1AP5A

Tyr34->phe mutant of human mitochondrial manganese superoxide dismutase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Crystal structure of Y34F mutant human mitochondrial manganese superoxide dismutase and the functional role of tyrosine 34.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ap5A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ap5A02
1I0HA 2CDYA 1BT8A 1ZLZA 4E4EA 1BS3A 3CEIA 2QKCA 3RN4A 1EN4A 1IXBA 4JZGA 1GN4A 1LUVA 1EN5A 1BSMA 2P4KA 1XUQA 1MNGA 1VARA 2ADQB 3MDSA 1JR9A 1LUWA 4YIPA 1PM9A 2AW9A 2GDSA 2CE4A 1QNMA 4X9QA 1I08A 1EN6A 3DC6A 1P7GA 2RCVA 1PL4A 1ZTEA 5A9GA 4GUNA 1N0NA 3C3SA 1IX9A 3AK1A 1XILA 1D5NA 1GN6A 3C3TA 1MMMA 1SZXA 1WB8A 1Y67A 3LSUA 5AG2A 1GN3A 3BFRA 1MSDA 1AVMA 4FFKA 3DC5A 3QVNA 4YIOA 1AP6A 1N0JA 4JZ2A 1ZUQA 1XREA 1AR5A 3AK3A 1AP5A 4F6EA 4BR6A 1ZSPA 3K9SA 1GN2A 1MA1A 3IC9A 1IDSA 3KKYA 3EVKA 4JYYA 1VEWA 1EM1A 2ADPA 3TJTA 1KKCA 1JA8A 1AR4A 1XDCA 4C7UA 3AK2A 1B06A 1WB7A 2QKAA 3OT7A
chains in the Genus database with same CATH superfamily
1I0HA 2CDYA 4TUYA 1BT8A 1Q81W 2F95B 1NI8A 2HJFC 2EIMB 4TQFA 1K33A 1IZ3A 3QO8A 1L0NH 1W59A 3D3QA 2R72A 3JASA 3JALB 2DQ3A 1MZEA 4O4LB 1I94B 4O2BB 3G6EV 1AJNA 3IJ4A 3RYCB 4UV9A 1YEWA 5B3SC 1Q5OA 4HZ3A 1U96A 2EX3A 1K5QA 2F93B 2GV9A 4ABMA 4YY3O 2W6IG 4DW1A 3MAQA 4LF7B 4IYIA 4LR3A 3BA9A 4FIPC 3SYCA 3CX5F 2CH7B 1HWYA 1GN6A 1SA0B 2P67A 4FLUA 1WPBA 2R9RB 5C8YB 2YXHA 4XDKA 4K0KB 1TVKB 5EBLC 4JYCA 3N2KB 2WLMA 3S3XA 1COWG 1GN3A 3ML0A 3ZS8C 4QPKA 2QGNA 1H2KA 4TOIA 3FKSG 4YIOA 2QM8A 1OZ0A 1RSOB 1ZUQA 2DYRB 4FZ0A 3M99B 1AR5A 2X6BA 4X20B 4PA3A 4R6ZA 4UFZA 3SPIA 1ZAUA 4WFEA 4UB6Z 3CD6V 4IT5A 2ARHA 5H6RA 1H5WA 3I55V 1FXKB 4J9YB 4KXRA 3BPZA 1AI7A 3TJTA 3WB2A 3S3WA 2XAQA 1XDCA 4MW8A 3JD3A 2LJ2A 4EB6B 1WB7A 4B7EA 1QU7A 1PNMA 2XAFA 3QF7A 4RUEA 4JTCB 2PF4E 4Z1MG 3KCXA 5JH7B 1NH2B 1DLBA 1YCIA 3FD9A 1EN4A 2Q67A 5IYDO 3OGCC 1K97A 2F1MA 1I5XA 2YXLA 2UUBB 4LWSA 3VQVA 4P2ZA 4J42A 1NTZH 1YF2A 4IHJB 2E5LB 1AB3A 4UCTA 1VARA 2KQXA 3AG2B 1HP8A 3P3NA 4LF8B 4PHZA 1AROP 4UV8A 3DGEA 1P7BA 4PA9A 3LDDA 2P5OA 3K08A 2HKOA 4DR2O 3L9DA 2ZE6A 5LP6A 4BAYA 3CCRV 3T2MA 5JJJB 3Q4HB 1S77D 1OCZB 4Q20A 5B1AB 5IE9A 5B5EZ 4JI7O 2VWJA 4DR5O 2DW4A 1MMMA 3CSXA 2WSSG 4G28B 4DO2A 1FFTB 2N04A 4X66B 2KB1A 4X65O 2LO1A 1US6A 3LSUA 2GTSA 2WLNA 2YICA 3CCSV 3FB7C 3STZC 2ZINA 2C2AA 3WU2Z 3SJAC 1LR1A 4FFKA 1IVSA 3TGUH 4I5SA 2P4VA 2QKSA 4G27B 3JD2A 2P06A 4KUMA 5KAFZ 5KHKA 2WLHA 3CRCA 4N23A 3QO5A 4GT1A 5IJ0B 2JDIG 2Y4UA 1R6KA 5LBQA 1Q7YW 4F6RA 2ZDIC 1IBMB 3CXCU 2A7WA 5B1BC 3CC4V 3CMEV 4KFMA 1WP7A 3RFRA 1KMIZ 2Z5UA 4LP8A 1SRYA 4CH6A 3W7SA 2ITDC 3ABLB 2RN9A 1K4DC 3UT5B 1ORQC 3AK2A 1Y76B 1R3JC 2L35A 4LF4O 4JYAO 1R3LC 4TV9A 3ASOC 3OT7A 4Z1VA 5LYJB 4DR7B 1HNWO 1NKDA 1KP2A 2HP8A 4JAVA 4B7KA 3JAMN 1QCEA 2GHYA 3DXRA 1N33B 5CA0A 3AG1B 2CTWA 2FYUH 2YIDA 3ZMVA 2W0XA 4WBNA 3ZMSA 4QPJA 1XI1A 3T1YO 4GKJO 1YTFD 3TETA 2H8PC 3OTOB 1SESA 1BQ0A 1QHTA 2BTQA 3LSQA 1RPOA 3J81N 3RBZA 5IWAB 5KHJA 2Q0OC 3FYEB 1Z5WA 3ZRVA 3JATA 4DV5B 2PYLA 5CBHA 2UXDO 2UUCB 4O4IA 2NN4A 2UU9B 1VMGA 2FB5A 4O2AA 1VQ4V 3CWBH 3N27A 5K1PA 4TUYB 3CB2A 3ZRXA 3K57A 5KLVH 5H6QA 2IM9A 3LSSA 1JCHA 2Y48A 5KA5A 3LNMB 2ZKOA 1G8MA 4MVMA 1MZFA 3LNNA 2JS5A 4LFCO 4BR6A 4F4LA 4GX5A 3L71H 3RYHA 4WFBV 3ZEDA 3JASB 3W7UA 1HR0O 1YZBA 3KKYA 4WFFA 5BR8B 1N34O 5IYBO 2YIAA 1NQTA 3OGIB 2PTMA 2YI9A 2Z3YA 1VEWA 3ZCCA 2R9AA 2ADPA 4JGSA 3G4SV 3ETDA 4DW0A 3ABTA 2XHBA 4H37A 1N4CA 1XEQA 5EZYA 3TXQA 2ZDIA 1PNLA 5BXZA 1YJWV 1ZLZA 4LF6B 2H94A 3BCCH 3HKCA 3UQ8A 3HKDA 2KSDA 3DSQA 2MK3A 2F4VB 3ETQA 2E74B 1BE3H 4DUZO 2QJ1A 3ZHSA 1BL8A 1QLNA 3OE7G 5L3EA 1VF6C 4DUYB 4PI0A 4JI3O 1QVFU 4ZIBA 2XTAA 2ETNA 4Q6GA 3F7YC 3E8FA 5JQGB 2EIKC 3N2KA 4HYOA 2X0LA 4YJ3A 1D5AA 1R6NA 2RCVA 3ZHQA 4UCRA 1WJZA 4E2LA 2DMXA 5H9CA 3IFXA 4PDRA 1KKDA 3HKEA 1N0NA 3K04A 3SYPA 4DRXA 3FFQA 3UCSC 3E8HA 1R3IC 2HHHB 1X59A 3GVMA 2EIJB 5IY5B 4ASUG 3RW0A 4X1KB 1N32B 4L87A 4LFAB 4NXNB 2ZR3A 2CK3G 2IH3C 4CC5A 1GAXA 4DYLA 2A79B 2IU0A 5FNVA 2YEVA 4LWSB 1URFA 1GN2A 3ZJZA 4LFBB 3O65A 1XMQO 4LF5B 3K79A 1DK1A 4JAUA 4DR4B 3OUSA 2UXBB 2DYSB 2AXTZ 4IHJA 1XNRO 3P32A 4C7UA 4HAMA 2PY5A 4P9PA 4DV4O 1MABG 1CP9A 5JWPA 2E75B 4DV0B 5LP6B 4YXWG 4BWAA 1AJQA 4OXSA 4GLXA 3RWRD 1JJ2U 1VF5B 4NTXA 4FLXA 4B3RO 4MTGA 2X6AA 5KMGA 4OX9B 1T5EA 2EZOA 3CJHB 2HFEC 2XASA 2V1DA 2JJ1G 3EXAA 1S0VA 1SQGA 2P4KA 3QTCA 1H2SB 2D2CB 1L0LH 4PA7A 3G80A 1JFFA 5LMUO 5IYZB 3A2FA 2EILC 2GSMB 3OMAB 5IYCO 2WLKA 3KCYA 2QWNB 1BGYH 4MW3A 5EBWC 3TXSA 3FB5C 5EK0A 3RYIA 1H2GA 3QO7A 1I94O 1FXHA 4RWUA 3WB1A 3JCUZ 3A0BZ 1FFXA 1JX9A 1BMFG 2FL4A 1VQOV 2FKXA 1VQLV 1H8EG 1WB8A 4TV9B 1Y67A 2UXXA 3H1JH 4DR3O 2DWEC 3A0RA 1Y76A 1MSDA 4MTXA 3G67A 3KDRA 2LQTA 5ITZA 3DXRB 3CCQV 5CA0B 2VQEO 1QQCA 3ZHVA 4WBNB 4LH6A 1NVPB 2RQ6A 5J9PC 4J7JA 3ZRSA 4RUFA 1RM1C 3CRRA 3CHXA 4BW5A 2BTQB 2DQ0A 1AJPA 1SC5B 4MVRA 3DTUB 1B06A 3OFNG 2BCCH 2QTOA 5LGNA 1E79G 2OCCB 4JI1B 1Q6IA 1N36B 2OWOA 1VQ6V 2EJ7A 3JATB 4IYHA 4PJ0Z 5CBFA 4O4IB 2LGWA 1BS3A 2H3OA 5LXTA 3CCMV 1FS0G 1F23A 4PD4F 1F4MA 4WFGA 4O2AB 2KKWA 4RQEA 1YSCA 1J95A 3NR7A 1TUBA 4K35A 4CS2A 4O4HA 2ZM6B 3ABKB 4W4LA 1OJHA 4GKKB 1G6UA 1YIJV 2JK5C 1PM9A 1M56C 1W0JG 2UUBO 1I08A 1YDXA 3RYHB 1JNBA 1BHAA 1ZTEA 1GO3F 2B9ZA 2R9IA 4U3JB 2YDEA 1XMOB 3AK1A 3P30A 2A06H 5DEDA 2BOCC 5E1AC 1Q82W 4KP4A 1KQSU 4B3TO 3LDEA 1YITV 1BHBA 1ZL8A 1SZXA 5EZYB 1FPOA 2DOSA 4FLZA 5CMUA 1JJOA 1K8AW 3HKCB 1YTFB 4WFHA 3HKDB 4DR1B 2Q5ZA 3OMIB 1OCOC 5K1XA 3ASOB 2Q4PA 1EBOA 2LW7A 1JMKC 1YHQV 1QR9A 3JSNA 1J5EO 1KKCA 1MOFA 4NXMO 3UKMA 4YJ3B 5BY1A 1JVMA 1AI6A 5JQGA 4JI4O 2W6JG 4AHCA 4J10A 1FAFA 1WN7A 1XQ8A 4O4JB 1FD9A 2QKAA 3ZHUA 4I0XB 3H01A 2QM7A 2AZ0A 1IBMO 3HKEB 2AGAA 2F66C 3K06A 1NTKH 4PDVA 4E4EA 4DRXB 4UB8Z 3AG7A 1IJGA 3CEIA 3VQXA 3RN4A 1XNQB 2IH1C 2JRIA 5LA6A 1GM7A 3F7VC 5L3GA 4CC6A 4UVBA 3H1IH 5JJNB 4X8AA 3HKBA 1ZX3A 2RMKB 4DR7O 4X1KA 2YIBD 1FJGO 4BIZA 1SZTA 4R7CA 4DV6B 5FNVB 2YEVB 1F51A 2OIGA 2W0FC 2HJDA 2Q6AA 1K73W 1GMGA 2CE4A 2VQFB 1HNXO 4MT8A 1M57C 1AR1B 4RAIA 1SQVH 1WAZA 1E1RG 2ZXWB 3K0DA 4MTFA 3OTOO 4FJCC 2PI5A 4JI0B 4GX1A 4PDMA 3C3TA 1H2NA 3SPHA 2IBZH 3FB6C 2HG5C 2X7RB 4PI2A 1XHZA 2UXNA 4B08A 5JVDB 4K8ZA 4DR6B 4DV5O 1NVPD 4YHHO 2UUCO 4KHPO 3JARA 2BSKA 1AP6A 1NBMG 1DTOA 5H5NA 1R6TA 2UU9O 3L75H 5KMGB 3AEIA 4DV3B 5HFLA 3CJHA 3ETGA 3EVKA 3D36C 2EBOA 1HNZB 3CMAV 3THOA 2EINC 1KD1W 5B66Z 1IBLB 5LGUA 4RO2A 1JFFB 4H33A 4YY3B 3E89A 5KUKA 4JASA 2YC0A 3P3PA 5FPRA 2NR5A 3L70H 3DC5A 5IYZA 2ITCC 4K3AA 3RYIB 5BR8O 3GWKC 1X4TA 3LUTB 1PP9H 2YIBA 2EIKB 1V54C 1FFXB 2YSUB 3U10A 2Y69C 1BCCH 3QG5A 1VQ7V 3M7MX 5LHGA 5KA6A 3O9OA 3EFFK 1QR8A 3CP1A 1IBKB 4LF6O 3ASNB 1V55B 4JI6O 5ITZB 3JYCA 1OCRC 1VQ9V 2XNDG 2PGGA 5F2VO 4L8JA 4W4KA 4GYCB 4H44B 2NLJC 1THZA 1K92A 2PI4A 1UPGA 3WG7B 1D5NA 3ZX6A 4HBNA 3T4ZA 1E1QG 3RVZA 1S72V 1M1KW 4JV5B 2UXCO 1NS1A 5LOVA 4EFBA 1GK9A 2QTSA 1H2MA 1KUQA 2WA3A 3BFRA 3JD1A 5IJ9A 1TA8A 5LXTB 2Z0AA 5KX5A 1B04A 1AP5A 3AK3A 2HHHO 5TISZ 2ZE7A 2N05A 2DN9A 2CUGA 2OYQA 2XAHA 3L74H 3H1HH 1FXKC 2M6YA 3F5WC 1N32O 2Y0PA 3L72H 4DK0A 1KC8W 4JI8O 4NXNO 1TUBB 3FYIB 4IL6Z 4O4HB 3H9VA 4CH4A 4X62B 3FX7A 4DR2B 4ZBMA 3MHHC 3A8TA 3F5TA 1WA8A 4DV2O 5GW7A 4H13B 4LFBO 1YJ9V 1GKFA 4JI7B 4LF5O 4U3JA 2UXBO 2OTJV 5EC1C 2Q69A 1IXBA 2MW2B 5EC2C 4FM1A 3ZMTA 1ZL8B 4DV0O 5EIBC 3BA8A 4TSFG 2DJVA 3GB7C 1JPXA 3T1HO 1PL0A 4LF9O 1QBZA 1M90W 1S76D 3BRCA 2ZIOA 2ZE5A 1LUWA 3JAKB 2AW9A 4WF9V 4JI2O 2JEXA 4FLYA 3OEHG 5B1AC 3EHBB 3ZIAG 3C3SA 2QEXV 5IDJA 4B3MO 4LF4B 3BHPA 4WCEV 1N8RW 3IGAC 2ZD9A 2JEUA 2QWRB 3CCJV 1HNWB 3BABA 3OD4A 4FPPA 4I55B 2Q73A 3VBBA 5H2FZ 1R1BA 1P49A 1AVMA 4O4JA 3K5NA 4I0XA 4LBEC 4LNUB 1A32A 2XAJA 5LA6B 4GKJB 2IJHA 4TQDA 3JAWB 1MA1A 5B1NA 3HKBB 4IIJA 4N21A 3JCZA 4UCVA 5CB4B 5GONA 2R70A 2WLLA 2PZSA 1JA8A 1SERA 4KL1A 1RPRA 3TCUA 4TT3G 2UXDB 5KUMA 2RJZA 3CRAA 3ZRWB 3SPJA 2ILMA 3AG1C 2Y0IA 3L73H 2CTRA 3AG4C 3SPCA 5LL6Y 1M56B 5EYPA 1K4CC 4I9WA 1EN5A 4CH5A 4NVPA 1MNGA 4IGGA 4X88A 4JI1O 3SR2C 4BW9A 3J80N 3CCLV 1N36O 3E35A 3MDSA 3JARB 2BSKB 3APQA 3WB0A 5JVDA 1SETA 1JR9A 4YIPA 3SDLA 3CXHF 4AQYO 4MVZA 2LP7A 1KB9F 2IU3A 5B3SB 4JPRA 1PL4A 3U11A 4AILC 4FVMA 3B8NA 1H2LA 4UCUA 1YXBA 2GBOA 4MVSA 1GTOA 4ZOLB 3B40A 4FM2A 1BQZA 1HW7A 2IW5A 3UM7A 3OAAG 2ATKC 2ODMA 2ZM6O 3BEHA 2BTOA 5BMVA 2ZT9B 3CC7V 1LNQA 2BOBC 5AG2A 2JGDB 4X64B 1VF6A 4DUZB 1CEZA 4OGQB 1OV9A 3ZHRA 1BZKA 1N0JA 1XREA 3AG3C 4DV1B 4OPHA 4F6EA 4PA4A 3X2QC 1XL6A 1OCCC 4FLTA 4EKWA 1AI5A 3IAYA 3K03A 1VQPV 2E76B 3M8AA 3SPGA 3W7WA 5EBMC 4LF7O 4NTWA 4CS4A 4UCOA 2LGQA 3CRQA 1Y74A 3H1KH 3HB3B 4JTDB 4K0KO 2QKCA 4PA6A 4JZGA 1NR1A 1M93A 3OR6C 2K9PA 1LUVA 5LOVB 5LGTA 2N74A 1BSMA 3SYOA 1ZWIC 1G1XB 2OIEA 4GCZA 5LMNB 5IJ9B 2KG7A 4QE9A 1XNQO 2CGOA 5KX5B 4U7NA 1XMQB 2B5UA 2WLJA 1FXVA 3B2EE 3DC6A 4ZHQB 4LC1A 1GH6A 2IJKA 5D5QA 4CH3A 2V4DA 1XNRB 4GUNA 2O57A 4DV4B 1CPYA 4JI5B 3D3IA 3K5MA 2EIJC 5IY5C 4DV6O 3VQWA 1DF5A 3OTFA 3CE2A 3N2GA 3ABMC 1IURA 1WA8B 2A0LA 3E22A 3G6BA 3SYAA 3K58A 2HLDG 2VRZA 3RT3C 5CA1A 4QE7A 4D7SA 2Q7GA 2JS3A 5J2TA 2EINB 3ZHTA 2ZR2A 2E5LO 2DE0X 5DECA 1M9NA 4LF8O 4EFEA 4BIUA 2DYSC 1CXZB 1O9HA 4LH7A 5LMUB 2Q9LA 3FAVA 2UUAB 4NYKA 3E83A 1V54B 4DR6O 1UJWB 5B1BB 3MD0A 2Y69B 5LP6C 1V9PA 2EJRA 4X1IA 1UFIA 3NXSA 3KZIZ 1I7FA 4DV3O 2XAGA 3JAKA 3B8MA 1KYOF 2P90A 4X66O 4MTOA 1Z2GA 4TV8A 4X89A 1HNZO 1AILA 4UVCA 4DK1A 1IBLO 3H1LH 4DR3B 1L1FA 5KHIA 1IXMA 1M4UA 1OCRB 1PPJH 2GUZB 4B3SB 4GX2A 1VQMV 4ZKIA 4FMTA 5FPOA 2YI8A 2CTPA 4DV7B 4CBCA 4I55A 2ADQB 3K0GA 2VQEB 1VQNV 4Z2WA 1SQPH 4QGPA 3K3WA 1P4RA 4LNUA 4I4TB 2Q7EA 4FFBA 4IIJB 3STLC 5KHGA 2ZQMA 1Q86W 2WA4A 5GONB 2WLIA 3JAWA 4LCUC 2OT5A 3CPWU 1IBKO 4J11A 1NZ6A 2WLLB 1PD3A 5CB4A 4UXNA 2LFSA 4JF3A 4NTYA 1N33O 4FM0A 4AI8A 1TAEA 3BVOA 1MSWD 1O9GA 4TWKA 1SF9A 3PN1A 3ZRWA 5FL7G 4JAAA 5EYPB 4JV5O 4PV1B 1QLEC 1ROPA 3JD0A 1IDSA 3I5DA 3A0HZ 4R50A 3CRMA 1K5SA 3I56V 2Q0AA 3ZN1A 2VS0A 2FTKA 5IWAO 1EM1A 2V7QG 5CN0A 2EZPA 1B6QA 2OCCC 3LDCA 3ZMUA 4HNAA 1WP8A 2YXYA 1XL4A 1S5LZ 3OMNB 1F7YA 4XBFA 3E2EA 3UO2A 3BY6A 2IJIA 4B3TB 2OTLV 2NNUA 4ZOLA 4X62O 3HR0A 4D7TA 5BMVB 4J7ZA 1XUQA 4UUJC 1PV0A 1KU9A 3ABKC 2QSAA 2G38A 4OPAA 1OHHG 3W7TA 2EIMC 1S5HC 2JGDA 4NB5A 2ZNIA 2GDSA 4FLVA 2HEPA 5JJEB 1AI4A 1RFYA 4D6TH 5A9GA 1J5EB 4NXMB 4GX0A 1SQFA 5J2UA 2YUAA 4JI4B 1SKVA 1B3QA 2QWOB 4A5UB 1XILA 1KBHA 3KG2A 3OUFA 2ZNJA 2F4VO 2RDCA 1Y74B 2IJJA 4UVAA 3D8CA 4DUYO 4I7ZB 1K7DA 2QWQB 4CS3A 1DF4A 2P7TC 2ZIMA 3U0ZA 2LW1A 2F43G 1ZSPA 1KP3A 3RYFA 3MHSC 1FJGB 2RNBA 1NTMH 3PJSK 1S5JA 4ZI7A 4XDLA 2P22C 5IT9N 1VP7A 3CCEV 2B1GA 1K9MW 1HNXB 3T1CA 3OM3B 2KG7B 1Q6HA 1AR4A 2DYRC 3AG4B 3SJBC 5HFMA 5JCOC 1QVGU 5C93A 1I5YA 3ICXA 3C90A 4YJ2A 3J7AU 3RVYA 4ZHQA 4I9QA 4LFAO 3R65A 1Y6XA 3ZN0A 4R8CA 3N2GB 1WPXA 3IC7A 1FYJA 2HR3A 3E22B 3OEEG 4YHHB 4KHPB 3G71V 4X1YA 1M5IA 4G2KA 5CA1B 4QNHB 3ABUA 3K9AA 3APOA 4I50A 5J2TB 1G4YB 3D36A 4DR4O 1FKAO 4DR5B 1NT2B 1QNMA 4X9QA 1PNKA 4X65B 3UO3A 1Y66A 2ZXWC 2LFRA 1YI2V 2EILB 5L3BA 3OW2U 1GRJA 3CCUV 4U3FH 2A9HA 3FAVB 4P9OA 1VQ5V 3AG2C 3ZMZA 1SS3A 1K3EA 1IX9A 3SJQC 1VF7A 3CS5A 3AG3B 4NKGB 1WNSA 4J7KA 4X1IB 5DM6V 2E3CA 5L3FA 2DWDC 4WFAV 3X2QB 4UCSA 1OCCB 3CC2V 1S3JA 3JALA 4BIOA 4OX9O 2CGNA 4O4LA 4O2BA 4J41A 3RYCA 4JTAB 4TV8B 1OCZC 1NH2D 3WFVA 3FB8C 3W7XA 5FLXN 1F4NA 4JYAB 1L8DA 3BAAA 1D2DA 4JI6B 4JYYA 3B4SA 5EIBD 5LHIA 2GUZA 2Q68A 4X64O 2CH7A 4NR1A 2AHZA 2EULA 4DXWA 1SA0A 1RM1B 1KECA 1VIBA 4DV1O 2XOKG 3E8GA 1YVWA 5C8YA 2VWKA 2X6CA 1TVKA 4FFBB 3GWOA 3T1YB 1TUEB 3E8BA 2WLIB 4I4TA 3R66A 2FMLA 1XBLA 2UXCB 2CTQA 1RSOA 3E86A 3ABLC 5JCOA 4J9ZB 1Q6UA 4X20A 4CZZA 1TGOA 2D3OW 2GTAA 1GN4A 1W2BU 1SQBH 4MSWC 3ASNC 1V55C 1HDJA 2XT9A 1FXKA 5KHHA 3SYQA 4P30A 3ABMB 3JSLA 2WPDG 4JI8B 1VQ8V 4EB6A 2ZCEA 1P7GA 4RQFA 1EZVH 2JJ2G 1NR7A 3WG7C 1Z5VA 1PKXA 2CAZC 5JH7A 4ICGA 5LMNO 1RP3B 4DV2B 5L3CA 4LFCB 1R3KC 2Y4TA 2JVDA 4HNAB 2QDOA 4XDJA 1HR0B 4J80A 1N34B 4MVOA 5DN6G 1U97A 2HVJC 3SGIA 2ZE8A 3QVNA 4JI5O 1Q90D 2AHYA 3VQYA 3T1HB 5BZBA 4GKKO 4MVQA 4LF9B 3K5LA 1OCOB 1W0KG 3Q4HA 3ZBHA 4PELA 3B09A 1JQ0A 2F23A 2M7WA 3HPLC 1K34A 4JI2B 4FK5C 4FLWA 1NU1H 1XMOO 5L3DA 2PYJA 1MG1A 4JI3B 3ETEA 4B3MB 1GM9A 1SQXH 4MVUA 1DGSA 5J2UB 4K8XA 2QA4V 2OCHA 1YJNV 2UUAO 3TK1A 1Y4MA 2AZ2A 1GM8A 4F6RB 4U7OA 1Q8IA 5E79Z 4EEQA 5IJ0A 4DR1O 1P84F 3B77A 2WWWA 2Q8VA 2L6LA 1EZJA 1Q43A 3CCVV 1XHXA 1NJIW 2WAMA 5GTIZ 5GTHZ 1VQKV 2JIZG 3UT5A 2BE3A 1EN6A 3CYOA 3RYFB 2QE7G 4MS2A 1SQQH 4B3SO 4H0LB 4ZI7B 5B1OA 2HVKC 5LYJA 1M57B 2QR4A 1H8HG 4PDLA 4DV7O 4FZ1A 1R73A 2XUMA 4QJFB 1QLEB 1FOUA 1Q3EA 3JD4A 4YJ2B 1JOYA 1WLEA 3OR7C 5CA3A 2YS8A 4QIWF 3K59A 2JGUA 5LHHA 1XOUA 2QWPB 4JZ2A 2QM4A 4JYBA 2B1IA 5A2QN 2A3QA 1H38A 3K9SA 1EFRG 4X1YB 3IC9A 3RGBA 3VOUA 1ENVA 2K1EA 2VQFO 4I50B 2Q7HA 5CBGA 4GZRB 5KAIZ 4B3RB 4AQYB 5D5PA 2P6JA 3K5OA 3T4DA 3QNEA 2PUSA 4JI0O 3SJCC
chains in the Genus database with same CATH topology
1I0HA 2CDYA 1BT8A 1ZLZA 4E4EA 1BS3A 3CEIA 2QKCA 3RN4A 1EN4A 1IXBA 4JZGA 1GN4A 1LUVA 1EN5A 1BSMA 2P4KA 1XUQA 1MNGA 1VARA 2ADQB 3MDSA 1JR9A 1LUWA 4YIPA 1PM9A 2AW9A 2GDSA 2CE4A 1QNMA 4X9QA 1I08A 1EN6A 3DC6A 1P7GA 2RCVA 1PL4A 1ZTEA 5A9GA 4GUNA 1N0NA 3C3SA 1IX9A 3AK1A 1XILA 1D5NA 1GN6A 3C3TA 1MMMA 1SZXA 1WB8A 1Y67A 3LSUA 5AG2A 1GN3A 3BFRA 1MSDA 1AVMA 4FFKA 3DC5A 3QVNA 4YIOA 3KDRA 1AP6A 1N0JA 4JZ2A 1ZUQA 1XREA 1AR5A 3AK3A 1AP5A 4F6EA 4BR6A 1ZSPA 3K9SA 1GN2A 1MA1A 3IC9A 1IDSA 3KKYA 3EVKA 4JYYA 1VEWA 1EM1A 2ADPA 3TJTA 1KKCA 1JA8A 1AR4A 1XDCA 4C7UA 3AK2A 1B06A 1WB7A 2QKAA 3OT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I0H A;  2CDY A;  1BT8 A;  1ZLZ A;  4E4E A;  1BS3 A;  3CEI A;  2QKC A;  3RN4 A;  1EN4 A;  1IXB A;  4JZG A;  1GN4 A;  1LUV A;  1EN5 A;  1BSM A;  2P4K A;  1XUQ A;  1MNG A;  1VAR A;  2ADQ B;  3MDS A;  1JR9 A;  1LUW A;  4YIP A;  1PM9 A;  2AW9 A;  2GDS A;  2CE4 A;  1QNM A;  4X9Q A;  1I08 A;  1EN6 A;  3DC6 A;  1P7G A;  2RCV A;  1PL4 A;  1ZTE A;  5A9G A;  4GUN A;  1N0N A;  3C3S A;  1IX9 A;  3AK1 A;  1XIL A;  1D5N A;  1GN6 A;  3C3T A;  1MMM A;  1SZX A;  1WB8 A;  1Y67 A;  3LSU A;  5AG2 A;  1GN3 A;  3BFR A;  1MSD A;  1AVM A;  4FFK A;  3DC5 A;  3QVN A;  4YIO A;  1AP6 A;  1N0J A;  4JZ2 A;  1ZUQ A;  1XRE A;  1AR5 A;  3AK3 A;  1AP5 A;  4F6E A;  4BR6 A;  1ZSP A;  3K9S A;  1GN2 A;  1MA1 A;  3IC9 A;  1IDS A;  3KKY A;  3EVK A;  4JYY A;  1VEW A;  1EM1 A;  2ADP A;  3TJT A;  1KKC A;  1JA8 A;  1AR4 A;  1XDC A;  4C7U A;  3AK2 A;  1B06 A;  1WB7 A;  2QKA A;  3OT7 A; 
#chains in the Genus database with same CATH topology
 1I0H A;  2CDY A;  4TUY A;  1BT8 A;  1Q81 W;  2F95 B;  1NI8 A;  2HJF C;  2EIM B;  4TQF A;  1K33 A;  1IZ3 A;  3QO8 A;  1L0N H;  1W59 A;  3D3Q A;  2R72 A;  3JAS A;  3JAL B;  2DQ3 A;  1MZE A;  4O4L B;  1I94 B;  4O2B B;  3G6E V;  1AJN A;  3IJ4 A;  3RYC B;  4UV9 A;  1YEW A;  5B3S C;  1Q5O A;  4HZ3 A;  1U96 A;  2EX3 A;  1K5Q A;  2F93 B;  2GV9 A;  4ABM A;  4YY3 O;  2W6I G;  4DW1 A;  3MAQ A;  4LF7 B;  4IYI A;  4LR3 A;  3BA9 A;  4FIP C;  3SYC A;  3CX5 F;  2CH7 B;  1HWY A;  1GN6 A;  1SA0 B;  2P67 A;  4FLU A;  1WPB A;  2R9R B;  5C8Y B;  2YXH A;  4XDK A;  4K0K B;  1TVK B;  5EBL C;  4JYC A;  3N2K B;  2WLM A;  3S3X A;  1COW G;  1GN3 A;  3ML0 A;  3ZS8 C;  4QPK A;  2QGN A;  1H2K A;  4TOI A;  3FKS G;  4YIO A;  2QM8 A;  1OZ0 A;  1RSO B;  1ZUQ A;  2DYR B;  4FZ0 A;  3M99 B;  1AR5 A;  2X6B A;  4X20 B;  4PA3 A;  4R6Z A;  4UFZ A;  3SPI A;  1ZAU A;  4WFE A;  4UB6 Z;  3CD6 V;  4IT5 A;  2ARH A;  5H6R A;  1H5W A;  3I55 V;  1FXK B;  4J9Y B;  4KXR A;  3BPZ A;  1AI7 A;  3TJT A;  3WB2 A;  3S3W A;  2XAQ A;  1XDC A;  4MW8 A;  3JD3 A;  2LJ2 A;  4EB6 B;  1WB7 A;  4B7E A;  1QU7 A;  1PNM A;  2XAF A;  3QF7 A;  4RUE A;  4JTC B;  2PF4 E;  4Z1M G;  3KCX A;  5JH7 B;  1NH2 B;  1DLB A;  1YCI A;  3FD9 A;  1EN4 A;  2Q67 A;  5IYD O;  3OGC C;  1K97 A;  2F1M A;  1I5X A;  2YXL A;  2UUB B;  4LWS A;  3VQV A;  4P2Z A;  4J42 A;  1NTZ H;  1YF2 A;  4IHJ B;  2E5L B;  1AB3 A;  4UCT A;  1VAR A;  2KQX A;  3AG2 B;  1HP8 A;  3P3N A;  4LF8 B;  4PHZ A;  1ARO P;  4UV8 A;  3DGE A;  1P7B A;  4PA9 A;  3LDD A;  2P5O A;  3K08 A;  2HKO A;  4DR2 O;  3L9D A;  2ZE6 A;  5LP6 A;  4BAY A;  3CCR V;  3T2M A;  5JJJ B;  3Q4H B;  1S77 D;  1OCZ B;  4Q20 A;  5B1A B;  5IE9 A;  5B5E Z;  4JI7 O;  2VWJ A;  4DR5 O;  2DW4 A;  1MMM A;  3CSX A;  2WSS G;  4G28 B;  4DO2 A;  1FFT B;  2N04 A;  4X66 B;  2KB1 A;  4X65 O;  2LO1 A;  1US6 A;  3LSU A;  2GTS A;  2WLN A;  2YIC A;  3CCS V;  3FB7 C;  3STZ C;  2ZIN A;  2C2A A;  3WU2 Z;  3SJA C;  1LR1 A;  4FFK A;  1IVS A;  3TGU H;  4I5S A;  2P4V A;  2QKS A;  4G27 B;  3JD2 A;  2P06 A;  4KUM A;  5KAF Z;  5KHK A;  2WLH A;  3CRC A;  4N23 A;  3QO5 A;  4GT1 A;  5IJ0 B;  2JDI G;  2Y4U A;  1R6K A;  5LBQ A;  1Q7Y W;  4F6R A;  2ZDI C;  1IBM B;  3CXC U;  2A7W A;  5B1B C;  3CC4 V;  3CME V;  4KFM A;  1WP7 A;  3RFR A;  1KMI Z;  2Z5U A;  4LP8 A;  1SRY A;  4CH6 A;  3W7S A;  2ITD C;  3ABL B;  2RN9 A;  1K4D C;  3UT5 B;  1ORQ C;  3AK2 A;  1Y76 B;  1R3J C;  2L35 A;  4LF4 O;  4JYA O;  1R3L C;  4TV9 A;  3ASO C;  3OT7 A;  4Z1V A;  5LYJ B;  4DR7 B;  1HNW O;  1NKD A;  1KP2 A;  2HP8 A;  4JAV A;  4B7K A;  3JAM N;  1QCE A;  2GHY A;  3DXR A;  1N33 B;  5CA0 A;  3AG1 B;  2CTW A;  2FYU H;  2YID A;  3ZMV A;  2W0X A;  4WBN A;  3ZMS A;  4QPJ A;  1XI1 A;  3T1Y O;  4GKJ O;  1YTF D;  3TET A;  2H8P C;  3OTO B;  1SES A;  1BQ0 A;  1QHT A;  2BTQ A;  3LSQ A;  1RPO A;  3J81 N;  3RBZ A;  5IWA B;  5KHJ A;  2Q0O C;  3FYE B;  1Z5W A;  3ZRV A;  3JAT A;  4DV5 B;  2PYL A;  5CBH A;  2UXD O;  2UUC B;  4O4I A;  2NN4 A;  2UU9 B;  1VMG A;  2FB5 A;  4O2A A;  1VQ4 V;  3CWB H;  3N27 A;  5K1P A;  4TUY B;  3CB2 A;  3ZRX A;  3K57 A;  5KLV H;  5H6Q A;  2IM9 A;  3LSS A;  1JCH A;  2Y48 A;  5KA5 A;  3LNM B;  2ZKO A;  1G8M A;  4MVM A;  1MZF A;  3LNN A;  2JS5 A;  4LFC O;  4BR6 A;  4F4L A;  4GX5 A;  3L71 H;  3RYH A;  4WFB V;  3ZED A;  3JAS B;  3W7U A;  1HR0 O;  1YZB A;  3KKY A;  4WFF A;  5BR8 B;  1N34 O;  5IYB O;  2YIA A;  1NQT A;  3OGI B;  2PTM A;  2YI9 A;  2Z3Y A;  1VEW A;  3ZCC A;  2R9A A;  2ADP A;  4JGS A;  3G4S V;  3ETD A;  4DW0 A;  3ABT A;  2XHB A;  4H37 A;  1N4C A;  1XEQ A;  5EZY A;  3TXQ A;  2ZDI A;  1PNL A;  5BXZ A;  1YJW V;  1ZLZ A;  4LF6 B;  2H94 A;  3BCC H;  3HKC A;  3UQ8 A;  3HKD A;  2KSD A;  3DSQ A;  2MK3 A;  2F4V B;  3ETQ A;  2E74 B;  1BE3 H;  4DUZ O;  2QJ1 A;  3ZHS A;  1BL8 A;  1QLN A;  3OE7 G;  5L3E A;  1VF6 C;  4DUY B;  4PI0 A;  4JI3 O;  1QVF U;  4ZIB A;  2XTA A;  2ETN A;  4Q6G A;  3F7Y C;  3E8F A;  5JQG B;  2EIK C;  3N2K A;  4HYO A;  2X0L A;  4YJ3 A;  1D5A A;  1R6N A;  2RCV A;  3ZHQ A;  4UCR A;  1WJZ A;  4E2L A;  2DMX A;  5H9C A;  3IFX A;  4PDR A;  1KKD A;  3HKE A;  1N0N A;  3K04 A;  3SYP A;  4DRX A;  3FFQ A;  3UCS C;  3E8H A;  1R3I C;  2HHH B;  1X59 A;  3GVM A;  2EIJ B;  5IY5 B;  4ASU G;  3RW0 A;  4X1K B;  1N32 B;  4L87 A;  4LFA B;  4NXN B;  2ZR3 A;  2CK3 G;  2IH3 C;  4CC5 A;  1GAX A;  4DYL A;  2A79 B;  2IU0 A;  5FNV A;  2YEV A;  4LWS B;  1URF A;  1GN2 A;  3ZJZ A;  4LFB B;  3O65 A;  1XMQ O;  4LF5 B;  3K79 A;  1DK1 A;  4JAU A;  4DR4 B;  3OUS A;  2UXB B;  2DYS B;  2AXT Z;  4IHJ A;  1XNR O;  3P32 A;  4C7U A;  4HAM A;  2PY5 A;  4P9P A;  4DV4 O;  1MAB G;  1CP9 A;  5JWP A;  2E75 B;  4DV0 B;  5LP6 B;  4YXW G;  4BWA A;  1AJQ A;  4OXS A;  4GLX A;  3RWR D;  1JJ2 U;  1VF5 B;  4NTX A;  4FLX A;  4B3R O;  4MTG A;  2X6A A;  5KMG A;  4OX9 B;  1T5E A;  2EZO A;  3CJH B;  2HFE C;  2XAS A;  2V1D A;  2JJ1 G;  3EXA A;  1S0V A;  1SQG A;  2P4K A;  3QTC A;  1H2S B;  2D2C B;  1L0L H;  4PA7 A;  3G80 A;  1JFF A;  5LMU O;  5IYZ B;  3A2F A;  2EIL C;  2GSM B;  3OMA B;  5IYC O;  2WLK A;  3KCY A;  2QWN B;  1BGY H;  4MW3 A;  5EBW C;  3TXS A;  3FB5 C;  5EK0 A;  3RYI A;  1H2G A;  3QO7 A;  1I94 O;  1FXH A;  4RWU A;  3WB1 A;  3JCU Z;  3A0B Z;  1FFX A;  1JX9 A;  1BMF G;  2FL4 A;  1VQO V;  2FKX A;  1VQL V;  1H8E G;  1WB8 A;  4TV9 B;  1Y67 A;  2UXX A;  3H1J H;  4DR3 O;  2DWE C;  3A0R A;  1Y76 A;  1MSD A;  4MTX A;  3G67 A;  3KDR A;  2LQT A;  5ITZ A;  3DXR B;  3CCQ V;  5CA0 B;  2VQE O;  1QQC A;  3ZHV A;  4WBN B;  4LH6 A;  1NVP B;  2RQ6 A;  5J9P C;  4J7J A;  3ZRS A;  4RUF A;  1RM1 C;  3CRR A;  3CHX A;  4BW5 A;  2BTQ B;  2DQ0 A;  1AJP A;  1SC5 B;  4MVR A;  3DTU B;  1B06 A;  3OFN G;  2BCC H;  2QTO A;  5LGN A;  1E79 G;  2OCC B;  4JI1 B;  1Q6I A;  1N36 B;  2OWO A;  1VQ6 V;  2EJ7 A;  3JAT B;  4IYH A;  4PJ0 Z;  5CBF A;  4O4I B;  2LGW A;  1BS3 A;  2H3O A;  5LXT A;  3CCM V;  1FS0 G;  1F23 A;  4PD4 F;  1F4M A;  4WFG A;  4O2A B;  2KKW A;  4RQE A;  1YSC A;  1J95 A;  3NR7 A;  1TUB A;  4K35 A;  4CS2 A;  4O4H A;  2ZM6 B;  3ABK B;  4W4L A;  1OJH A;  4GKK B;  1G6U A;  1YIJ V;  2JK5 C;  1PM9 A;  1M56 C;  1W0J G;  2UUB O;  1I08 A;  1YDX A;  3RYH B;  1JNB A;  1BHA A;  1ZTE A;  1GO3 F;  2B9Z A;  2R9I A;  4U3J B;  2YDE A;  1XMO B;  3AK1 A;  3P30 A;  2A06 H;  5DED A;  2BOC C;  5E1A C;  1Q82 W;  4KP4 A;  1KQS U;  4B3T O;  3LDE A;  1YIT V;  1BHB A;  1ZL8 A;  1SZX A;  5EZY B;  1FPO A;  2DOS A;  4FLZ A;  5CMU A;  1JJO A;  1K8A W;  3HKC B;  1YTF B;  4WFH A;  3HKD B;  4DR1 B;  2Q5Z A;  3OMI B;  1OCO C;  5K1X A;  3ASO B;  2Q4P A;  1EBO A;  2LW7 A;  1JMK C;  1YHQ V;  1QR9 A;  3JSN A;  1J5E O;  1KKC A;  1MOF A;  4NXM O;  3UKM A;  4YJ3 B;  5BY1 A;  1JVM A;  1AI6 A;  5JQG A;  4JI4 O;  2W6J G;  4AHC A;  4J10 A;  1FAF A;  1WN7 A;  1XQ8 A;  4O4J B;  1FD9 A;  2QKA A;  3ZHU A;  4I0X B;  3H01 A;  2QM7 A;  2AZ0 A;  1IBM O;  3HKE B;  2AGA A;  2F66 C;  3K06 A;  1NTK H;  4PDV A;  4E4E A;  4DRX B;  4UB8 Z;  3AG7 A;  1IJG A;  3CEI A;  3VQX A;  3RN4 A;  1XNQ B;  2IH1 C;  2JRI A;  5LA6 A;  1GM7 A;  3F7V C;  5L3G A;  4CC6 A;  4UVB A;  3H1I H;  5JJN B;  4X8A A;  3HKB A;  1ZX3 A;  2RMK B;  4DR7 O;  4X1K A;  2YIB D;  1FJG O;  4BIZ A;  1SZT A;  4R7C A;  4DV6 B;  5FNV B;  2YEV B;  1F51 A;  2OIG A;  2W0F C;  2HJD A;  2Q6A A;  1K73 W;  1GMG A;  2CE4 A;  2VQF B;  1HNX O;  4MT8 A;  1M57 C;  1AR1 B;  4RAI A;  1SQV H;  1WAZ A;  1E1R G;  2ZXW B;  3K0D A;  4MTF A;  3OTO O;  4FJC C;  2PI5 A;  4JI0 B;  4GX1 A;  4PDM A;  3C3T A;  1H2N A;  3SPH A;  2IBZ H;  3FB6 C;  2HG5 C;  2X7R B;  4PI2 A;  1XHZ A;  2UXN A;  4B08 A;  5JVD B;  4K8Z A;  4DR6 B;  4DV5 O;  1NVP D;  4YHH O;  2UUC O;  4KHP O;  3JAR A;  2BSK A;  1AP6 A;  1NBM G;  1DTO A;  5H5N A;  1R6T A;  2UU9 O;  3L75 H;  5KMG B;  3AEI A;  4DV3 B;  5HFL A;  3CJH A;  3ETG A;  3EVK A;  3D36 C;  2EBO A;  1HNZ B;  3CMA V;  3THO A;  2EIN C;  1KD1 W;  5B66 Z;  1IBL B;  5LGU A;  4RO2 A;  1JFF B;  4H33 A;  4YY3 B;  3E89 A;  5KUK A;  4JAS A;  2YC0 A;  3P3P A;  5FPR A;  2NR5 A;  3L70 H;  3DC5 A;  5IYZ A;  2ITC C;  4K3A A;  3RYI B;  5BR8 O;  3GWK C;  1X4T A;  3LUT B;  1PP9 H;  2YIB A;  2EIK B;  1V54 C;  1FFX B;  2YSU B;  3U10 A;  2Y69 C;  1BCC H;  3QG5 A;  1VQ7 V;  3M7M X;  5LHG A;  5KA6 A;  3O9O A;  3EFF K;  1QR8 A;  3CP1 A;  1IBK B;  4LF6 O;  3ASN B;  1V55 B;  4JI6 O;  5ITZ B;  3JYC A;  1OCR C;  1VQ9 V;  2XND G;  2PGG A;  5F2V O;  4L8J A;  4W4K A;  4GYC B;  4H44 B;  2NLJ C;  1THZ A;  1K92 A;  2PI4 A;  1UPG A;  3WG7 B;  1D5N A;  3ZX6 A;  4HBN A;  3T4Z A;  1E1Q G;  3RVZ A;  1S72 V;  1M1K W;  4JV5 B;  2UXC O;  1NS1 A;  5LOV A;  4EFB A;  1GK9 A;  2QTS A;  1H2M A;  1KUQ A;  2WA3 A;  3BFR A;  3JD1 A;  5IJ9 A;  1TA8 A;  5LXT B;  2Z0A A;  5KX5 A;  1B04 A;  1AP5 A;  3AK3 A;  2HHH O;  5TIS Z;  2ZE7 A;  2N05 A;  2DN9 A;  2CUG A;  2OYQ A;  2XAH A;  3L74 H;  3H1H H;  1FXK C;  2M6Y A;  3F5W C;  1N32 O;  2Y0P A;  3L72 H;  4DK0 A;  1KC8 W;  4JI8 O;  4NXN O;  1TUB B;  3FYI B;  4IL6 Z;  4O4H B;  3H9V A;  4CH4 A;  4X62 B;  3FX7 A;  4DR2 B;  4ZBM A;  3MHH C;  3A8T A;  3F5T A;  1WA8 A;  4DV2 O;  5GW7 A;  4H13 B;  4LFB O;  1YJ9 V;  1GKF A;  4JI7 B;  4LF5 O;  4U3J A;  2UXB O;  2OTJ V;  5EC1 C;  2Q69 A;  1IXB A;  2MW2 B;  5EC2 C;  4FM1 A;  3ZMT A;  1ZL8 B;  4DV0 O;  5EIB C;  3BA8 A;  4TSF G;  2DJV A;  3GB7 C;  1JPX A;  3T1H O;  1PL0 A;  4LF9 O;  1QBZ A;  1M90 W;  1S76 D;  3BRC A;  2ZIO A;  2ZE5 A;  1LUW A;  3JAK B;  2AW9 A;  4WF9 V;  4JI2 O;  2JEX A;  4FLY A;  3OEH G;  5B1A C;  3EHB B;  3ZIA G;  3C3S A;  2QEX V;  5IDJ A;  4B3M O;  4LF4 B;  3BHP A;  4WCE V;  1N8R W;  3IGA C;  2ZD9 A;  2JEU A;  2QWR B;  3CCJ V;  1HNW B;  3BAB A;  3OD4 A;  4FPP A;  4I55 B;  2Q73 A;  3VBB A;  5H2F Z;  1R1B A;  1P49 A;  1AVM A;  4O4J A;  3K5N A;  4I0X A;  4LBE C;  4LNU B;  1A32 A;  2XAJ A;  5LA6 B;  4GKJ B;  2IJH A;  4TQD A;  3JAW B;  1MA1 A;  5B1N A;  3HKB B;  4IIJ A;  4N21 A;  3JCZ A;  4UCV A;  5CB4 B;  5GON A;  2R70 A;  2WLL A;  2PZS A;  1JA8 A;  1SER A;  4KL1 A;  1RPR A;  3TCU A;  4TT3 G;  2UXD B;  5KUM A;  2RJZ A;  3CRA A;  3ZRW B;  3SPJ A;  2ILM A;  3AG1 C;  2Y0I A;  3L73 H;  2CTR A;  3AG4 C;  3SPC A;  5LL6 Y;  1M56 B;  5EYP A;  1K4C C;  4I9W A;  1EN5 A;  4CH5 A;  4NVP A;  1MNG A;  4IGG A;  4X88 A;  4JI1 O;  3SR2 C;  4BW9 A;  3J80 N;  3CCL V;  1N36 O;  3E35 A;  3MDS A;  3JAR B;  2BSK B;  3APQ A;  3WB0 A;  5JVD A;  1SET A;  1JR9 A;  4YIP A;  3SDL A;  3CXH F;  4AQY O;  4MVZ A;  2LP7 A;  1KB9 F;  2IU3 A;  5B3S B;  4JPR A;  1PL4 A;  3U11 A;  4AIL C;  4FVM A;  3B8N A;  1H2L A;  4UCU A;  1YXB A;  2GBO A;  4MVS A;  1GTO A;  4ZOL B;  3B40 A;  4FM2 A;  1BQZ A;  1HW7 A;  2IW5 A;  3UM7 A;  3OAA G;  2ATK C;  2ODM A;  2ZM6 O;  3BEH A;  2BTO A;  5BMV A;  2ZT9 B;  3CC7 V;  1LNQ A;  2BOB C;  5AG2 A;  2JGD B;  4X64 B;  1VF6 A;  4DUZ B;  1CEZ A;  4OGQ B;  1OV9 A;  3ZHR A;  1BZK A;  1N0J A;  1XRE A;  3AG3 C;  4DV1 B;  4OPH A;  4F6E A;  4PA4 A;  3X2Q C;  1XL6 A;  1OCC C;  4FLT A;  4EKW A;  1AI5 A;  3IAY A;  3K03 A;  1VQP V;  2E76 B;  3M8A A;  3SPG A;  3W7W A;  5EBM C;  4LF7 O;  4NTW A;  4CS4 A;  4UCO A;  2LGQ A;  3CRQ A;  1Y74 A;  3H1K H;  3HB3 B;  4JTD B;  4K0K O;  2QKC A;  4PA6 A;  4JZG A;  1NR1 A;  1M93 A;  3OR6 C;  2K9P A;  1LUV A;  5LOV B;  5LGT A;  2N74 A;  1BSM A;  3SYO A;  1ZWI C;  1G1X B;  2OIE A;  4GCZ A;  5LMN B;  5IJ9 B;  2KG7 A;  4QE9 A;  1XNQ O;  2CGO A;  5KX5 B;  4U7N A;  1XMQ B;  2B5U A;  2WLJ A;  1FXV A;  3B2E E;  3DC6 A;  4ZHQ B;  4LC1 A;  1GH6 A;  2IJK A;  5D5Q A;  4CH3 A;  2V4D A;  1XNR B;  4GUN A;  2O57 A;  4DV4 B;  1CPY A;  4JI5 B;  3D3I A;  3K5M A;  2EIJ C;  5IY5 C;  4DV6 O;  3VQW A;  1DF5 A;  3OTF A;  3CE2 A;  3N2G A;  3ABM C;  1IUR A;  1WA8 B;  2A0L A;  3E22 A;  3G6B A;  3SYA A;  3K58 A;  2HLD G;  2VRZ A;  3RT3 C;  5CA1 A;  4QE7 A;  4D7S A;  2Q7G A;  2JS3 A;  5J2T A;  2EIN B;  3ZHT A;  2ZR2 A;  2E5L O;  2DE0 X;  5DEC A;  1M9N A;  4LF8 O;  4EFE A;  4BIU A;  2DYS C;  1CXZ B;  1O9H A;  4LH7 A;  5LMU B;  2Q9L A;  3FAV A;  2UUA B;  4NYK A;  3E83 A;  1V54 B;  4DR6 O;  1UJW B;  5B1B B;  3MD0 A;  2Y69 B;  5LP6 C;  1V9P A;  2EJR A;  4X1I A;  1UFI A;  3NXS A;  3KZI Z;  1I7F A;  4DV3 O;  2XAG A;  3JAK A;  3B8M A;  1KYO F;  2P90 A;  4X66 O;  4MTO A;  1Z2G A;  4TV8 A;  4X89 A;  1HNZ O;  1AIL A;  4UVC A;  4DK1 A;  1IBL O;  3H1L H;  4DR3 B;  1L1F A;  5KHI A;  1IXM A;  1M4U A;  1OCR B;  1PPJ H;  2GUZ B;  4B3S B;  4GX2 A;  1VQM V;  4ZKI A;  4FMT A;  5FPO A;  2YI8 A;  2CTP A;  4DV7 B;  4CBC A;  4I55 A;  2ADQ B;  3K0G A;  2VQE B;  1VQN V;  4Z2W A;  1SQP H;  4QGP A;  3K3W A;  1P4R A;  4LNU A;  4I4T B;  2Q7E A;  4FFB A;  4IIJ B;  3STL C;  5KHG A;  2ZQM A;  1Q86 W;  2WA4 A;  5GON B;  2WLI A;  3JAW A;  4LCU C;  2OT5 A;  3CPW U;  1IBK O;  4J11 A;  1NZ6 A;  2WLL B;  1PD3 A;  5CB4 A;  4UXN A;  2LFS A;  4JF3 A;  4NTY A;  1N33 O;  4FM0 A;  4AI8 A;  1TAE A;  3BVO A;  1MSW D;  1O9G A;  4TWK A;  1SF9 A;  3PN1 A;  3ZRW A;  5FL7 G;  4JAA A;  5EYP B;  4JV5 O;  4PV1 B;  1QLE C;  1ROP A;  3JD0 A;  1IDS A;  3I5D A;  3A0H Z;  4R50 A;  3CRM A;  1K5S A;  3I56 V;  2Q0A A;  3ZN1 A;  2VS0 A;  2FTK A;  5IWA O;  1EM1 A;  2V7Q G;  5CN0 A;  2EZP A;  1B6Q A;  2OCC C;  3LDC A;  3ZMU A;  4HNA A;  1WP8 A;  2YXY A;  1XL4 A;  1S5L Z;  3OMN B;  1F7Y A;  4XBF A;  3E2E A;  3UO2 A;  3BY6 A;  2IJI A;  4B3T B;  2OTL V;  2NNU A;  4ZOL A;  4X62 O;  3HR0 A;  4D7T A;  5BMV B;  4J7Z A;  1XUQ A;  4UUJ C;  1PV0 A;  1KU9 A;  3ABK C;  2QSA A;  2G38 A;  4OPA A;  1OHH G;  3W7T A;  2EIM C;  1S5H C;  2JGD A;  4NB5 A;  2ZNI A;  2GDS A;  4FLV A;  2HEP A;  5JJE B;  1AI4 A;  1RFY A;  4D6T H;  5A9G A;  1J5E B;  4NXM B;  4GX0 A;  1SQF A;  5J2U A;  2YUA A;  4JI4 B;  1SKV A;  1B3Q A;  2QWO B;  4A5U B;  1XIL A;  1KBH A;  3KG2 A;  3OUF A;  2ZNJ A;  2F4V O;  2RDC A;  1Y74 B;  2IJJ A;  4UVA A;  3D8C A;  4DUY O;  4I7Z B;  1K7D A;  2QWQ B;  4CS3 A;  1DF4 A;  2P7T C;  2ZIM A;  3U0Z A;  2LW1 A;  2F43 G;  1ZSP A;  1KP3 A;  3RYF A;  3MHS C;  1FJG B;  2RNB A;  1NTM H;  3PJS K;  1S5J A;  4ZI7 A;  4XDL A;  2P22 C;  5IT9 N;  1VP7 A;  3CCE V;  2B1G A;  1K9M W;  1HNX B;  3T1C A;  3OM3 B;  2KG7 B;  1Q6H A;  1AR4 A;  2DYR C;  3AG4 B;  3SJB C;  5HFM A;  5JCO C;  1QVG U;  5C93 A;  1I5Y A;  3ICX A;  3C90 A;  4YJ2 A;  3J7A U;  3RVY A;  4ZHQ A;  4I9Q A;  4LFA O;  3R65 A;  1Y6X A;  3ZN0 A;  4R8C A;  3N2G B;  1WPX A;  3IC7 A;  1FYJ A;  2HR3 A;  3E22 B;  3OEE G;  4YHH B;  4KHP B;  3G71 V;  4X1Y A;  1M5I A;  4G2K A;  5CA1 B;  4QNH B;  3ABU A;  3K9A A;  3APO A;  4I50 A;  5J2T B;  1G4Y B;  3D36 A;  4DR4 O;  1FKA O;  4DR5 B;  1NT2 B;  1QNM A;  4X9Q A;  1PNK A;  4X65 B;  3UO3 A;  1Y66 A;  2ZXW C;  2LFR A;  1YI2 V;  2EIL B;  5L3B A;  3OW2 U;  1GRJ A;  3CCU V;  4U3F H;  2A9H A;  3FAV B;  4P9O A;  1VQ5 V;  3AG2 C;  3ZMZ A;  1SS3 A;  1K3E A;  1IX9 A;  3SJQ C;  1VF7 A;  3CS5 A;  3AG3 B;  4NKG B;  1WNS A;  4J7K A;  4X1I B;  5DM6 V;  2E3C A;  5L3F A;  2DWD C;  4WFA V;  3X2Q B;  4UCS A;  1OCC B;  3CC2 V;  1S3J A;  3JAL A;  4BIO A;  4OX9 O;  2CGN A;  4O4L A;  4O2B A;  4J41 A;  3RYC A;  4JTA B;  4TV8 B;  1OCZ C;  1NH2 D;  3WFV A;  3FB8 C;  3W7X A;  5FLX N;  1F4N A;  4JYA B;  1L8D A;  3BAA A;  1D2D A;  4JI6 B;  4JYY A;  3B4S A;  5EIB D;  5LHI A;  2GUZ A;  2Q68 A;  4X64 O;  2CH7 A;  4NR1 A;  2AHZ A;  2EUL A;  4DXW A;  1SA0 A;  1RM1 B;  1KEC A;  1VIB A;  4DV1 O;  2XOK G;  3E8G A;  1YVW A;  5C8Y A;  2VWK A;  2X6C A;  1TVK A;  4FFB B;  3GWO A;  3T1Y B;  1TUE B;  3E8B A;  2WLI B;  4I4T A;  3R66 A;  2FML A;  1XBL A;  2UXC B;  2CTQ A;  1RSO A;  3E86 A;  3ABL C;  5JCO A;  4J9Z B;  1Q6U A;  4X20 A;  4CZZ A;  1TGO A;  2D3O W;  2GTA A;  1GN4 A;  1W2B U;  1SQB H;  4MSW C;  3ASN C;  1V55 C;  1HDJ A;  2XT9 A;  1FXK A;  5KHH A;  3SYQ A;  4P30 A;  3ABM B;  3JSL A;  2WPD G;  4JI8 B;  1VQ8 V;  4EB6 A;  2ZCE A;  1P7G A;  4RQF A;  1EZV H;  2JJ2 G;  1NR7 A;  3WG7 C;  1Z5V A;  1PKX A;  2CAZ C;  5JH7 A;  4ICG A;  5LMN O;  1RP3 B;  4DV2 B;  5L3C A;  4LFC B;  1R3K C;  2Y4T A;  2JVD A;  4HNA B;  2QDO A;  4XDJ A;  1HR0 B;  4J80 A;  1N34 B;  4MVO A;  5DN6 G;  1U97 A;  2HVJ C;  3SGI A;  2ZE8 A;  3QVN A;  4JI5 O;  1Q90 D;  2AHY A;  3VQY A;  3T1H B;  5BZB A;  4GKK O;  4MVQ A;  4LF9 B;  3K5L A;  1OCO B;  1W0K G;  3Q4H A;  3ZBH A;  4PEL A;  3B09 A;  1JQ0 A;  2F23 A;  2M7W A;  3HPL C;  1K34 A;  4JI2 B;  4FK5 C;  4FLW A;  1NU1 H;  1XMO O;  5L3D A;  2PYJ A;  1MG1 A;  4JI3 B;  3ETE A;  4B3M B;  1GM9 A;  1SQX H;  4MVU A;  1DGS A;  5J2U B;  4K8X A;  2QA4 V;  2OCH A;  1YJN V;  2UUA O;  3TK1 A;  1Y4M A;  2AZ2 A;  1GM8 A;  4F6R B;  4U7O A;  1Q8I A;  5E79 Z;  4EEQ A;  5IJ0 A;  4DR1 O;  1P84 F;  3B77 A;  2WWW A;  2Q8V A;  2L6L A;  1EZJ A;  1Q43 A;  3CCV V;  1XHX A;  1NJI W;  2WAM A;  5GTI Z;  5GTH Z;  1VQK V;  2JIZ G;  3UT5 A;  2BE3 A;  1EN6 A;  3CYO A;  3RYF B;  2QE7 G;  4MS2 A;  1SQQ H;  4B3S O;  4H0L B;  4ZI7 B;  5B1O A;  2HVK C;  5LYJ A;  1M57 B;  2QR4 A;  1H8H G;  4PDL A;  4DV7 O;  4FZ1 A;  1R73 A;  2XUM A;  4QJF B;  1QLE B;  1FOU A;  1Q3E A;  3JD4 A;  4YJ2 B;  1JOY A;  1WLE A;  3OR7 C;  5CA3 A;  2YS8 A;  4QIW F;  3K59 A;  2JGU A;  5LHH A;  1XOU A;  2QWP B;  4JZ2 A;  2QM4 A;  4JYB A;  2B1I A;  5A2Q N;  2A3Q A;  1H38 A;  3K9S A;  1EFR G;  4X1Y B;  3IC9 A;  3RGB A;  3VOU A;  1ENV A;  2K1E A;  2VQF O;  4I50 B;  2Q7H A;  5CBG A;  4GZR B;  5KAI Z;  4B3R B;  4AQY B;  5D5P A;  2P6J A;  3K5O A;  3T4D A;  3QNE A;  2PUS A;  4JI0 O;  3SJC C; 
#chains in the Genus database with same CATH homology
 1I0H A;  2CDY A;  1BT8 A;  1ZLZ A;  4E4E A;  1BS3 A;  3CEI A;  2QKC A;  3RN4 A;  1EN4 A;  1IXB A;  4JZG A;  1GN4 A;  1LUV A;  1EN5 A;  1BSM A;  2P4K A;  1XUQ A;  1MNG A;  1VAR A;  2ADQ B;  3MDS A;  1JR9 A;  1LUW A;  4YIP A;  1PM9 A;  2AW9 A;  2GDS A;  2CE4 A;  1QNM A;  4X9Q A;  1I08 A;  1EN6 A;  3DC6 A;  1P7G A;  2RCV A;  1PL4 A;  1ZTE A;  5A9G A;  4GUN A;  1N0N A;  3C3S A;  1IX9 A;  3AK1 A;  1XIL A;  1D5N A;  1GN6 A;  3C3T A;  1MMM A;  1SZX A;  1WB8 A;  1Y67 A;  3LSU A;  5AG2 A;  1GN3 A;  3BFR A;  1MSD A;  1AVM A;  4FFK A;  3DC5 A;  3QVN A;  4YIO A;  3KDR A;  1AP6 A;  1N0J A;  4JZ2 A;  1ZUQ A;  1XRE A;  1AR5 A;  3AK3 A;  1AP5 A;  4F6E A;  4BR6 A;  1ZSP A;  3K9S A;  1GN2 A;  1MA1 A;  3IC9 A;  1IDS A;  3KKY A;  3EVK A;  4JYY A;  1VEW A;  1EM1 A;  2ADP A;  3TJT A;  1KKC A;  1JA8 A;  1AR4 A;  1XDC A;  4C7U A;  3AK2 A;  1B06 A;  1WB7 A;  2QKA A;  3OT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...