1AP5A

Tyr34->phe mutant of human mitochondrial manganese superoxide dismutase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Y34F mutant human mitochondrial manganese superoxide dismutase and the functional role of tyrosine 34.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
total genus 66
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ap5A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ap5A02
3KKYA 3AK1A 4JZ2A 1Y67A 4C7UA 1BSMA 3TJTA 3BFRA 5A9GA 1IDSA 1JR9A 4F6EA 4YIOA 1EM1A 1AR5A 3AK3A 3MDSA 1LUWA 4YIPA 2QKAA 1GN3A 1N0JA 3OT7A 1MMMA 1D5NA 1N0NA 4FFKA 1I08A 3K9SA 1AP6A 2ADQB 1GN4A 4BR6A 1WB8A 3EVKA 1IXBA 3AK2A 3C3SA 4JZGA 1IX9A 1BS3A 4X9QA 3RN4A 3DC6A 1VEWA 1I0HA 1JA8A 2ADPA 1EN4A 1ZTEA 1XILA 3C3TA 1WB7A 1AR4A 1PM9A 2GDSA 3DC5A 1VARA 3QVNA 3CEIA 4GUNA 5AG2A 2P4KA 4JYYA 1MSDA 1EN6A 1B06A 1GN2A 1QNMA 3LSUA 1XREA 2QKCA 1XUQA 1EN5A 2CDYA 1XDCA 1ZSPA 1LUVA 2RCVA 1BT8A 1ZLZA 1MA1A 4E4EA 1PL4A 3IC9A 1KKCA 1GN6A 2CE4A 1P7GA 1ZUQA 1MNGA 1AP5A 2AW9A 1SZXA 1AVMA
chains in the Genus database with same CATH superfamily
4YJ3B 1Y76B 3O9OA 2JIZG 3JD0A 5B1OA 5KLVH 2X7RB 1XMQO 2ATKC 2UUCB 4IGGA 2VWJA 3LUTB 2E5LB 2X6BA 2XAFA 3SYAA 1CEZA 1M90W 1URFA 2VRZA 2UUCO 4DV2B 4O4JB 3AG4B 3R65A 4X1IA 5IJ9B 4LP8A 2A7WA 5CBGA 4NYKA 4U7OA 3I5DA 2ADQB 2F43G 2AZ0A 5HFLA 2Q68A 3N2KB 3QTCA 5JH7B 2EILB 2QSAA 2FL4A 1HNZO 3OD4A 4AHCA 3OTFA 2BSKB 2B9ZA 5JWPA 3ZN0A 1XILA 1AI6A 4K0KO 1SC5B 1WP8A 1A32A 1SETA 4O2AB 3CCRV 1BQZA 2YXHA 1K3EA 4JAUA 3ZRSA 1DTOA 3CCMV 5LMNO 1IBMO 5LP6A 4JI7O 2BOCC 1F51A 3OGIB 4U3JA 5IYZB 2W0FC 2RCVA 1P4RA 1H2MA 1QR9A 3IC9A 5E79Z 4Z1VA 3BEHA 3P3NA 3HB3B 2P6JA 1AVMA 3KKYA 4Q6GA 1MZFA 3SPCA 3FAVB 2CGOA 3MHSC 3SPIA 2F4VB 3F5WC 1Y67A 3BA9A 2BOBC 4ABMA 4O2BB 1Y74A 1HDJA 5LGNA 3ABTA 1JVMA 1SQGA 2JDIG 4IHJA 2ZNIA 4PV1B 4UVBA 2RQ6A 3BY6A 3LDEA 2V4DA 3OEEG 5J2TB 1KD1W 5FPOA 3JSNA 1IXBA 1R6KA 1I7FA 4XDLA 3ZMZA 1HNXO 4I55A 2KG7B 1KMIZ 4DRXA 1K9MW 2IU0A 4QNHB 2W0XA 5IWAB 4FM1A 4JI4O 5CBHA 3K5MA 3KZIZ 3F5TA 4X64O 4FM0A 2B5UA 4JI5O 1Q90D 1PKXA 4ICGA 1RP3B 1JFFA 4JTAB 1SQBH 4R7CA 3N27A 1M4UA 4G2KA 5LOVA 1KB9F 3T1CA 3OGCC 2WA3A 1U96A 5H6RA 3B8MA 2Q0OC 4J9ZB 2QJ1A 3WG7B 5LL6Y 1VQ5V 2KSDA 1NU1H 2W6JG 3CXHF 2A9HA 3MD0A 1K92A 2QKCA 1XUQA 4BAYA 2WLMA 5EZYA 2UUAB 3ZHTA 3K5NA 5L3GA 5IJ0A 4LF8B 1HWYA 2WLLB 4CH5A 1QVFU 2PZSA 1P7GA 4JI2B 1AP5A 4X65O 2AW9A 1SZTA 3HPLC 1L1FA 5IYBO 4L8JA 1K5QA 3E86A 3FKSG 3B4SA 2EIMC 4WFEA 1SQXH 3ICXA 1OCZB 1R3KC 1SERA 1FOUA 4I4TA 1VF6A 3JARA 2UUAO 1RM1C 2JEUA 2Q7EA 2CGNA 3CB2A 4JI5B 2L35A 3ZCCA 1Q3EA 3K9SA 1YTFB 5B5EZ 1EFRG 4FJCC 1GM7A 3DXRA 2Q9LA 4E2LA 3ABLC 1Z5WA 2ZXWB 3CRRA 1YF2A 4H37A 3A0BZ 3G6EV 2ZXWC 4LC1A 1AJPA 4JI1B 2HP8A 3JAKB 3TGUH 4JI6O 5L3FA 1QR8A 4J9YB 3G6BA 4HNAB 4LH7A 3U10A 4LCUC 1XNRO 1EN4A 4JF3A 1IBLO 1BHAA 1WB7A 2QDOA 1NJIW 4Q20A 4QJFB 4DV1O 4MVQA 2HEPA 1OCZC 3D36C 4AILC 4KXRA 4ZI7A 1YI2V 2F4VO 3ASNB 3TETA 4YJ2A 3HKCB 2QKSA 4DV4B 3LDDA 2ZKOA 1VF7A 1JX9A 2ITDC 3CRCA 3OMIB 3UKMA 1NR1A 4BWAA 2ODMA 2EJ7A 2A06H 1YJ9V 4GKKB 3RVYA 2XOKG 2GV9A 2CE4A 4AQYO 5A2QN 2YS8A 3G67A 4JAAA 1EBOA 1SQVH 3AK1A 4QPKA 1XHXA 4WFBV 3GWOA 4D7TA 1M9NA 1IDSA 5JJJB 4GYCB 1J5EO 2WLNA 2VWKA 2WLLA 4EFEA 2P06A 2PTMA 5B1AB 2HJDA 4JI3O 3B8NA 1M1KW 4OX9B 1N34B 1PV0A 2ZDIA 2DOSA 3J80N 3UCSC 2OCCB 2PI4A 4PI2A 5KAIZ 4PA3A 1NH2B 3K9AA 4WFAV 2LGWA 4B3MB 2MK3A 3ZRWA 1QCEA 3CWBH 1HR0O 2QWRB 1I0HA 3JAWA 2V1DA 5IWAO 4GKJB 4I50A 4DV6B 1K7DA 2FKXA 4DW0A 1AROP 1PM9A 2GDSA 1W2BU 2K9PA 3QVNA 3S3WA 2DN9A 2P4KA 4DV2O 1FAFA 2ZCEA 3AG7A 4PD4F 1D2DA 3QF7A 4JI6B 2QE7G 1SKVA 5KHIA 2UXXA 1WN7A 2EIKB 1Y4MA 1NTZH 1R1BA 3HKBA 1EN5A 5CB4B 2BCCH 1VIBA 3CX5F 3G4SV 1GRJA 3AEIA 4DUZO 1ZLZA 3RYIA 4X8AA 1VF6C 1SS3A 4UCOA 1G6UA 2A79B 4N23A 2P7TC 4H44B 4B3SO 3RYFB 4DK1A 3A8TA 4X66B 3JAKA 3L74H 1TA8A 1B3QA 4JYBA 2QGNA 3B09A 1NH2D 2PUSA 2X6CA 4J7ZA 1NZ6A 2W6IG 2QKAA 3TXQA 3NR7A 2YIBA 1VQKV 1N0NA 3T1YO 1KBHA 1AP6A 3UT5A 4UCUA 4YY3O 1VQ9V 2BE3A 4UCRA 4XDJA 5EBMC 5FL7G 1TGOA 1N34O 1W0KG 2EILC 2ZR2A 1FPOA 2OCCC 1R3JC 3GB7C 2ARHA 3JD3A 4N21A 3ETQA 5D5QA 5J9PC 3ETEA 2NLJC 4PDLA 3EXAA 4UB6Z 3RYHA 2K1EA 1NVPD 1H38A 1JMKC 3OFNG 3T1YB 3VOUA 2IU3A 5CN0A 3DC5A 1BE3H 1VARA 3RYCA 3ETGA 1RM1B 2H3OA 2UXBB 4GUNA 1PNKA 4CS4A 4JYAB 4B3RB 1KYOF 3JASB 4JYYA 2IH3C 1VQ6V 2ZE8A 4LF4O 2KB1A 4PA4A 2WSSG 1P49A 4YJ2B 4DUYB 4W4LA 1KP2A 4UXNA 3ZJZA 2HG5C 1Q7YW 4LFCB 3OR7C 3O65A 1N33B 2PGGA 4X1YA 2UXDO 1KECA 2XHBA 4J42A 4O4JA 3RT3C 3F7YC 2MW2B 3QO5A 3MAQA 5H2FZ 2BTOA 4LBEC 3J7AU 4TSFG 4WCEV 3K0DA 4JPRA 1S72V 2CTPA 2Y0PA 3H1HH 4J80A 2F93B 2IJKA 4QPJA 1YXBA 3MHHC 4ZBMA 2HLDG 4F6EA 3E89A 5TISZ 3BAAA 3VQYA 5DECA 4RUFA 1VQ4V 1ZAUA 4L87A 1SF9A 1XMOO 1FFXB 2WLHA 5BR8B 2IBZH 3HKEB 4QE7A 1I08A 2LQTA 3CP1A 3FB8C 3L72H 5C93A 1BHBA 5DEDA 4MVUA 1AILA 1UFIA 5LYJB 4DV7B 3D3IA 3A0HZ 3K04A 1YJNV 1FFTB 1JQ0A 4YHHO 1S5HC 1GTOA 4JZGA 4A5UB 5CA1A 4HBNA 4WBNB 1F4MA 1S5LZ 2H94A 3CRQA 4LF6O 4FLZA 2E74B 4IYHA 5C8YA 5IY5C 3E22A 4X9QA 3DGEA 3RN4A 3ZN1A 5B3SB 1MSWD 3SYPA 2R9RB 3KG2A 2R72A 1H8HG 2P90A 4RUEA 4DR1B 4KHPB 1JNBA 1XQ8A 4TV8B 2GUZB 1PPJH 4I5SA 1AI4A 2EJRA 4D7SA 4DR5B 3SYOA 3H1KH 3OR6C 5EZYB 2E3CA 3L73H 4LF9B 3KDRA 1GO3F 1FYJA 3CJHA 1E1QG 3BRCA 1R6TA 2FB5A 4H33A 4NTWA 4WFGA 3CSXA 3ZHSA 3CRMA 4YY3B 5IYDO 1V55B 2NN4A 4FIPC 2A3QA 4PA6A 1COWG 4MS2A 1KQSU 4X66O 2R9IA 3JYCA 3JATA 1IBLB 3JCZA 3BHPA 1QBZA 2VQFB 3UM7A 2B1IA 4MW3A 2BSKA 3FB5C 1BSMA 4EKWA 2AZ2A 2BTQB 2QWQB 4KUMA 1SQFA 2CTRA 2DWEC 4MSWC 5IDJA 3BABA 3AG2C 2IJJA 3AK3A 3MDSA 3P32A 5BMVA 3H9VA 5LA6A 4OPAA 1K4DC 5L3EA 1NTMH 3APQA 4DUYO 1OCOC 3M8AA 2EINC 3CCJV 2DQ0A 1S0VA 4GX0A 4ZHQA 5LBQA 1Y74B 5C8YB 2R9AA 1K5SA 3JAMN 2E5LO 4CS3A 4MTGA 5EYPA 2M7WA 2FMLA 1OCCB 1QLEC 3AG3B 3CS5A 2DMXA 3ASOC 1CXZB 2HHHB 2VQEO 1VF5B 5JJNB 4RO2A 5EIBC 2AXTZ 3ZIAG 1Z5VA 1VQPV 1K73W 4DV5B 4UCTA 4DR3O 2UXCB 4JI2O 5LGTA 5IY5B 3ZX6A 3UQ8A 3JALA 4UV8A 1I5XA 3HKBB 3LSUA 1FD9A 3HKCA 5J2UA 1ZL8B 1PNMA 4F6RA 5KUKA 4ZOLA 1IZ3A 1F7YA 1NI8A 3JD2A 1FJGO 1S5JA 2GTSA 1OCRC 2VS0A 1JJ2U 3T4ZA 4P9PA 1DK1A 1PL4A 3WFVA 2YEVB 4ZHQB 1YJWV 2DYSB 4I50B 2AHZA 4I0XA 2XAHA 1GM8A 1MG1A 3FAVA 3STZC 1YTFD 1AJQA 3M99B 1N32O 5EC1C 2EULA 2ZIOA 4I7ZB 1J95A 4X1KB 2CH7A 1FJGB 5KA6A 3E83A 3TXSA 2WLKA 1AR5A 2HJFC 1Q81W 5IYZA 4KFMA 3CCVV 4JI8B 4LWSA 1Y66A 2ETNA 4HYOA 4UVCA 3IAYA 2DWDC 1VQOV 3JSLA 2Y48A 3QG5A 4OXSA 3RYHB 4NXNO 4TOIA 3K5OA 1XMOB 5H5NA 3JAWB 5GTIZ 2JJ1G 4NXMO 4LF5B 3AK2A 1O9GA 1GAXA 3LNNA 3TK1A 2UU9B 3FX7A 3B77A 4PELA 4PJ0Z 2RMKB 1M56C 5GONB 5J2UB 3RBZA 4MTXA 2IH1C 2UXDB 3BPZA 1AR4A 4B3TO 3ABUA 4NXNB 3AG4C 2WLIB 3OMAB 2M6YA 1PP9H 5LA6B 1HNWO 4GX1A 3ZMSA 1R3LC 2RDCA 3SJQC 1T5EA 4X89A 1QNMA 4GZRB 4LFCO 4QIWF 3FD9A 2Q4PA 2WWWA 2JS3A 4B3RO 4DK0A 4OX9O 3AG1B 4DR4B 2ZE6A 1FXHA 1VQLV 2HVJC 1S76D 2JGDB 1R6NA 2B1GA 2JS5A 3S3XA 4K8XA 4CBCA 2FYUH 2D2CB 4LF7O 1N36O 5CB4A 4R8CA 3SDLA 3OE7G 5D5PA 1WPXA 4JTCB 2JVDA 2Q6AA 4B08A 5CA0A 1SA0B 3ML0A 4JI7B 1OJHA 1HW7A 1CP9A 4TT3G 1R73A 2YI8A 2D3OW 4YIOA 1EM1A 4O4IA 3JALB 2OIEA 1I94O 3ZHQA 5LP6C 4K0KB 5K1XA 4EB6B 3K03A 2CK3G 4FZ0A 2UXNA 3W7WA 3JARB 3N2KA 3C90A 2HHHO 4CH4A 3A0RA 1SESA 4X20B 3SJAC 1NKDA 5CA1B 1WJZA 1Q8IA 4LF6B 3A2FA 2F95B 3THOA 1IXMA 1ZTEA 2N04A 1B6QA 3K08A 4JASA 5B1BC 3WB0A 4DUZB 4F4LA 4FM2A 1NQTA 1JJOA 4DR2O 1YDXA 2KKWA 2YXYA 4ZOLB 4OGQB 1D5AA 5JVDA 2LW7A 2XNDG 1WNSA 1GMGA 4DV0O 3R66A 4LNUB 2IM9A 2LGQA 3AG1C 1XDCA 1ZSPA 2WLIA 1FXKC 4XBFA 5KX5A 2Y4UA 4WBNA 1HNXB 1GN6A 1IBKO 4B7EA 5CMUA 1ZUQA 2P22C 3OUSA 3E8HA 1XBLA 5LXTB 4BW5A 2NNUA 4LR3A 2Q5ZA 4EB6A 2DW4A 1BL8A 1FFXA 1NT2B 1W0JG 4X65B 2GBOA 4U3FH 5EC2C 3BFRA 1I94B 2ZINA 2Q73A 5KHGA 4XDKA 4FVMA 1PL0A 1ROPA 3W7UA 4UUJC 4DYLA 3SPGA 1D5NA 4X88A 4R50A 5LHHA 1XEQA 3ZRXA 1QHTA 4OPHA 5JCOA 3FYEB 5IJ9A 2DYRB 5FNVA 3UO3A 2LFRA 5IYCO 1JCHA 4LF8O 4NB5A 2ZD9A 2XASA 3ZHUA 3J81N 1IX9A 1H5WA 4FFBA 4DRXB 4X1YB 4WF9V 2DJVA 4CH3A 4AQYB 1Q5OA 2OWOA 1H8EG 3H1LH 1G8MA 4DR7B 3CPWU 1YZBA 3E8FA 3D3QA 4IHJB 5KHKA 5KMGB 3JASA 4MVOA 4PDVA 1MZEA 2NR5A 1N36B 2P4VA 1DLBA 4X62B 1EN6A 4MW8A 1BGYH 2KG7A 2EINB 2Q7HA 2DYRC 4LFAO 3E8BA 3CMAV 1GKFA 1XREA 3ABLB 4O4HA 1L8DA 4X64B 3K3WA 1IURA 2PF4E 2CTWA 1QQCA 3OTOB 3CC7V 4E4EA 3L70H 4DO2A 5K1PA 3RYIB 1YHQV 4UFZA 2EX3A 2QTSA 4X62O 4JAVA 3LNMB 1B04A 1KP3A 1SRYA 1WPBA 2YC0A 1Q6IA 4J7KA 4LFAB 5LP6B 4AI8A 4JZ2A 3RYFA 2WLJA 4DV0B 3TJTA 3ZHVA 3CE2A 3QNEA 1M57C 3AG3C 4P30A 2P5OA 2XTAA 1YVWA 1MMMA 2XT9A 2YIBD 4NTXA 3SPJA 3E2EA 2Y0IA 3ZEDA 4DR2B 4R6ZA 3GWKC 1M93A 4TQDA 2V7QG 3I55V 2HKOA 2YEVA 3CRAA 1H2LA 3ABKB 2L6LA 1BQ0A 3ETDA 2ZE7A 3WG7C 3SGIA 1OZ0A 4X20A 4NVPA 1VEWA 4GX2A 1JA8A 1VQ8V 5B1BB 4O4LA 1N32B 4O4LB 4JYAO 2X6AA 2ZQMA 1P7BA 1H2KA 2KQXA 2DYSC 1HP8A 3JD4A 1BMFG 2XAJA 1KUQA 1HNZB 4TV8A 1K4CC 4UCVA 3ZRWB 4JI3B 1DGSA 4G28B 4DXWA 2ZIMA 1YITV 1S77D 3U11A 1K34A 5IE9A 4FPPA 3WB2A 1X4TA 4LH6A 4TUYB 3E8GA 3OAAG 2O57A 4DV3O 2ZT9B 2ILMA 3JD1A 3CCEV 2OTLV 3ZMTA 1G4YB 3IGAC 2G38A 5BR8O 3U0ZA 2YIAA 5L3BA 4I9WA 3OW2U 5LHGA 1IVSA 4P2ZA 4MTOA 5DM6V 4GKKO 5LMUB 1K97A 3HKEA 4HZ3A 1N4CA 4JI0B 5BMVB 2XAGA 3PJSK 3APOA 3IC7A 5KHJA 4RWUA 3B40A 4B3SB 2VQEB 2OIGA 1G1XB 4FLYA 1DF5A 1BCCH 4UCSA 1H2NA 3JATB 1AI7A 5KAFZ 4YXWG 5E1AC 1GN4A 3CCUV 1SA0A 3C3SA 4JYCA 1NTKH 4CC6A 2PYLA 5H9CA 2EZOA 5KUMA 4BIUA 4DR6O 3OUFA 3ZRVA 1GM9A 3SYCA 5EIBD 5FPRA 4JI1O 3RWRD 4KP4A 5BY1A 4FLTA 2ZM6O 1E79G 3PN1A 2CUGA 4ZI7B 1RFYA 4FLXA 2Q7GA 2YICA 5LMNB 2WA4A 4MT8A 1ZL8A 3FB7C 4RQFA 1H2GA 3HKDB 1NR7A 3RGBA 2H8PC 4IL6Z 4BIZA 1NVPB 2GTAA 4HNAA 1N8RW 4PHZA 3VQXA 2HVKC 1K8AW 1TUBA 3ASNC 3ASOB 2JEXA 4YJ3A 2F66C 2Q8VA 2Z0AA 4IIJA 3OMNB 1QLEB 1YCIA 3RVZA 2ZM6B 4K3AA 1Z2GA 1FS0G 4EEQA 2Q0AA 1WP7A 4TQFA 2XUMA 5ITZB 3VBBA 2QM4A 5ITZA 1PD3A 4UVAA 3GVMA 5F2VO 1LR1A 4DV4O 4DR1O 4KHPO 3QO8A 4O4HB 3AG2B 3BCCH 4IT5A 4D6TH 2CAZC 1HNWB 1M5IA 3VQWA 1W59A 3D36A 2OCHA 4FLVA 4DV7O 3K79A 3CXCU 1AI5A 3ZMUA 4J10A 1AR1B 4ZKIA 1ZX3A 2DQ3A 4MVRA 1X59A 4JV5O 3CYOA 4JTDB 2EZPA 4KL1A 4X1KA 2QM7A 4BIOA 4DW1A 5IJ0B 3HR0A 3H1JH 3ABKC 3LSSA 4NXMB 1ZWIC 1BS3A 3Q4HA 1XNQB 4X1IB 2N05A 1N33O 3IFXA 5LOVB 5FNVB 3OTOO 1TUEB 4NKGB 1JFFB 3CEIA 4LF4B 1OCCC 1EZJA 1GH6A 4TWKA 3ZHRA 4HAMA 1RSOB 2X0LA 3OEHG 1MSDA 4I4TB 1XOUA 1MOFA 2VQFO 4MVMA 2QTOA 4WFFA 4I9QA 1BZKA 5J2TA 2C2AA 5CA0B 4DV6O 1RSOA 2EIKC 3N2GA 4PA7A 5B1AC 5JQGA 4I55B 3OM3B 3RW0A 2UXBO 1WA8B 4FK5C 2AHYA 1QVGU 2UUBB 2RJZA 4U7NA 1SZXA 1F23A 3EFFK 4CS2A 1WLEA 2E75B 3I56V 3T4DA 4DV5O 2PY5A 3SPHA 4FFBB 5A9GA 3B2EE 1ENVA 2QA4V 2EIJC 5LGUA 4LF9O 3T1HO 4MVSA 3K0GA 1FXVA 3OT7A 4O2AA 2QR4A 3Q4HB 1M56B 2YDEA 5HFMA 1WA8A 4F6RB 1O9HA 4DR4O 2YI9A 5GW7A 5GTHZ 4DR6B 3N2GB 3CD6V 4LFBB 1S3JA 2HR3A 4JGSA 3M7MX 3TCUA 2R70A 4YHHB 1SQQH 1OCOB 3QO7A 2OYQA 2PYJA 2UU9O 5LMUO 4QE9A 4CC5A 1WAZA 2AGAA 5KMGA 2WAMA 3K57A 1Q86W 5JQGB 3IJ4A 5AG2A 5KX5B 2CTQA 4J41A 3W7TA 2JRIA 1VP7A 3ZMVA 3L9DA 4Z1MG 1K33A 1XI1A 4O2BA 1B06A 4UB8Z 4JI8O 4DV3B 2YUAA 4P9OA 2XAQA 4G27B 5EBWC 5JH7A 4B7KA 1L0NH 4IIJB 1Y76A 4LF5O 1LUVA 3RYCB 1GK9A 4LFBO 4MTFA 3T1HB 1JOYA 1MA1A 1XMQB 2OTJV 1FXKB 1KKCA 1QLNA 3G71V 2LW1A 1MNGA 4TV9B 4RQEA 2OT5A 3E22B 3DXRB 5IT9N 1KU9A 2EIMB 2HFEC 2LP7A 1VQMV 4GKJO 2GHYA 2ZE5A 1Q6HA 4IYIA 1YSCA 4PDMA 5LHIA 1IBMB 2Q69A 1US6A 4B3MO 4DR5O 2EBOA 2RN9A 3WU2Z 4GCZA 4J7JA 1LUWA 5KHHA 5JCOC 3SJBC 4GT1A 1PNLA 5LXTA 3BVOA 2Z5UA 2UUBO 3EHBB 5B66Z 5BXZA 1F4NA 1TVKB 2F23A 3D8CA 1XL4A 4Z2WA 4DR3B 2UXCO 3K58A 1YIJV 4GLXA 3JCUZ 2JK5C 3P3PA 1J5EB 2LFSA 1CPYA 3CC2V 4CH6A 3HKDA 1KC8W 3DC6A 4K8ZA 3SJCC 1XHZA 5JVDB 2QWPB 3UO2A 4WFHA 4UV9A 1UPGA 4H13B 3CCLV 2YIDA 1DF4A 1THZA 2Y69C 3UT5B 3WB1A 2FTKA 4QGPA 1VMGA 4ZIBA 3CCQV 2LJ2A 3K5LA 4TV9A 4CZZA 1GN2A 5CBFA 1IJGA 3K59A 4JI4B 2QWNB 5LYJA 4LNUA 1ORQC 4ASUG 2PI5A 3FFQA 1XNQO 1AB3A 1TAEA 4EFBA 2CDYA 1MABG 2JJ2G 4TUYA 2WPDG 1QU7A 1BT8A 3KCXA 1H2SB 2QWOB 4B3TB 4RAIA 1V55C 3E35A 2LO1A 4DV1B 2YXLA 3VQVA 2ZDIC 3SYQA 5EK0A 2EIJB 4JV5B 3P30A 4NTYA 2QM8A 4JI0O 4K35A 2Q67A 3L71H 4FMTA 3ZBHA 3G80A 2N74A 2GSMB 1TUBB 1XNRB 5B1NA 1R3IC 1XL6A 4O4IB 4PDRA 5FLXN 3ZS8C 4NR1A 4C7UA 1M57B 3F7VC 1JR9A 3H01A 3LDCA 3LSQA 2JGDA 2F1MA 4YIPA 3CC4V 2ZR3A 3CJHB 1GN3A 1N0JA 3STLC 1YEWA 1P84F 5B3SC 4DR7O 1Q43A 4FFKA 1VQ7V 3X2QC 2IW5A 3T2MA 1UJWB 3L75H 3W7XA 1LNQA 3K06A 4W4KA 1E1RG 3X2QB 4BR6A 1WB8A 2Y4TA 3EVKA 4H0LB 2Z3YA 5L3CA 1NBMG 1HR0B 4FLWA 1V54B 2IJIA 1RPOA 3W7SA 5L3DA 1OHHG 2YSUB 3KCYA 2CH7B 1OV9A 2P67A 4FLUA 4U3JB 2GUZA 4LF7B 2JGUA 5JJEB 5EYPB 1I5YA 5CA3A 2ADPA 1EZVH 3RFRA 2IJHA 1AJNA 1Q6UA 3ABMC 3C3TA 1SQPH 3H1IH 4I0XB 4BW9A 5KA5A 3ABMB 1Q82W 1FKAO 2E76B 3DTUB 4PA9A 3CCSV 5DN6G 1NS1A 1JPXA 2RNBA 1Y6XA 2A0LA 4FZ1A 1IBKB 3BA8A 4GX5A 5EBLC 5GONA 1V54C 1V9PA 3SR2C 2ZNJA 2BTQA 1VQNV 3CMEV 1TVKA 5H6QA 4MVZA 4PI0A 5BZBA 4J11A 3FB6C 2ITCC 2DE0X 1FXKA 1U97A 1OCRB 1L0LH 3CHXA 2Y69B 2QEXV 3NXSA 4LWSB 3FYIB 1RPRA 3DSQA 1KKDA
chains in the Genus database with same CATH topology
3KKYA 3AK1A 4JZ2A 1Y67A 4C7UA 1BSMA 3TJTA 3BFRA 5A9GA 1IDSA 1JR9A 4F6EA 4YIOA 1EM1A 1AR5A 3AK3A 3MDSA 1LUWA 4YIPA 2QKAA 1GN3A 1N0JA 3OT7A 1MMMA 1D5NA 1N0NA 4FFKA 1I08A 3K9SA 1AP6A 2ADQB 1GN4A 4BR6A 1WB8A 3EVKA 1IXBA 3AK2A 3C3SA 4JZGA 1IX9A 1BS3A 4X9QA 3RN4A 3DC6A 1VEWA 1I0HA 1JA8A 2ADPA 1EN4A 1ZTEA 1XILA 3C3TA 1WB7A 1AR4A 1PM9A 2GDSA 3DC5A 1VARA 3QVNA 3CEIA 4GUNA 5AG2A 2P4KA 4JYYA 3KDRA 1MSDA 1EN6A 1B06A 1GN2A 1QNMA 3LSUA 1XREA 2QKCA 1XUQA 1EN5A 2CDYA 1XDCA 1ZSPA 1LUVA 2RCVA 1BT8A 1ZLZA 1MA1A 4E4EA 1PL4A 3IC9A 1KKCA 1GN6A 2CE4A 1P7GA 1ZUQA 1MNGA 1AP5A 2AW9A 1SZXA 1AVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKY A;  3AK1 A;  4JZ2 A;  1Y67 A;  4C7U A;  1BSM A;  3TJT A;  3BFR A;  5A9G A;  1IDS A;  1JR9 A;  4F6E A;  4YIO A;  1EM1 A;  1AR5 A;  3AK3 A;  3MDS A;  1LUW A;  4YIP A;  2QKA A;  1GN3 A;  1N0J A;  3OT7 A;  1MMM A;  1D5N A;  1N0N A;  4FFK A;  1I08 A;  3K9S A;  1AP6 A;  2ADQ B;  1GN4 A;  4BR6 A;  1WB8 A;  3EVK A;  1IXB A;  3AK2 A;  3C3S A;  4JZG A;  1IX9 A;  1BS3 A;  4X9Q A;  3RN4 A;  3DC6 A;  1VEW A;  1I0H A;  1JA8 A;  2ADP A;  1EN4 A;  1ZTE A;  1XIL A;  3C3T A;  1WB7 A;  1AR4 A;  1PM9 A;  2GDS A;  3DC5 A;  1VAR A;  3QVN A;  3CEI A;  4GUN A;  5AG2 A;  2P4K A;  4JYY A;  1MSD A;  1EN6 A;  1B06 A;  1GN2 A;  1QNM A;  3LSU A;  1XRE A;  2QKC A;  1XUQ A;  1EN5 A;  2CDY A;  1XDC A;  1ZSP A;  1LUV A;  2RCV A;  1BT8 A;  1ZLZ A;  1MA1 A;  4E4E A;  1PL4 A;  3IC9 A;  1KKC A;  1GN6 A;  2CE4 A;  1P7G A;  1ZUQ A;  1MNG A;  1AP5 A;  2AW9 A;  1SZX A;  1AVM A; 
#chains in the Genus database with same CATH topology
 4YJ3 B;  1Y76 B;  3O9O A;  2JIZ G;  3JD0 A;  5B1O A;  5KLV H;  2X7R B;  1XMQ O;  2ATK C;  2UUC B;  4IGG A;  2VWJ A;  3LUT B;  2E5L B;  2X6B A;  2XAF A;  3SYA A;  1CEZ A;  1M90 W;  1URF A;  2VRZ A;  2UUC O;  4DV2 B;  4O4J B;  3AG4 B;  3R65 A;  4X1I A;  5IJ9 B;  4LP8 A;  2A7W A;  5CBG A;  4NYK A;  4U7O A;  3I5D A;  2ADQ B;  2F43 G;  2AZ0 A;  5HFL A;  2Q68 A;  3N2K B;  3QTC A;  5JH7 B;  2EIL B;  2QSA A;  2FL4 A;  1HNZ O;  3OD4 A;  4AHC A;  3OTF A;  2BSK B;  2B9Z A;  5JWP A;  3ZN0 A;  1XIL A;  1AI6 A;  4K0K O;  1SC5 B;  1WP8 A;  1A32 A;  1SET A;  4O2A B;  3CCR V;  1BQZ A;  2YXH A;  1K3E A;  4JAU A;  3ZRS A;  1DTO A;  3CCM V;  5LMN O;  1IBM O;  5LP6 A;  4JI7 O;  2BOC C;  1F51 A;  3OGI B;  4U3J A;  5IYZ B;  2W0F C;  2RCV A;  1P4R A;  1H2M A;  1QR9 A;  3IC9 A;  5E79 Z;  4Z1V A;  3BEH A;  3P3N A;  3HB3 B;  2P6J A;  1AVM A;  3KKY A;  4Q6G A;  1MZF A;  3SPC A;  3FAV B;  2CGO A;  3MHS C;  3SPI A;  2F4V B;  3F5W C;  1Y67 A;  3BA9 A;  2BOB C;  4ABM A;  4O2B B;  1Y74 A;  1HDJ A;  5LGN A;  3ABT A;  1JVM A;  1SQG A;  2JDI G;  4IHJ A;  2ZNI A;  4PV1 B;  4UVB A;  2RQ6 A;  3BY6 A;  3LDE A;  2V4D A;  3OEE G;  5J2T B;  1KD1 W;  5FPO A;  3JSN A;  1IXB A;  1R6K A;  1I7F A;  4XDL A;  3ZMZ A;  1HNX O;  4I55 A;  2KG7 B;  1KMI Z;  4DRX A;  1K9M W;  2IU0 A;  4QNH B;  2W0X A;  5IWA B;  4FM1 A;  4JI4 O;  5CBH A;  3K5M A;  3KZI Z;  3F5T A;  4X64 O;  4FM0 A;  2B5U A;  4JI5 O;  1Q90 D;  1PKX A;  4ICG A;  1RP3 B;  1JFF A;  4JTA B;  1SQB H;  4R7C A;  3N27 A;  1M4U A;  4G2K A;  5LOV A;  1KB9 F;  3T1C A;  3OGC C;  2WA3 A;  1U96 A;  5H6R A;  3B8M A;  2Q0O C;  4J9Z B;  2QJ1 A;  3WG7 B;  5LL6 Y;  1VQ5 V;  2KSD A;  1NU1 H;  2W6J G;  3CXH F;  2A9H A;  3MD0 A;  1K92 A;  2QKC A;  1XUQ A;  4BAY A;  2WLM A;  5EZY A;  2UUA B;  3ZHT A;  3K5N A;  5L3G A;  5IJ0 A;  4LF8 B;  1HWY A;  2WLL B;  4CH5 A;  1QVF U;  2PZS A;  1P7G A;  4JI2 B;  1AP5 A;  4X65 O;  2AW9 A;  1SZT A;  3HPL C;  1L1F A;  5IYB O;  4L8J A;  1K5Q A;  3E86 A;  3FKS G;  3B4S A;  2EIM C;  4WFE A;  1SQX H;  3ICX A;  1OCZ B;  1R3K C;  1SER A;  1FOU A;  4I4T A;  1VF6 A;  3JAR A;  2UUA O;  1RM1 C;  2JEU A;  2Q7E A;  2CGN A;  3CB2 A;  4JI5 B;  2L35 A;  3ZCC A;  1Q3E A;  3K9S A;  1YTF B;  5B5E Z;  1EFR G;  4FJC C;  1GM7 A;  3DXR A;  2Q9L A;  4E2L A;  3ABL C;  1Z5W A;  2ZXW B;  3CRR A;  1YF2 A;  4H37 A;  3A0B Z;  3G6E V;  2ZXW C;  4LC1 A;  1AJP A;  4JI1 B;  2HP8 A;  3JAK B;  3TGU H;  4JI6 O;  5L3F A;  1QR8 A;  4J9Y B;  3G6B A;  4HNA B;  4LH7 A;  3U10 A;  4LCU C;  1XNR O;  1EN4 A;  4JF3 A;  1IBL O;  1BHA A;  1WB7 A;  2QDO A;  1NJI W;  4Q20 A;  4QJF B;  4DV1 O;  4MVQ A;  2HEP A;  1OCZ C;  3D36 C;  4AIL C;  4KXR A;  4ZI7 A;  1YI2 V;  2F4V O;  3ASN B;  3TET A;  4YJ2 A;  3HKC B;  2QKS A;  4DV4 B;  3LDD A;  2ZKO A;  1VF7 A;  1JX9 A;  2ITD C;  3CRC A;  3OMI B;  3UKM A;  1NR1 A;  4BWA A;  2ODM A;  2EJ7 A;  2A06 H;  1YJ9 V;  4GKK B;  3RVY A;  2XOK G;  2GV9 A;  2CE4 A;  4AQY O;  5A2Q N;  2YS8 A;  3G67 A;  4JAA A;  1EBO A;  1SQV H;  3AK1 A;  4QPK A;  1XHX A;  4WFB V;  3GWO A;  4D7T A;  1M9N A;  1IDS A;  5JJJ B;  4GYC B;  1J5E O;  2WLN A;  2VWK A;  2WLL A;  4EFE A;  2P06 A;  2PTM A;  5B1A B;  2HJD A;  4JI3 O;  3B8N A;  1M1K W;  4OX9 B;  1N34 B;  1PV0 A;  2ZDI A;  2DOS A;  3J80 N;  3UCS C;  2OCC B;  2PI4 A;  4PI2 A;  5KAI Z;  4PA3 A;  1NH2 B;  3K9A A;  4WFA V;  2LGW A;  4B3M B;  2MK3 A;  3ZRW A;  1QCE A;  3CWB H;  1HR0 O;  2QWR B;  1I0H A;  3JAW A;  2V1D A;  5IWA O;  4GKJ B;  4I50 A;  4DV6 B;  1K7D A;  2FKX A;  4DW0 A;  1ARO P;  1PM9 A;  2GDS A;  1W2B U;  2K9P A;  3QVN A;  3S3W A;  2DN9 A;  2P4K A;  4DV2 O;  1FAF A;  2ZCE A;  3AG7 A;  4PD4 F;  1D2D A;  3QF7 A;  4JI6 B;  2QE7 G;  1SKV A;  5KHI A;  2UXX A;  1WN7 A;  2EIK B;  1Y4M A;  1NTZ H;  1R1B A;  3HKB A;  1EN5 A;  5CB4 B;  2BCC H;  1VIB A;  3CX5 F;  3G4S V;  1GRJ A;  3AEI A;  4DUZ O;  1ZLZ A;  3RYI A;  4X8A A;  1VF6 C;  1SS3 A;  4UCO A;  1G6U A;  2A79 B;  4N23 A;  2P7T C;  4H44 B;  4B3S O;  3RYF B;  4DK1 A;  3A8T A;  4X66 B;  3JAK A;  3L74 H;  1TA8 A;  1B3Q A;  4JYB A;  2QGN A;  3B09 A;  1NH2 D;  2PUS A;  2X6C A;  4J7Z A;  1NZ6 A;  2W6I G;  2QKA A;  3TXQ A;  3NR7 A;  2YIB A;  1VQK V;  1N0N A;  3T1Y O;  1KBH A;  1AP6 A;  3UT5 A;  4UCU A;  4YY3 O;  1VQ9 V;  2BE3 A;  4UCR A;  4XDJ A;  5EBM C;  5FL7 G;  1TGO A;  1N34 O;  1W0K G;  2EIL C;  2ZR2 A;  1FPO A;  2OCC C;  1R3J C;  3GB7 C;  2ARH A;  3JD3 A;  4N21 A;  3ETQ A;  5D5Q A;  5J9P C;  3ETE A;  2NLJ C;  4PDL A;  3EXA A;  4UB6 Z;  3RYH A;  2K1E A;  1NVP D;  1H38 A;  1JMK C;  3OFN G;  3T1Y B;  3VOU A;  2IU3 A;  5CN0 A;  3DC5 A;  1BE3 H;  1VAR A;  3RYC A;  3ETG A;  1RM1 B;  2H3O A;  2UXB B;  4GUN A;  1PNK A;  4CS4 A;  4JYA B;  4B3R B;  1KYO F;  3JAS B;  4JYY A;  2IH3 C;  1VQ6 V;  2ZE8 A;  4LF4 O;  2KB1 A;  4PA4 A;  2WSS G;  1P49 A;  4YJ2 B;  4DUY B;  4W4L A;  1KP2 A;  4UXN A;  3ZJZ A;  2HG5 C;  1Q7Y W;  4LFC B;  3OR7 C;  3O65 A;  1N33 B;  2PGG A;  4X1Y A;  2UXD O;  1KEC A;  2XHB A;  4J42 A;  4O4J A;  3RT3 C;  3F7Y C;  2MW2 B;  3QO5 A;  3MAQ A;  5H2F Z;  2BTO A;  4LBE C;  3J7A U;  4TSF G;  4WCE V;  3K0D A;  4JPR A;  1S72 V;  2CTP A;  2Y0P A;  3H1H H;  4J80 A;  2F93 B;  2IJK A;  4QPJ A;  1YXB A;  3MHH C;  4ZBM A;  2HLD G;  4F6E A;  3E89 A;  5TIS Z;  3BAA A;  3VQY A;  5DEC A;  4RUF A;  1VQ4 V;  1ZAU A;  4L87 A;  1SF9 A;  1XMO O;  1FFX B;  2WLH A;  5BR8 B;  2IBZ H;  3HKE B;  4QE7 A;  1I08 A;  2LQT A;  3CP1 A;  3FB8 C;  3L72 H;  5C93 A;  1BHB A;  5DED A;  4MVU A;  1AIL A;  1UFI A;  5LYJ B;  4DV7 B;  3D3I A;  3A0H Z;  3K04 A;  1YJN V;  1FFT B;  1JQ0 A;  4YHH O;  1S5H C;  1GTO A;  4JZG A;  4A5U B;  5CA1 A;  4HBN A;  4WBN B;  1F4M A;  1S5L Z;  2H94 A;  3CRQ A;  4LF6 O;  4FLZ A;  2E74 B;  4IYH A;  5C8Y A;  5IY5 C;  3E22 A;  4X9Q A;  3DGE A;  3RN4 A;  3ZN1 A;  5B3S B;  1MSW D;  3SYP A;  2R9R B;  3KG2 A;  2R72 A;  1H8H G;  2P90 A;  4RUE A;  4DR1 B;  4KHP B;  1JNB A;  1XQ8 A;  4TV8 B;  2GUZ B;  1PPJ H;  4I5S A;  1AI4 A;  2EJR A;  4D7S A;  4DR5 B;  3SYO A;  3H1K H;  3OR6 C;  5EZY B;  2E3C A;  3L73 H;  4LF9 B;  3KDR A;  1GO3 F;  1FYJ A;  3CJH A;  1E1Q G;  3BRC A;  1R6T A;  2FB5 A;  4H33 A;  4NTW A;  4WFG A;  3CSX A;  3ZHS A;  3CRM A;  4YY3 B;  5IYD O;  1V55 B;  2NN4 A;  4FIP C;  2A3Q A;  4PA6 A;  1COW G;  4MS2 A;  1KQS U;  4X66 O;  2R9I A;  3JYC A;  3JAT A;  1IBL B;  3JCZ A;  3BHP A;  1QBZ A;  2VQF B;  3UM7 A;  2B1I A;  4MW3 A;  2BSK A;  3FB5 C;  1BSM A;  4EKW A;  2AZ2 A;  2BTQ B;  2QWQ B;  4KUM A;  1SQF A;  2CTR A;  2DWE C;  4MSW C;  5IDJ A;  3BAB A;  3AG2 C;  2IJJ A;  3AK3 A;  3MDS A;  3P32 A;  5BMV A;  3H9V A;  5LA6 A;  4OPA A;  1K4D C;  5L3E A;  1NTM H;  3APQ A;  4DUY O;  1OCO C;  3M8A A;  2EIN C;  3CCJ V;  2DQ0 A;  1S0V A;  4GX0 A;  4ZHQ A;  5LBQ A;  1Y74 B;  5C8Y B;  2R9A A;  1K5S A;  3JAM N;  2E5L O;  4CS3 A;  4MTG A;  5EYP A;  2M7W A;  2FML A;  1OCC B;  1QLE C;  3AG3 B;  3CS5 A;  2DMX A;  3ASO C;  1CXZ B;  2HHH B;  2VQE O;  1VF5 B;  5JJN B;  4RO2 A;  5EIB C;  2AXT Z;  3ZIA G;  1Z5V A;  1VQP V;  1K73 W;  4DV5 B;  4UCT A;  4DR3 O;  2UXC B;  4JI2 O;  5LGT A;  5IY5 B;  3ZX6 A;  3UQ8 A;  3JAL A;  4UV8 A;  1I5X A;  3HKB B;  3LSU A;  1FD9 A;  3HKC A;  5J2U A;  1ZL8 B;  1PNM A;  4F6R A;  5KUK A;  4ZOL A;  1IZ3 A;  1F7Y A;  1NI8 A;  3JD2 A;  1FJG O;  1S5J A;  2GTS A;  1OCR C;  2VS0 A;  1JJ2 U;  3T4Z A;  4P9P A;  1DK1 A;  1PL4 A;  3WFV A;  2YEV B;  4ZHQ B;  1YJW V;  2DYS B;  4I50 B;  2AHZ A;  4I0X A;  2XAH A;  1GM8 A;  1MG1 A;  3FAV A;  3STZ C;  1YTF D;  1AJQ A;  3M99 B;  1N32 O;  5EC1 C;  2EUL A;  2ZIO A;  4I7Z B;  1J95 A;  4X1K B;  2CH7 A;  1FJG B;  5KA6 A;  3E83 A;  3TXS A;  2WLK A;  1AR5 A;  2HJF C;  1Q81 W;  5IYZ A;  4KFM A;  3CCV V;  4JI8 B;  4LWS A;  1Y66 A;  2ETN A;  4HYO A;  4UVC A;  3IAY A;  2DWD C;  1VQO V;  3JSL A;  2Y48 A;  3QG5 A;  4OXS A;  3RYH B;  4NXN O;  4TOI A;  3K5O A;  1XMO B;  5H5N A;  3JAW B;  5GTI Z;  2JJ1 G;  4NXM O;  4LF5 B;  3AK2 A;  1O9G A;  1GAX A;  3LNN A;  3TK1 A;  2UU9 B;  3FX7 A;  3B77 A;  4PEL A;  4PJ0 Z;  2RMK B;  1M56 C;  5GON B;  5J2U B;  3RBZ A;  4MTX A;  2IH1 C;  2UXD B;  3BPZ A;  1AR4 A;  4B3T O;  3ABU A;  4NXN B;  3AG4 C;  2WLI B;  3OMA B;  2M6Y A;  1PP9 H;  5LA6 B;  1HNW O;  4GX1 A;  3ZMS A;  1R3L C;  2RDC A;  3SJQ C;  1T5E A;  4X89 A;  1QNM A;  4GZR B;  4LFC O;  4QIW F;  3FD9 A;  2Q4P A;  2WWW A;  2JS3 A;  4B3R O;  4DK0 A;  4OX9 O;  3AG1 B;  4DR4 B;  2ZE6 A;  1FXH A;  1VQL V;  2HVJ C;  1S76 D;  2JGD B;  1R6N A;  2B1G A;  2JS5 A;  3S3X A;  4K8X A;  4CBC A;  2FYU H;  2D2C B;  4LF7 O;  1N36 O;  5CB4 A;  4R8C A;  3SDL A;  3OE7 G;  5D5P A;  1WPX A;  4JTC B;  2JVD A;  2Q6A A;  4B08 A;  5CA0 A;  1SA0 B;  3ML0 A;  4JI7 B;  1OJH A;  1HW7 A;  1CP9 A;  4TT3 G;  1R73 A;  2YI8 A;  2D3O W;  4YIO A;  1EM1 A;  4O4I A;  3JAL B;  2OIE A;  1I94 O;  3ZHQ A;  5LP6 C;  4K0K B;  5K1X A;  4EB6 B;  3K03 A;  2CK3 G;  4FZ0 A;  2UXN A;  3W7W A;  3JAR B;  3N2K A;  3C90 A;  2HHH O;  4CH4 A;  3A0R A;  1SES A;  4X20 B;  3SJA C;  1NKD A;  5CA1 B;  1WJZ A;  1Q8I A;  4LF6 B;  3A2F A;  2F95 B;  3THO A;  1IXM A;  1ZTE A;  2N04 A;  1B6Q A;  3K08 A;  4JAS A;  5B1B C;  3WB0 A;  4DUZ B;  4F4L A;  4FM2 A;  1NQT A;  1JJO A;  4DR2 O;  1YDX A;  2KKW A;  2YXY A;  4ZOL B;  4OGQ B;  1D5A A;  5JVD A;  2LW7 A;  2XND G;  1WNS A;  1GMG A;  4DV0 O;  3R66 A;  4LNU B;  2IM9 A;  2LGQ A;  3AG1 C;  1XDC A;  1ZSP A;  2WLI A;  1FXK C;  4XBF A;  5KX5 A;  2Y4U A;  4WBN A;  1HNX B;  1GN6 A;  1IBK O;  4B7E A;  5CMU A;  1ZUQ A;  2P22 C;  3OUS A;  3E8H A;  1XBL A;  5LXT B;  4BW5 A;  2NNU A;  4LR3 A;  2Q5Z A;  4EB6 A;  2DW4 A;  1BL8 A;  1FFX A;  1NT2 B;  1W0J G;  4X65 B;  2GBO A;  4U3F H;  5EC2 C;  3BFR A;  1I94 B;  2ZIN A;  2Q73 A;  5KHG A;  4XDK A;  4FVM A;  1PL0 A;  1ROP A;  3W7U A;  4UUJ C;  4DYL A;  3SPG A;  1D5N A;  4X88 A;  4R50 A;  5LHH A;  1XEQ A;  3ZRX A;  1QHT A;  4OPH A;  5JCO A;  3FYE B;  5IJ9 A;  2DYR B;  5FNV A;  3UO3 A;  2LFR A;  5IYC O;  1JCH A;  4LF8 O;  4NB5 A;  2ZD9 A;  2XAS A;  3ZHU A;  3J81 N;  1IX9 A;  1H5W A;  4FFB A;  4DRX B;  4X1Y B;  4WF9 V;  2DJV A;  4CH3 A;  4AQY B;  1Q5O A;  2OWO A;  1H8E G;  3H1L H;  1G8M A;  4DR7 B;  3CPW U;  1YZB A;  3E8F A;  3D3Q A;  4IHJ B;  5KHK A;  5KMG B;  3JAS A;  4MVO A;  4PDV A;  1MZE A;  2NR5 A;  1N36 B;  2P4V A;  1DLB A;  4X62 B;  1EN6 A;  4MW8 A;  1BGY H;  2KG7 A;  2EIN B;  2Q7H A;  2DYR C;  4LFA O;  3E8B A;  3CMA V;  1GKF A;  1XRE A;  3ABL B;  4O4H A;  1L8D A;  4X64 B;  3K3W A;  1IUR A;  2PF4 E;  2CTW A;  1QQC A;  3OTO B;  3CC7 V;  4E4E A;  3L70 H;  4DO2 A;  5K1P A;  3RYI B;  1YHQ V;  4UFZ A;  2EX3 A;  2QTS A;  4X62 O;  4JAV A;  3LNM B;  1B04 A;  1KP3 A;  1SRY A;  1WPB A;  2YC0 A;  1Q6I A;  4J7K A;  4LFA B;  5LP6 B;  4AI8 A;  4JZ2 A;  3RYF A;  2WLJ A;  4DV0 B;  3TJT A;  3ZHV A;  3CE2 A;  3QNE A;  1M57 C;  3AG3 C;  4P30 A;  2P5O A;  2XTA A;  1YVW A;  1MMM A;  2XT9 A;  2YIB D;  4NTX A;  3SPJ A;  3E2E A;  2Y0I A;  3ZED A;  4DR2 B;  4R6Z A;  3GWK C;  1M93 A;  4TQD A;  2V7Q G;  3I55 V;  2HKO A;  2YEV A;  3CRA A;  1H2L A;  3ABK B;  2L6L A;  1BQ0 A;  3ETD A;  2ZE7 A;  3WG7 C;  3SGI A;  1OZ0 A;  4X20 A;  4NVP A;  1VEW A;  4GX2 A;  1JA8 A;  1VQ8 V;  5B1B B;  4O4L A;  1N32 B;  4O4L B;  4JYA O;  2X6A A;  2ZQM A;  1P7B A;  1H2K A;  2KQX A;  2DYS C;  1HP8 A;  3JD4 A;  1BMF G;  2XAJ A;  1KUQ A;  1HNZ B;  4TV8 A;  1K4C C;  4UCV A;  3ZRW B;  4JI3 B;  1DGS A;  4G28 B;  4DXW A;  2ZIM A;  1YIT V;  1S77 D;  3U11 A;  1K34 A;  5IE9 A;  4FPP A;  3WB2 A;  1X4T A;  4LH6 A;  4TUY B;  3E8G A;  3OAA G;  2O57 A;  4DV3 O;  2ZT9 B;  2ILM A;  3JD1 A;  3CCE V;  2OTL V;  3ZMT A;  1G4Y B;  3IGA C;  2G38 A;  5BR8 O;  3U0Z A;  2YIA A;  5L3B A;  4I9W A;  3OW2 U;  5LHG A;  1IVS A;  4P2Z A;  4MTO A;  5DM6 V;  4GKK O;  5LMU B;  1K97 A;  3HKE A;  4HZ3 A;  1N4C A;  4JI0 B;  5BMV B;  2XAG A;  3PJS K;  3APO A;  3IC7 A;  5KHJ A;  4RWU A;  3B40 A;  4B3S B;  2VQE B;  2OIG A;  1G1X B;  4FLY A;  1DF5 A;  1BCC H;  4UCS A;  1H2N A;  3JAT B;  1AI7 A;  5KAF Z;  4YXW G;  5E1A C;  1GN4 A;  3CCU V;  1SA0 A;  3C3S A;  4JYC A;  1NTK H;  4CC6 A;  2PYL A;  5H9C A;  2EZO A;  5KUM A;  4BIU A;  4DR6 O;  3OUF A;  3ZRV A;  1GM9 A;  3SYC A;  5EIB D;  5FPR A;  4JI1 O;  3RWR D;  4KP4 A;  5BY1 A;  4FLT A;  2ZM6 O;  1E79 G;  3PN1 A;  2CUG A;  4ZI7 B;  1RFY A;  4FLX A;  2Q7G A;  2YIC A;  5LMN B;  2WA4 A;  4MT8 A;  1ZL8 A;  3FB7 C;  4RQF A;  1H2G A;  3HKD B;  1NR7 A;  3RGB A;  2H8P C;  4IL6 Z;  4BIZ A;  1NVP B;  2GTA A;  4HNA A;  1N8R W;  4PHZ A;  3VQX A;  2HVK C;  1K8A W;  1TUB A;  3ASN C;  3ASO B;  2JEX A;  4YJ3 A;  2F66 C;  2Q8V A;  2Z0A A;  4IIJ A;  3OMN B;  1QLE B;  1YCI A;  3RVZ A;  2ZM6 B;  4K3A A;  1Z2G A;  1FS0 G;  4EEQ A;  2Q0A A;  1WP7 A;  4TQF A;  2XUM A;  5ITZ B;  3VBB A;  2QM4 A;  5ITZ A;  1PD3 A;  4UVA A;  3GVM A;  5F2V O;  1LR1 A;  4DV4 O;  4DR1 O;  4KHP O;  3QO8 A;  4O4H B;  3AG2 B;  3BCC H;  4IT5 A;  4D6T H;  2CAZ C;  1HNW B;  1M5I A;  3VQW A;  1W59 A;  3D36 A;  2OCH A;  4FLV A;  4DV7 O;  3K79 A;  3CXC U;  1AI5 A;  3ZMU A;  4J10 A;  1AR1 B;  4ZKI A;  1ZX3 A;  2DQ3 A;  4MVR A;  1X59 A;  4JV5 O;  3CYO A;  4JTD B;  2EZP A;  4KL1 A;  4X1K A;  2QM7 A;  4BIO A;  4DW1 A;  5IJ0 B;  3HR0 A;  3H1J H;  3ABK C;  3LSS A;  4NXM B;  1ZWI C;  1BS3 A;  3Q4H A;  1XNQ B;  4X1I B;  2N05 A;  1N33 O;  3IFX A;  5LOV B;  5FNV B;  3OTO O;  1TUE B;  4NKG B;  1JFF B;  3CEI A;  4LF4 B;  1OCC C;  1EZJ A;  1GH6 A;  4TWK A;  3ZHR A;  4HAM A;  1RSO B;  2X0L A;  3OEH G;  1MSD A;  4I4T B;  1XOU A;  1MOF A;  2VQF O;  4MVM A;  2QTO A;  4WFF A;  4I9Q A;  1BZK A;  5J2T A;  2C2A A;  5CA0 B;  4DV6 O;  1RSO A;  2EIK C;  3N2G A;  4PA7 A;  5B1A C;  5JQG A;  4I55 B;  3OM3 B;  3RW0 A;  2UXB O;  1WA8 B;  4FK5 C;  2AHY A;  1QVG U;  2UUB B;  2RJZ A;  4U7N A;  1SZX A;  1F23 A;  3EFF K;  4CS2 A;  1WLE A;  2E75 B;  3I56 V;  3T4D A;  4DV5 O;  2PY5 A;  3SPH A;  4FFB B;  5A9G A;  3B2E E;  1ENV A;  2QA4 V;  2EIJ C;  5LGU A;  4LF9 O;  3T1H O;  4MVS A;  3K0G A;  1FXV A;  3OT7 A;  4O2A A;  2QR4 A;  3Q4H B;  1M56 B;  2YDE A;  5HFM A;  1WA8 A;  4F6R B;  1O9H A;  4DR4 O;  2YI9 A;  5GW7 A;  5GTH Z;  4DR6 B;  3N2G B;  3CD6 V;  4LFB B;  1S3J A;  2HR3 A;  4JGS A;  3M7M X;  3TCU A;  2R70 A;  4YHH B;  1SQQ H;  1OCO B;  3QO7 A;  2OYQ A;  2PYJ A;  2UU9 O;  5LMU O;  4QE9 A;  4CC5 A;  1WAZ A;  2AGA A;  5KMG A;  2WAM A;  3K57 A;  1Q86 W;  5JQG B;  3IJ4 A;  5AG2 A;  5KX5 B;  2CTQ A;  4J41 A;  3W7T A;  2JRI A;  1VP7 A;  3ZMV A;  3L9D A;  4Z1M G;  1K33 A;  1XI1 A;  4O2B A;  1B06 A;  4UB8 Z;  4JI8 O;  4DV3 B;  2YUA A;  4P9O A;  2XAQ A;  4G27 B;  5EBW C;  5JH7 A;  4B7K A;  1L0N H;  4IIJ B;  1Y76 A;  4LF5 O;  1LUV A;  3RYC B;  1GK9 A;  4LFB O;  4MTF A;  3T1H B;  1JOY A;  1MA1 A;  1XMQ B;  2OTJ V;  1FXK B;  1KKC A;  1QLN A;  3G71 V;  2LW1 A;  1MNG A;  4TV9 B;  4RQE A;  2OT5 A;  3E22 B;  3DXR B;  5IT9 N;  1KU9 A;  2EIM B;  2HFE C;  2LP7 A;  1VQM V;  4GKJ O;  2GHY A;  2ZE5 A;  1Q6H A;  4IYI A;  1YSC A;  4PDM A;  5LHI A;  1IBM B;  2Q69 A;  1US6 A;  4B3M O;  4DR5 O;  2EBO A;  2RN9 A;  3WU2 Z;  4GCZ A;  4J7J A;  1LUW A;  5KHH A;  5JCO C;  3SJB C;  4GT1 A;  1PNL A;  5LXT A;  3BVO A;  2Z5U A;  2UUB O;  3EHB B;  5B66 Z;  5BXZ A;  1F4N A;  1TVK B;  2F23 A;  3D8C A;  1XL4 A;  4Z2W A;  4DR3 B;  2UXC O;  3K58 A;  1YIJ V;  4GLX A;  3JCU Z;  2JK5 C;  3P3P A;  1J5E B;  2LFS A;  1CPY A;  3CC2 V;  4CH6 A;  3HKD A;  1KC8 W;  3DC6 A;  4K8Z A;  3SJC C;  1XHZ A;  5JVD B;  2QWP B;  3UO2 A;  4WFH A;  4UV9 A;  1UPG A;  4H13 B;  3CCL V;  2YID A;  1DF4 A;  1THZ A;  2Y69 C;  3UT5 B;  3WB1 A;  2FTK A;  4QGP A;  1VMG A;  4ZIB A;  3CCQ V;  2LJ2 A;  3K5L A;  4TV9 A;  4CZZ A;  1GN2 A;  5CBF A;  1IJG A;  3K59 A;  4JI4 B;  2QWN B;  5LYJ A;  4LNU A;  1ORQ C;  4ASU G;  2PI5 A;  3FFQ A;  1XNQ O;  1AB3 A;  1TAE A;  4EFB A;  2CDY A;  1MAB G;  2JJ2 G;  4TUY A;  2WPD G;  1QU7 A;  1BT8 A;  3KCX A;  1H2S B;  2QWO B;  4B3T B;  4RAI A;  1V55 C;  3E35 A;  2LO1 A;  4DV1 B;  2YXL A;  3VQV A;  2ZDI C;  3SYQ A;  5EK0 A;  2EIJ B;  4JV5 B;  3P30 A;  4NTY A;  2QM8 A;  4JI0 O;  4K35 A;  2Q67 A;  3L71 H;  4FMT A;  3ZBH A;  3G80 A;  2N74 A;  2GSM B;  1TUB B;  1XNR B;  5B1N A;  1R3I C;  1XL6 A;  4O4I B;  4PDR A;  5FLX N;  3ZS8 C;  4NR1 A;  4C7U A;  1M57 B;  3F7V C;  1JR9 A;  3H01 A;  3LDC A;  3LSQ A;  2JGD A;  2F1M A;  4YIP A;  3CC4 V;  2ZR3 A;  3CJH B;  1GN3 A;  1N0J A;  3STL C;  1YEW A;  1P84 F;  5B3S C;  4DR7 O;  1Q43 A;  4FFK A;  1VQ7 V;  3X2Q C;  2IW5 A;  3T2M A;  1UJW B;  3L75 H;  3W7X A;  1LNQ A;  3K06 A;  4W4K A;  1E1R G;  3X2Q B;  4BR6 A;  1WB8 A;  2Y4T A;  3EVK A;  4H0L B;  2Z3Y A;  5L3C A;  1NBM G;  1HR0 B;  4FLW A;  1V54 B;  2IJI A;  1RPO A;  3W7S A;  5L3D A;  1OHH G;  2YSU B;  3KCY A;  2CH7 B;  1OV9 A;  2P67 A;  4FLU A;  4U3J B;  2GUZ A;  4LF7 B;  2JGU A;  5JJE B;  5EYP B;  1I5Y A;  5CA3 A;  2ADP A;  1EZV H;  3RFR A;  2IJH A;  1AJN A;  1Q6U A;  3ABM C;  3C3T A;  1SQP H;  3H1I H;  4I0X B;  4BW9 A;  5KA5 A;  3ABM B;  1Q82 W;  1FKA O;  2E76 B;  3DTU B;  4PA9 A;  3CCS V;  5DN6 G;  1NS1 A;  1JPX A;  2RNB A;  1Y6X A;  2A0L A;  4FZ1 A;  1IBK B;  3BA8 A;  4GX5 A;  5EBL C;  5GON A;  1V54 C;  1V9P A;  3SR2 C;  2ZNJ A;  2BTQ A;  1VQN V;  3CME V;  1TVK A;  5H6Q A;  4MVZ A;  4PI0 A;  5BZB A;  4J11 A;  3FB6 C;  2ITC C;  2DE0 X;  1FXK A;  1U97 A;  1OCR B;  1L0L H;  3CHX A;  2Y69 B;  2QEX V;  3NXS A;  4LWS B;  3FYI B;  1RPR A;  3DSQ A;  1KKD A; 
#chains in the Genus database with same CATH homology
 3KKY A;  3AK1 A;  4JZ2 A;  1Y67 A;  4C7U A;  1BSM A;  3TJT A;  3BFR A;  5A9G A;  1IDS A;  1JR9 A;  4F6E A;  4YIO A;  1EM1 A;  1AR5 A;  3AK3 A;  3MDS A;  1LUW A;  4YIP A;  2QKA A;  1GN3 A;  1N0J A;  3OT7 A;  1MMM A;  1D5N A;  1N0N A;  4FFK A;  1I08 A;  3K9S A;  1AP6 A;  2ADQ B;  1GN4 A;  4BR6 A;  1WB8 A;  3EVK A;  1IXB A;  3AK2 A;  3C3S A;  4JZG A;  1IX9 A;  1BS3 A;  4X9Q A;  3RN4 A;  3DC6 A;  1VEW A;  1I0H A;  1JA8 A;  2ADP A;  1EN4 A;  1ZTE A;  1XIL A;  3C3T A;  1WB7 A;  1AR4 A;  1PM9 A;  2GDS A;  3DC5 A;  1VAR A;  3QVN A;  3CEI A;  4GUN A;  5AG2 A;  2P4K A;  4JYY A;  3KDR A;  1MSD A;  1EN6 A;  1B06 A;  1GN2 A;  1QNM A;  3LSU A;  1XRE A;  2QKC A;  1XUQ A;  1EN5 A;  2CDY A;  1XDC A;  1ZSP A;  1LUV A;  2RCV A;  1BT8 A;  1ZLZ A;  1MA1 A;  4E4E A;  1PL4 A;  3IC9 A;  1KKC A;  1GN6 A;  2CE4 A;  1P7G A;  1ZUQ A;  1MNG A;  1AP5 A;  2AW9 A;  1SZX A;  1AVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...