM A;  4JI7 O;  1HNW B;  1ENV A;  1L8D A;  3OGI B;  3BFR A;  5B1B C;  1M90 W;  3TXQ A;  1YEW A;  3OMI B;  1IBL B;  4DV6 O;  3CRC A;  3E35 A;  4WFG A;  2V1D A;  1GM9 A;  4DV4 B;  5IYC O;  2KKW A;  1XUQ A;  3GVM A;  4PDR A;  1Y74 B;  1YF2 A;  2IH1 C;  1H2K A;  4KHP B;  4O4I B;  2ZE7 A;  3STZ C;  4JYB A;  5CBF A;  1RFY A;  2CGO A;  3CCR V;  3Q4H B;  3CP1 A;  3L75 H;  4BWA A;  3G67 A;  4BW9 A;  3C90 A;  1QR8 A;  4FIP C;  4X88 A;  3SJQ C;  3P3N A;  3QNE A;  4PI0 A;  3ZMV A;  3OR7 C;  3CJH A;  3CMA V;  3GB7 C;  1J5E O;  2EIJ B;  2LFS A;  4GKJ B;  4FLW A;  2ZR2 A;  2H3O A;  5EBL C;  4Z1M G;  3CCE V;  1S77 D;  3SYP A;  2EIM C;  4GX0 A;  4LC1 A;  3S3W A;  3FX7 A;  3K57 A;  4CC6 A;  2V4D A;  5B1B B;  3G4S V;  1FXK A;  3RGB A;  2CTR A;  4NVP A;  1GN3 A;  1XRE A;  1T5E A;  3WB1 A;  1NI8 A;  3EHB B;  4DK1 A;  3ZX6 A;  3B2E E;  1N34 O;  1N0J A;  4BR6 A;  2ZDI C;  2X0L A;  5BR8 O;  4UVB A;  3SJA C;  2F93 B;  3UQ8 A;  1Y74 A;  1R3L C;  2ITD C;  4GCZ A;  4J10 A;  4CH6 A;  4R6Z A;  1H38 A;  3GWK C;  3AK3 A;  4O4I A;  1WP8 A;  3VQW A;  1QVF U;  3Q4H A;  4EKW A;  1H2G A;  3T4Z A;  2UXB B;  3CXH F;  4CH3 A;  4YIP A;  2P90 A;  3WG7 C;  3SGI A;  1GH6 A;  1R73 A;  1IX9 A;  2EIM B;  2GUZ B;  4B7K A;  3FYI B;  3JAL B;  2MK3 A;  2PY5 A;  3JD1 A;  3K08 A;  5CBG A;  1Q6U A;  4IGG A;  3TCU A;  2UUC B;  1H2N A;  1S3J A;  1ROP A;  1VQ8 V;  2KG7 B;  5J9P C;  4JV5 B;  2IJI A;  4KHP O;  3RYC A;  2XUM A;  1VF7 A;  3J7A U;  4ZHQ B;  2AHY A;  1EBO A;  1I7F A;  4XDJ A;  3CSX A;  4JI0 O;  4PHZ A;  5EC2 C;  1B6Q A;  1XNR B;  4B3T B;  4G2K A;  4TUY B;  5B1A C;  4DRX B;  2M6Y A;  1VP7 A;  3C3S A;  4O4J B;  3OTO O;  3WG7 B;  3K5M A;  3WFV A;  4K0K O;  5H5N A;  3H1J H;  1PNK A;  3ABT A;  2Q6A A;  3VQV A;  3HKE B;  5KMG B;  1KEC A;  4FZ0 A;  2QWQ B;  3DC6 A;  4DUZ B;  5KUM A;  2GUZ A;  4CS3 A;  5EK0 A;  2UXD O;  1QQC A;  4LFB O;  2ZE8 A;  3OD4 A;  2CDY A;  3JAL A;  4JI8 B;  1DGS A;  4UCU A;  5JJJ B;  1S76 D;  3H1K H;  1GRJ A;  1S72 V;  3NR7 A;  5DED A;  1KB9 F;  4D7T A;  1N33 O;  4BIU A;  1BHB A;  4PA4 A;  4MVZ A;  1WB7 A;  2KG7 A;  3GWO A;  3BEH A;  2F4V O;  3WB2 A;  1H8H G;  3FB6 C;  4FM0 A;  3T1C A;  3H01 A;  5J2U B;  4ZHQ A;  5B1A B;  3G6E V;  3AG3 C;  5FPR A;  3APQ A;  1VIB A;  2KB1 A;  2UXB O;  4JZG A;  1ARO P;  4TUY A;  4LFA B;  3FFQ A;  4HYO A;  4DRX A;  4UCS A;  2NLJ C;  4F6R B;  2QM4 A;  1NQT A;  4J7K A;  2ZQM A;  2XT9 A;  5IYZ B;  2WLH A;  1NTK H;  2UXN A;  1XHZ A;  1HR0 O;  2WLN A;  1U97 A;  1SET A;  1NTM H;  1P7B A;  3HKE A;  5KMG A;  4DR6 B;  4FM1 A;  1TAE A;  4WCE V;  1Y4M A;  2LFR A;  1I5X A;  3FAV B;  3BAA A;  2GTS A;  3T4D A;  1MSW D;  3P3P A;  3ZMS A;  2BE3 A;  1M5I A;  3HR0 A;  1AP6 A;  4JTC B;  2PF4 E;  1JNB A;  4PA7 A;  4TOI A;  5H6R A;  1M57 C;  3STL C;  1NVP B;  1LNQ A;  1MZE A;  3AG3 B;  1Y6X A;  2YXH A;  1N36 B;  4OX9 O;  2WA3 A;  5E1A C;  5J2U A;  4WF9 V;  4MTG A;  2VQF O;  2GSM B;  2W6I G;  4DR2 B;  2E5L B;  3HKC B;  3OFN G;  3M7M X;  1Q90 D;  4TT3 G;  2AXT Z;  2LW1 A;  2RNB A;  2BCC H;  4LF9 O;  1XI1 A;  3MD0 A;  4JI5 B;  1GM7 A;  4F6R A;  2ODM A;  4J42 A;  1QHT A;  5IYZ A;  2R9I A;  2QWO B;  2CAZ C;  1I08 A;  2Q67 A;  2Z0A A;  3LSS A;  2WPD G;  1DLB A;  3CYO A;  3CRQ A;  4CH4 A;  4DR3 O;  1AI5 A;  4IYI A;  4UUJ C;  4UV9 A;  1FFX B;  1ZSP A;  1WPB A;  4AIL C;  4ASU G;  2UUB B;  2LGW A;  1M57 B;  3UO2 A;  4ZKI A;  1JFF B;  1B3Q A;  1W2B U;  2LO1 A;  2CTW A;  3SPI A;  5J2T B;  4X9Q A;  2F43 G;  4LR3 A;  1YCI A;  1FAF A;  1VF6 C;  3JAW B;  1FS0 G;  1JCH A;  4GT1 A;  3JD2 A;  3H1L H;  3QF7 A;  2ZE6 A;  4LF6 O;  1MZF A;  2GV9 A;  3CB2 A;  1IBK B;  1XMO B;  2H8P C;  3A8T A;  1KP2 A;  3E8G A;  3I55 V;  2UUA B;  1BS3 A;  4JYA B;  4J9Y B; 
#chains in the Genus database with same CATH homology
 1GN6 A;  1ZLZ A;  2QKA A;  1AP6 A;  1ZUQ A;  2AW9 A;  1PM9 A;  1KKC A;  1PL4 A;  3C3S A;  1AR4 A;  1XIL A;  1SZX A;  3KKY A;  1VEW A;  1I0H A;  4YIO A;  1BT8 A;  1QNM A;  2CE4 A;  2ADQ B;  1GN3 A;  1JR9 A;  3KDR A;  3AK2 A;  1XRE A;  4JYY A;  3LSU A;  3DC6 A;  1P7G A;  3QVN A;  1N0J A;  4BR6 A;  5A9G A;  1EN4 A;  2CDY A;  4F6E A;  1MA1 A;  2RCV A;  1IXB A;  1AP5 A;  3C3T A;  1MMM A;  4GUN A;  4JZ2 A;  1EN6 A;  3MDS A;  3AK3 A;  1VAR A;  1I08 A;  1WB7 A;  1EN5 A;  1IDS A;  1MSD A;  4FFK A;  1D5N A;  3K9S A;  1AR5 A;  1BSM A;  1GN2 A;  1MNG A;  1ZSP A;  4YIP A;  3BFR A;  1IX9 A;  3RN4 A;  3IC9 A;  1EM1 A;  1Y67 A;  3TJT A;  1GN4 A;  4JZG A;  3CEI A;  4X9Q A;  2ADP A;  5AG2 A;  3AK1 A;  1XUQ A;  1LUW A;  1AVM A;  4E4E A;  2GDS A;  2QKC A;  3EVK A;  1N0N A;  1WB8 A;  1XDC A;  1ZTE A;  1B06 A;  3DC5 A;  1LUV A;  2P4K A;  4C7U A;  1BS3 A;  3OT7 A;  1JA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...