1AP5A

Tyr34->phe mutant of human mitochondrial manganese superoxide dismutase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal structure of Y34F mutant human mitochondrial manganese superoxide dismutase and the functional role of tyrosine 34.
pubmed doi rcsb
total genus 66
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ap5A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ap5A02
1BS3A 1MMMA 1WB7A 3KKYA 3BFRA 1MSDA 2CE4A 1AR4A 2QKCA 1GN6A 1PM9A 3RN4A 1JA8A 1IXBA 1VEWA 4YIPA 5AG2A 1ZLZA 2ADPA 1Y67A 4FFKA 1EM1A 1EN5A 1D5NA 4X9QA 1GN3A 3MDSA 1BSMA 1GN2A 2CDYA 1MNGA 5A9GA 1N0NA 1VARA 3C3SA 1AP5A 1IDSA 1BT8A 1JR9A 1LUVA 3QVNA 1IX9A 1KKCA 1ZSPA 1PL4A 1AVMA 1XUQA 3TJTA 3AK1A 2ADQB 3OT7A 1XILA 4BR6A 1AR5A 1WB8A 4JZGA 1I0HA 3AK2A 4C7UA 1MA1A 1ZUQA 3C3TA 3EVKA 3CEIA 1XREA 3IC9A 1LUWA 2P4KA 1XDCA 1I08A 1AP6A 1EN6A 1GN4A 4E4EA 1N0JA 1B06A 3AK3A 3DC5A 3DC6A 1ZTEA 4YIOA 2RCVA 4F6EA 4JYYA 4GUNA 3K9SA 3LSUA 2GDSA 2AW9A 2QKAA 1QNMA 1SZXA 1P7GA 1EN4A 4JZ2A
chains in the Genus database with same CATH superfamily
4H13B 3E89A 4MTXA 1QLEB 2HR3A 5B5EZ 3FD9A 1B3QA 1SRYA 1O9HA 2Q5ZA 1J5EB 3ZMZA 3RYFB 3OR6C 4ZOLA 4DYLA 1Z5VA 3ICXA 4OGQB 3DSQA 2LO1A 3BA8A 3OR7C 3OM3B 1EM1A 4B3MB 5LP6B 4DV2B 3T2MA 2XTAA 4JTDB 1GO3F 4B3RB 3LSQA 3JD3A 1Q3EA 4CH5A 4DR6O 2JEXA 1M90W 1NR7A 4DR5B 1JR9A 1S72V 3CCMV 3BEHA 3F5WC 4OX9B 4GKJO 4JGSA 5C93A 4YHHB 1W2BU 4QE9A 4CS2A 1PL4A 3X2QB 2UUAO 4CBCA 2KSDA 4GZRB 4X8AA 3KG2A 2ADQB 5H6RA 3B2EE 4Z2WA 4DV2O 1FAFA 4X1IB 1K33A 2FB5A 1GRJA 3ZRVA 4LFAB 4PDRA 1WAZA 2WWWA 1NKDA 4JAUA 1J95A 3CXCU 4FLXA 3JCUZ 3R66A 3ZHRA 4JI4O 5L3BA 3T1YB 3SJQC 3ABKB 5FL7G 3CCRV 1Q5OA 2A0LA 4DV7O 5FPOA 1NU1H 4YY3O 3CE2A 2Q0AA 1KB9F 1FKAO 2PI5A 4P30A 4XBFA 1YHQV 3G80A 3D36A 1VMGA 3TGUH 1H2LA 3ZHSA 4EFBA 2UXDO 3ZHTA 3G4SV 2JJ1G 5FPRA 1CP9A 4LC1A 2WLIB 4I50B 2DJVA 4J41A 4QNHB 1DF4A 2BSKA 3E83A 1AJNA 4ZHQB 1NI8A 2YUAA 2DYSB 4AQYB 3RYHA 2DYSC 4UVCA 2JVDA 4W4LA 2ITCC 5GONA 1GAXA 4PDVA 2F4VB 3H1JH 1M93A 3OEHG 4FLUA 2YEVB 5CA1A 1TVKB 3CB2A 1H5WA 1MZEA 5KHHA 5GW7A 3SYCA 4YJ2A 1FXKA 1IX9A 4IGGA 5LA6A 1R6TA 2QM4A 3A2FA 4R8CA 5EK0A 2F66C 1RPOA 3ZMSA 1QHTA 4HYOA 1U96A 3JCZA 3E2EA 3OMAB 2CH7B 2ZINA 2MW2B 3HPLC 5JJJB 1FOUA 5LP6A 5IYZB 3A0BZ 3CEIA 4G28B 5TISZ 4ZOLB 4LP8A 4TWKA 1AP6A 1EN6A 4JV5O 5EZYA 4DRXA 4AQYO 3ZEDA 1T5EA 2LQTA 1S0VA 4MVUA 2OCCB 2E5LB 2EILC 3A0RA 2ZM6O 5ITZB 2VQFO 1VF6C 4DW1A 1BHAA 2NN4A 5IYCO 4JAAA 3JASA 3CC4V 4QIWF 2GBOA 1K4DC 1SF9A 1JPXA 5B1BC 2XUMA 3OD4A 4D7SA 2OIGA 1SQXH 2ZIOA 4K8ZA 1TA8A 3KKYA 1AROP 3O65A 5J2TA 3CCJV 1E79G 5CBHA 2H8PC 4NXNO 3BHPA 2ATKC 2IU3A 2YXYA 1R1BA 3JARA 3B09A 1OCRC 3CCQV 5IJ0B 1Q8IA 4UCTA 5A9GA 1KQSU 4D6TH 4RUEA 5DN6G 3C3SA 1W59A 2NR5A 1V55B 2H94A 3BPZA 1K5QA 2JEUA 2LP7A 4QPJA 4J10A 3QVNA 1M9NA 1P4RA 4OPHA 4LF4B 3ZX6A 1JQ0A 3TXSA 4O4LB 2WLIA 2UUAB 2ZIMA 1ORQC 4I0XA 3OW2U 4MT8A 2R9AA 3X2QC 1QBZA 1OJHA 4IIJB 4YJ2B 3CP1A 2YICA 4TT3G 1JFFA 1MA1A 3LDEA 3C3TA 5JQGB 4KXRA 2IH1C 3KCYA 1JNBA 3AK3A 3K58A 4E2LA 3P3NA 2P7TC 4EB6A 3D36C 4WCEV 2ZDIC 4GUNA 1OCZB 3JD1A 3L72H 2ZDIA 4DR4O 5BMVB 2GHYA 5CA3A 4DR6B 1VQ7V 3T1HO 5KHIA 1OCOC 2EJRA 3ZIAG 1D2DA 1HWYA 2UXCO 5CBGA 5JCOC 1BS3A 3ABLB 4LNUA 4YJ3A 1HR0O 4XDKA 2CE4A 3G6BA 4GKKB 1AR4A 3CD6V 5LXTB 1KMIZ 3CCSV 4J7KA 4LCUC 4X1IA 1RPRA 4P9OA 2PTMA 1VEWA 2VRZA 4LF6O 2UU9O 4L8JA 2W0FC 1IBMB 4RO2A 4NTWA 2WLHA 4GLXA 4B3SB 4UVBA 2Q7EA 1RSOA 3T1YO 4X64B 5KA5A 1PNKA 2PGGA 4DV0O 3CCEV 3JD0A 2P6JA 2Q7HA 4J80A 2HKOA 2YSUB 3L71H 2HHHB 3SR2C 4EFEA 4F4LA 2Y69C 1QLNA 4RQFA 4GT1A 3U0ZA 4H0LB 1W0JG 3TJTA 3CS5A 4FIPC 5KMGA 4PA3A 1BHBA 3B8MA 3D3IA 1XNRO 4WBNB 1NVPB 4TOIA 1GM7A 1NS1A 1EBOA 4X20A 5JQGA 1ZUQA 5LMNB 5B3SB 4OPAA 1BCCH 1Q86W 4FM0A 3ZRWB 3OTOB 4LF4O 2Y48A 2L35A 4PI2A 2XT9A 5KA6A 3J7AU 2XNDG 3M7MX 5KX5A 2ODMA 3FX7A 1YIJV 4RAIA 3TXQA 4NXMO 3CMEV 2WLKA 2W0XA 2DMXA 1F51A 5D5QA 3WU2Z 2C2AA 4DV7B 2BE3A 2Y0IA 3NXSA 1I94O 3STZC 3SPIA 1JOYA 3BVOA 3JASB 3ABMC 4JI1B 3BCCH 4DR7B 1IURA 1YTFB 2WA3A 2ZXWB 2ILMA 3SJBC 3RW0A 2CH7A 1OCRB 3Q4HA 4DV1O 4ABMA 1VQLV 1K4CC 1RSOB 3CC2V 1EZVH 4I4TB 2DN9A 1CEZA 4X66B 1GMGA 5E1AC 3JARB 3CMAV 3UCSC 5IYDO 1H2GA 4JAVA 1G1XB 4LR3A 1NTKH 1F7YA 3C90A 2PUSA 4ZHQA 1NJIW 1YJ9V 4KFMA 5FNVA 2KKWA 2DQ3A 3JAMN 5IWAB 1COWG 1MSWD 2V1DA 1UJWB 2ZE8A 2K9PA 4TV8B 3M8AA 4FLZA 1AILA 2IM9A 2F1MA 1TUBB 1YSCA 4WBNA 3JAWB 1M5IA 1WB8A 4I0XB 4JF3A 1SQBH 2VQFB 5L3EA 4B3TB 2WAMA 3TETA 5JVDA 1JCHA 2QM7A 1NH2B 2RQ6A 3B8NA 1K3EA 3IC9A 3E35A 2P4KA 1GN4A 1I5XA 3D3QA 3JYCA 3EFFK 5DM6V 3JAKA 2EZOA 4LFAO 4DRXB 3FAVA 2R72A 1BGYH 1US6A 4LFBB 2X6BA 1Y74B 1V9PA 3WFVA 5B1NA 2ZE6A 2GSMB 2XAQA 2UXBO 4J42A 4JI8B 4HNAB 3OTOO 4I55B 1KUQA 1QNMA 4UCVA 3E8HA 5J2UB 3CJHB 4FK5C 3OMIB 2UXCB 3O9OA 4FVMA 1KP2A 1BMFG 4B08A 2WLNA 4PA6A 2W6JG 2F95B 2BCCH 3ZCCA 2N04A 3AG1B 3QO5A 1YXBA 3RWRD 4EKWA 3WG7B 1XEQA 4DUYO 4X66O 2AGAA 4JASA 3DTUB 1BQZA 1XL4A 2XOKG 4H44B 1Q82W 2VS0A 1GN2A 5A2QN 5BR8O 4PD4F 3E8BA 4FPPA 4J7ZA 3FB7C 2QWPB 3K03A 3CCVV 3K0GA 3KZIZ 4O4HA 2E76B 4O2BA 4LF8O 1GH6A 4MS2A 5LHGA 1ZSPA 1Q6UA 5BMVA 1WPBA 1FD9A 1XUQA 2Z3YA 3ASNB 4UCUA 3LDCA 3SPGA 4BR6A 2IJKA 4X1YB 5HFLA 4J9ZB 2OTLV 4R7CA 1H8HG 2Q68A 4K3AA 1Q6HA 4DR3O 4DR2O 4UCSA 1VQ9V 2E75B 1K73W 4TQFA 5DEDA 4P2ZA 2RJZA 1NTMH 2CGNA 3T1HB 3MHHC 4FMTA 4GX2A 1X59A 5CB4A 1S5JA 4IIJA 3LUTB 3ZS8C 4FM1A 5EC2C 5FNVB 1B04A 4AI8A 1V54B 2ZR2A 3ETGA 4JYAO 3DXRA 1NR1A 2EIMC 5B1BB 1K8AW 3ABMB 3K06A 3D8CA 2GUZA 4GX5A 3APQA 2ZXWC 2N74A 4ZKIA 5LOVB 4W4KA 1CXZB 2NLJC 3HKEA 2EINB 5H6QA 1HP8A 2UXBB 4GKJB 4OX9O 1M56C 3CX5F 4LH7A 2Z5UA 2LGQA 2CUGA 2YXHA 1IXBA 3IJ4A 1L0LH 4K35A 1OCZC 1ZLZA 4LF9B 4DR1B 1SQVH 1D5NA 4B7EA 4DV5B 1I94B 4JI2B 4IT5A 2ZE5A 3QTCA 4K8XA 1VARA 1S5HC 1DLBA 3FFQA 4YY3B 1VQ8V 4MVQA 4CC5A 1YZBA 3K5OA 2EBOA 1M1KW 4YXWG 4JI4B 5C8YA 1R3LC 2R70A 2WSSG 4JI1O 5LGUA 1NT2B 4LF9O 5GTHZ 4O4HB 3F5TA 1VIBA 3JD2A 3I56V 3OUFA 3QO8A 2QEXV 3BA9A 3CHXA 2KG7B 4B3TO 4TV9B 5K1PA 3UO3A 4X65O 2CTQA 1N8RW 1LUWA 2F4VO 1N0JA 2QE7G 3OGCC 1J5EO 2IJHA 4F6EA 2X7RB 4BWAA 3N27A 4N21A 2EX3A 2WLLA 4PDLA 1Q7YW 5H5NA 3EXAA 2AW9A 2BSKB 4MTOA 4HNAA 1AI4A 3SJCC 5IYBO 1IBMO 1E1RG 4PA9A 3PJSK 1BL8A 1FPOA 1SQFA 3ZHUA 1H2SB 2P06A 1RM1B 3DXRB 2RMKB 1GN6A 2ZR3A 1JA8A 3FB6C 3OGIB 4FFBA 1NZ6A 1NBMG 5CB4B 1MABG 2PYJA 3CSXA 1R3IC 4I4TA 3RYCA 1K34A 1JJ2U 3CRCA 1GTOA 3VQXA 2HJFC 2ZKOA 1AJQA 5JJNB 1WPXA 2K1EA 2QM8A 2LJ2A 1Y6XA 1WP8A 3FYEB 4MVOA 4UV8A 3ZMUA 1PPJH 4EEQA 2CTRA 3RFRA 1AR1B 4LNUB 4FJCC 2AHYA 1KECA 5LOVA 3VQVA 4JPRA 3N2GA 1R6KA 2OTJV 1QLEC 1AB3A 1A32A 4FZ1A 1EZJA 4H37A 3GWOA 3MAQA 3FYIB 3SYPA 4G27B 4PDMA 3BAAA 2LFRA 2XAJA 2YI9A 3RVZA 3BRCA 3RT3C 1XDCA 1EFRG 5IE9A 4DR2B 2UUCB 1QVGU 1R73A 3HKBA 2GTAA 1YJWV 3A0HZ 1PP9H 2JGUA 2KG7A 1ZX3A 3SGIA 5IY5B 4KHPB 2FTKA 2O57A 3JATB 1GK9A 1YF2A 2R9RB 4D7TA 3WB2A 1OCOB 1FFTB 1RFYA 1FYJA 2EIMB 1P7GA 2QSAA 4WFFA 4ZBMA 4CZZA 5CBFA 1MMMA 4TSFG 2A9HA 4Q6GA 3UO2A 1YITV 5JWPA 3SYOA 5EBMC 2Y69B 4RUFA 2DE0X 3JALB 4DK0A 1VQMV 1XHXA 4KHPO 2QGNA 4QPKA 2JJ2G 2WA4A 3OMNB 1DTOA 5IWAO 2E74B 3ZHQA 2IH3C 4JI5B 2P67A 5LYJB 4ZI7A 2M6YA 3R65A 3ASNC 3Q4HB 1L0NH 4JI6B 4DK1A 4JI5O 2OCHA 3K3WA 1R3KC 2QWRB 1IJGA 1PNLA 1SQQH 3KCXA 4UB8Z 1SQGA 4Z1MG 5C8YB 2GUZB 4LFCB 5CA0A 2MK3A 1LNQA 3HKCB 3SDLA 1CPYA 1MZFA 3T4DA 4NTYA 2HHHO 2IBZH 4J11A 2QTOA 2PZSA 5IT9N 4LBEC 1Y4MA 4WFGA 1TUBA 4PHZA 5B1OA 1IBLO 2ZT9B 2PF4E 3CCUV 1N33B 1NQTA 4UUJC 3W7SA 4NYKA 2BOCC 2HP8A 5K1XA 4HZ3A 3ZRWA 2ETNA 2AXTZ 2XAHA 1QVFU 1AI7A 3B4SA 4JI2O 2CAZC 2F23A 2X6CA 5LMNO 5JH7B 4JI0O 1XMOO 3RYHB 4JZ2A 5KLVH 2WLMA 3SPJA 4JI6O 5ITZA 1Z2GA 2XASA 4I9QA 4I5SA 1HNZO 1URFA 4K0KO 2G38A 2HVJC 1O9GA 1TVKA 1DF5A 2QKCA 4UXNA 4AHCA 3W7XA 1PL0A 2AZ0A 1F23A 2EULA 1FFXA 3M99B 4I55A 3B40A 1XNRB 1K92A 1MOFA 1K7DA 1FXKB 3AG4C 4FFBB 4LF5B 4NKGB 4X9QA 1KBHA 3CRQA 2XAGA 2FL4A 1AI6A 4X62B 5LHHA 3W7UA 3DGEA 2IU0A 4A5UB 1OV9A 1N36O 1BZKA 3IC7A 1AI5A 1BT8A 1XNQB 3QG5A 4DV4B 4DV0B 3AG2B 3RYIA 1GM8A 4DR7O 4B7KA 1Y76B 1Q43A 4B3SO 2QDOA 1VQ4V 3OAAG 2KB1A 2WLLB 3L74H 3CWBH 2EIKC 3OTFA 3OT7A 1XILA 2LGWA 1ZL8A 4LF8B 4DR3B 2QWNB 4O2BB 1I7FA 2Y4UA 1H38A 3ZRSA 3K57A 2PYLA 4CC6A 2E3CA 3AK2A 3JSNA 2EJ7A 1HNXB 2A06H 2GTSA 3EVKA 3H1LH 3OEEG 5LP6C 4IL6Z 1SQPH 4BW9A 4LF5O 4ZI7B 5H9CA 4KUMA 4DV5O 3QNEA 5KUMA 1RP3B 1F4MA 2Q67A 1SESA 4TV9A 4FZ0A 3DC6A 4J9YB 5L3FA 3RYCB 2EZPA 5IJ9B 4NXNB 5KX5B 5EIBD 3GB7C 2EIJB 4GYCB 3CCLV 1HNZB 2VWJA 3J81N 1VF6A 1HW7A 3W7WA 4WFBV 3IFXA 3HKCA 3P3PA 1WB7A 3QF7A 2CTPA 2QKSA 1G8MA 1XMQO 1PM9A 5IDJA 3K08A 1Q81W 1AJPA 5FLXN 1N4CA 3BY6A 4TUYA 4N23A 4R6ZA 4LF6B 2Y4TA 3OUSA 5LA6B 2B1GA 4OXSA 5KAFZ 1Q6IA 3ETEA 1VQ5V 2QA4V 2YC0A 2DWEC 4LF7B 4X89A 4CH3A 4F6RA 1N32O 4IHJB 3STLC 4PV1B 3ML0A 4DUZO 2YIDA 4O4IA 1VQKV 1KP3A 1TGOA 2JGDA 4LWSA 3UM7A 2HVKC 1VP7A 1NVPD 2ZNJA 1WN7A 4MVZA 3VQYA 5B1AC 2UXNA 1THZA 4GX1A 4P9PA 4ASUG 3ZMVA 4Z1VA 4FLVA 1XNQO 1XMQB 3FB5C 4MW8A 1SZTA 4TQDA 3ABKC 1FFXB 1K97A 3K0DA 1I08A 3JAWA 1G6UA 4E4EA 4UFZA 2OT5A 3B77A 5BXZA 2ZE7A 3RYIB 5KAIZ 1JVMA 2NNUA 2RCVA 3GVMA 4DUYB 3BABA 4XDLA 4DR5O 1P49A 1M4UA 4BIZA 3P30A 2GDSA 2HEPA 3JATA 1X4TA 3CPWU 4U3JA 4X64O 3FB8C 4B3RO 5EBLC 4IYHA 4JYBA 1Z5WA 5GTIZ 4QGPA 2F43G 4O4JA 5JH7A 1Q90D 4UB6Z 1UFIA 5JCOA 3ETDA 3J80N 1IBKB 2CTWA 3GWKC 1K5SA 3NR7A 3LSSA 2ITDC 3L9DA 4FFKA 4FM2A 3ZJZA 3MDSA 3E8FA 2P4VA 3CXHF 1SETA 1XOUA 2CDYA 4I50A 2FMLA 4BIUA 4MVMA 1MNGA 1KD1W 2VQEO 1SERA 1D5AA 4DO2A 4DR4B 1RM1C 2PY5A 3K79A 5LGTA 4H33A 4JYCA 5CMUA 3H1HH 3WG7C 4DV4O 3UT5B 3SPCA 3EHBB 3OE7G 4I9WA 2JGDB 4LWSB 1AVMA 3H1IH 2FYUH 3JSLA 4BW5A 1OZ0A 4I7ZB 1KC8W 3CRRA 2HG5C 2DW4A 1GM9A 3W7TA 4KL1A 1I0HA 5IYZA 4C7UA 4DV6B 2AHZA 4QJFB 2WPDG 1FJGB 4MVRA 3TCUA 2JK5C 1P7BA 1TAEA 3G6EV 1H2MA 3P32A 2DQ0A 4FLWA 3A8TA 1B06A 3SYQA 5B1AB 3K5NA 5H2FZ 2HJDA 3T4ZA 4B3MO 3JD4A 3N2KB 5KHKA 1HDJA 4XDJA 2LFSA 1JMKC 4MTFA 4GKKO 3K9SA 1KKDA 3F7VC 2LW7A 2YI8A 2EIKB 4U3JB 3AG3B 2VQEB 3AG3C 3WB1A 4DR1O 3FKSG 1AP5A 4WFAV 2B5UA 3RVYA 4NB5A 3H1KH 2OCCC 3K5LA 1MSDA 5IJ0A 5DECA 3RGBA 1VF5B 2QTSA 2W6IG 4NR1A 5EBWC 1L1FA 1ZL8B 4FLTA 3G71V 2BTOA 4PI0A 1BQ0A 2YIAA 1E1QG 4JI3B 4BIOA 1GN3A 2V4DA 2CGOA 4O4LA 3S3XA 1PKXA 2QJ1A 1L8DA 1PV0A 3AG1C 4O2AA 1WA8A 2Q4PA 1KKCA 4PELA 4MVSA 2RNBA 3K04A 1LR1A 1YTFD 1XL6A 3K9AA 4O4IB 3ZBHA 3K59A 2Q8VA 4MTGA 3AG7A 5LYJA 3THOA 2V7QG 3UKMA 1ZAUA 1QQCA 4U3FH 2QR4A 2ZCEA 1GKFA 2Y0PA 1N34O 2JS3A 2Q6AA 2XAFA 3L70H 2Q73A 2E5LO 2EILB 3AG2C 5D5PA 1PD3A 4R50A 1WNSA 1JX9A 3HKDB 2R9IA 3K5MA 4ZIBA 3L73H 2X0LA 5CA0B 5L3CA 4DUZB 1VQPV 1JFFB 2HFEC 3E8GA 1N34B 5JVDB 2YXLA 2DWDC 1QR8A 2B9ZA 4YIOA 5B3SC 3ZN0A 4DW0A 3IGAC 3E22A 4NXMB 2UUCO 3ABLC 3WB0A 5EC1C 1FJGO 2JDIG 4DV3O 1EN4A 1F4NA 1V55C 3H9VA 5CN0A 1M57B 3BFRA 1SA0A 2GV9A 1QR9A 4PA4A 1HNWB 4U7OA 3RN4A 3HB3B 1MG1A 1N36B 4YIPA 2RDCA 3AG4B 5AG2A 2ADPA 3LNNA 1KU9A 2IW5A 4X62O 2UXDB 4JI7B 1OHHG 1OCCC 4RQEA 4DV1B 2AZ2A 4TUYB 2LW1A 5LXTA 2HLDG 2RN9A 2A3QA 2Q69A 4JI8O 1R6NA 3LNMB 2OYQA 1OCCB 1ZWIC 4X1YA 1LUVA 3G67A 2BOBC 4WF9V 4BAYA 4HBNA 3H01A 1P84F 4NTXA 4X20B 5EIBC 3UT5A 2UU9B 5LMUB 3CC7V 2YIBA 3N2GB 3LDDA 5EZYB 2JRIA 5J9PC 1AR5A 4O4JB 1SS3A 4JZGA 2X6AA 3JAKB 4KP4A 2BTQA 1HR0B 4MSWC 1NTZH 4PA7A 1G4YB 1IVSA 1QCEA 5HFMA 1XBLA 2JIZG 1XREA 5JJEB 4GX0A 1YJNV 4CH4A 5LL6Y 1W0KG 4JI7O 1ENVA 3SJAC 3CJHA 1M56B 3HKEB 2PI4A 2F93B 3RBZA 3ETQA 5J2TB 4K0KB 1YCIA 4X1KB 1H8EG 5KUKA 3ZN1A 4LFCO 5BR8B 4LH6A 2Q9LA 2M7WA 4O2AB 1I5YA 1BE3H 5KHGA 3F7YC 2L6LA 3L75H 3QO7A 3KDRA 1VF7A 5GONB 2JS5A 1SC5B 3ASOB 3U11A 2YEVA 1N33O 2P22C 3HKDA 4HAMA 4LFBO 4CS3A 2ARHA 3PN1A 2ZM6B 1XI1A 2DYRB 4U7NA 3CRAA 2UUBB 2VWKA 4IYIA 2D2CB 1S76D 1KYOF 1FXVA 5KMGB 1FXKC 4WFEA 1HNXO 1M57C 2OWOA 1FXHA 4Q20A 4TV8A 4JTAB 4WFHA 4UCOA 2KQXA 5E79Z 2QWQB 1SA0B 4PJ0Z 4L87A 4CS4A 5IY5C 2ZNIA 4FLYA 2UUBO 1H2KA 1WJZA 4DXWA 1Y74A 3T1CA 5EYPA 1H2NA 2Z0AA 2A79B 3RYFA 1FS0G 3E86A 1IZ3A 2DYRC 2XHBA 5L3DA 1JJOA 1WP7A 1YEWA 1TUEB 3I55V 1B6QA 1R3JC 5F2VO 1ROPA 1YVWA 2YIBD 1DGSA 2WLJA 4JTCB 2YDEA 2YS8A 3U10A 3LSUA 4JYAB 4JV5B 2N05A 3MHSC 3ASOC 3SPHA 1VQNV 4GCZA 3VBBA 1VQ6V 5BY1A 2QKAA 3S3WA 2UXXA 1SZXA 4G2KA 1N32B 3N2KA 4JI3O 4DV3B 1V54C 1WLEA 2BTQB 3SYAA 5IJ9A 1PNMA 3ABTA 3ZHVA 2OIEA 4QE7A 1S5LZ 1QU7A 1DK1A 2IJJA 5J2UA 1Y67A 3MD0A 5BZBA 1EN5A 3CYOA 5B66Z 1BSMA 3ZMTA 2P90A 5CA1B 4UV9A 1XHZA 1IXMA 2CK3G 1N0NA 1Y66A 1S3JA 4MW3A 3JALA 4RWUA 4DV6O 2ZQMA 1IDSA 1YI2V 2Q0OC 2EINC 4J7JA 3TK1A 4UCRA 1VQOV 3ABUA 3I5DA 3E22B 3CRMA 1WA8B 4X1KA 1Y76A 4ICGA 3AEIA 5LHIA 2EIJC 1NH2D 4X65B 5LGNA 1UPGA 1YDXA 3AK1A 4NVPA 2P5OA 2A7WA 1S77D 1HNWO 2ZD9A 2H3OA 5L3GA 3FAVB 3UQ8A 4YHHO 3VOUA 3OFNG 4CH6A 4IHJA 3APOA 4AILC 5LBQA 4X88A 3ZRXA 2B1IA 4EB6B 1XMOB 3DC5A 4JI0B 4LF7O 3VQWA 1IBKO 1ZTEA 1SKVA 2QWOB 2FKXA 5KHJA 4JYYA 2D3OW 1IBLB 5EYPB 3IAYA 2IJIA 3HR0A 2DOSA 2Q7GA 5LMUO 1U97A 4UVAA 3HKBB 4F6RB 1K9MW 1XQ8A 4YJ3B
chains in the Genus database with same CATH topology
1BS3A 1MMMA 1WB7A 3KDRA 3KKYA 3BFRA 1MSDA 2CE4A 1AR4A 2QKCA 1GN6A 1PM9A 3RN4A 1JA8A 1IXBA 1VEWA 4YIPA 5AG2A 1ZLZA 2ADPA 1Y67A 4FFKA 1EM1A 1EN5A 1D5NA 4X9QA 1GN3A 3MDSA 1BSMA 1GN2A 2CDYA 1MNGA 5A9GA 1N0NA 1VARA 3C3SA 1AP5A 1IDSA 1BT8A 1JR9A 1LUVA 3QVNA 1IX9A 1KKCA 1ZSPA 1PL4A 1AVMA 1XUQA 3TJTA 3AK1A 2ADQB 3OT7A 1XILA 4BR6A 1AR5A 1WB8A 4JZGA 1I0HA 3AK2A 4C7UA 1MA1A 1ZUQA 3C3TA 3EVKA 3CEIA 1XREA 3IC9A 1LUWA 2P4KA 1XDCA 1I08A 1AP6A 1EN6A 1GN4A 4E4EA 1N0JA 1B06A 3AK3A 3DC5A 3DC6A 1ZTEA 4YIOA 2RCVA 4F6EA 4JYYA 4GUNA 3K9SA 3LSUA 2GDSA 2AW9A 2QKAA 1QNMA 1SZXA 1P7GA 1EN4A 4JZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BS3 A;  1MMM A;  1WB7 A;  3KKY A;  3BFR A;  1MSD A;  2CE4 A;  1AR4 A;  2QKC A;  1GN6 A;  1PM9 A;  3RN4 A;  1JA8 A;  1IXB A;  1VEW A;  4YIP A;  5AG2 A;  1ZLZ A;  2ADP A;  1Y67 A;  4FFK A;  1EM1 A;  1EN5 A;  1D5N A;  4X9Q A;  1GN3 A;  3MDS A;  1BSM A;  1GN2 A;  2CDY A;  1MNG A;  5A9G A;  1N0N A;  1VAR A;  3C3S A;  1AP5 A;  1IDS A;  1BT8 A;  1JR9 A;  1LUV A;  3QVN A;  1IX9 A;  1KKC A;  1ZSP A;  1PL4 A;  1AVM A;  1XUQ A;  3TJT A;  3AK1 A;  2ADQ B;  3OT7 A;  1XIL A;  4BR6 A;  1AR5 A;  1WB8 A;  4JZG A;  1I0H A;  3AK2 A;  4C7U A;  1MA1 A;  1ZUQ A;  3C3T A;  3EVK A;  3CEI A;  1XRE A;  3IC9 A;  1LUW A;  2P4K A;  1XDC A;  1I08 A;  1AP6 A;  1EN6 A;  1GN4 A;  4E4E A;  1N0J A;  1B06 A;  3AK3 A;  3DC5 A;  3DC6 A;  1ZTE A;  4YIO A;  2RCV A;  4F6E A;  4JYY A;  4GUN A;  3K9S A;  3LSU A;  2GDS A;  2AW9 A;  2QKA A;  1QNM A;  1SZX A;  1P7G A;  1EN4 A;  4JZ2 A; 
#chains in the Genus database with same CATH topology
 4H13 B;  3E89 A;  4MTX A;  1QLE B;  2HR3 A;  5B5E Z;  3FD9 A;  1B3Q A;  1SRY A;  1O9H A;  2Q5Z A;  1J5E B;  3ZMZ A;  3RYF B;  3OR6 C;  4ZOL A;  4DYL A;  1Z5V A;  3ICX A;  4OGQ B;  3DSQ A;  2LO1 A;  3BA8 A;  3OR7 C;  3OM3 B;  1EM1 A;  4B3M B;  5LP6 B;  4DV2 B;  3T2M A;  2XTA A;  4JTD B;  1GO3 F;  4B3R B;  3LSQ A;  3JD3 A;  1Q3E A;  4CH5 A;  4DR6 O;  2JEX A;  1M90 W;  1NR7 A;  4DR5 B;  1JR9 A;  1S72 V;  3CCM V;  3BEH A;  3F5W C;  4OX9 B;  4GKJ O;  4JGS A;  5C93 A;  4YHH B;  1W2B U;  4QE9 A;  4CS2 A;  1PL4 A;  3X2Q B;  2UUA O;  4CBC A;  2KSD A;  4GZR B;  4X8A A;  3KG2 A;  2ADQ B;  5H6R A;  3B2E E;  4Z2W A;  4DV2 O;  1FAF A;  4X1I B;  1K33 A;  2FB5 A;  1GRJ A;  3ZRV A;  4LFA B;  4PDR A;  1WAZ A;  2WWW A;  1NKD A;  4JAU A;  1J95 A;  3CXC U;  4FLX A;  3JCU Z;  3R66 A;  3ZHR A;  4JI4 O;  5L3B A;  3T1Y B;  3SJQ C;  3ABK B;  5FL7 G;  3CCR V;  1Q5O A;  2A0L A;  4DV7 O;  5FPO A;  1NU1 H;  4YY3 O;  3CE2 A;  2Q0A A;  1KB9 F;  1FKA O;  2PI5 A;  4P30 A;  4XBF A;  1YHQ V;  3G80 A;  3D36 A;  1VMG A;  3TGU H;  1H2L A;  3ZHS A;  4EFB A;  2UXD O;  3ZHT A;  3G4S V;  2JJ1 G;  5FPR A;  1CP9 A;  4LC1 A;  2WLI B;  4I50 B;  2DJV A;  4J41 A;  4QNH B;  1DF4 A;  2BSK A;  3E83 A;  1AJN A;  4ZHQ B;  1NI8 A;  2YUA A;  2DYS B;  4AQY B;  3RYH A;  2DYS C;  4UVC A;  2JVD A;  4W4L A;  2ITC C;  5GON A;  1GAX A;  4PDV A;  2F4V B;  3H1J H;  1M93 A;  3OEH G;  4FLU A;  2YEV B;  5CA1 A;  1TVK B;  3CB2 A;  1H5W A;  1MZE A;  5KHH A;  5GW7 A;  3SYC A;  4YJ2 A;  1FXK A;  1IX9 A;  4IGG A;  5LA6 A;  1R6T A;  2QM4 A;  3A2F A;  4R8C A;  5EK0 A;  2F66 C;  1RPO A;  3ZMS A;  1QHT A;  4HYO A;  1U96 A;  3JCZ A;  3E2E A;  3OMA B;  2CH7 B;  2ZIN A;  2MW2 B;  3HPL C;  5JJJ B;  1FOU A;  5LP6 A;  5IYZ B;  3A0B Z;  3CEI A;  4G28 B;  5TIS Z;  4ZOL B;  4LP8 A;  4TWK A;  1AP6 A;  1EN6 A;  4JV5 O;  5EZY A;  4DRX A;  4AQY O;  3ZED A;  1T5E A;  2LQT A;  1S0V A;  4MVU A;  2OCC B;  2E5L B;  2EIL C;  3A0R A;  2ZM6 O;  5ITZ B;  2VQF O;  1VF6 C;  4DW1 A;  1BHA A;  2NN4 A;  5IYC O;  4JAA A;  3JAS A;  3CC4 V;  4QIW F;  2GBO A;  1K4D C;  1SF9 A;  1JPX A;  5B1B C;  2XUM A;  3OD4 A;  4D7S A;  2OIG A;  1SQX H;  2ZIO A;  4K8Z A;  1TA8 A;  3KKY A;  1ARO P;  3O65 A;  5J2T A;  3CCJ V;  1E79 G;  5CBH A;  2H8P C;  4NXN O;  3BHP A;  2ATK C;  2IU3 A;  2YXY A;  1R1B A;  3JAR A;  3B09 A;  1OCR C;  3CCQ V;  5IJ0 B;  1Q8I A;  4UCT A;  5A9G A;  1KQS U;  4D6T H;  4RUE A;  5DN6 G;  3C3S A;  1W59 A;  2NR5 A;  1V55 B;  2H94 A;  3BPZ A;  1K5Q A;  2JEU A;  2LP7 A;  4QPJ A;  4J10 A;  3QVN A;  1M9N A;  1P4R A;  4OPH A;  4LF4 B;  3ZX6 A;  1JQ0 A;  3TXS A;  4O4L B;  2WLI A;  2UUA B;  2ZIM A;  1ORQ C;  4I0X A;  3OW2 U;  4MT8 A;  2R9A A;  3X2Q C;  1QBZ A;  1OJH A;  4IIJ B;  4YJ2 B;  3CP1 A;  2YIC A;  4TT3 G;  1JFF A;  1MA1 A;  3LDE A;  3C3T A;  5JQG B;  4KXR A;  2IH1 C;  3KCY A;  1JNB A;  3AK3 A;  3K58 A;  4E2L A;  3P3N A;  2P7T C;  4EB6 A;  3D36 C;  4WCE V;  2ZDI C;  4GUN A;  1OCZ B;  3JD1 A;  3L72 H;  2ZDI A;  4DR4 O;  5BMV B;  2GHY A;  5CA3 A;  4DR6 B;  1VQ7 V;  3T1H O;  5KHI A;  1OCO C;  2EJR A;  3ZIA G;  1D2D A;  1HWY A;  2UXC O;  5CBG A;  5JCO C;  1BS3 A;  3ABL B;  4LNU A;  4YJ3 A;  1HR0 O;  4XDK A;  2CE4 A;  3G6B A;  4GKK B;  1AR4 A;  3CD6 V;  5LXT B;  1KMI Z;  3CCS V;  4J7K A;  4LCU C;  4X1I A;  1RPR A;  4P9O A;  2PTM A;  1VEW A;  2VRZ A;  4LF6 O;  2UU9 O;  4L8J A;  2W0F C;  1IBM B;  4RO2 A;  4NTW A;  2WLH A;  4GLX A;  4B3S B;  4UVB A;  2Q7E A;  1RSO A;  3T1Y O;  4X64 B;  5KA5 A;  1PNK A;  2PGG A;  4DV0 O;  3CCE V;  3JD0 A;  2P6J A;  2Q7H A;  4J80 A;  2HKO A;  2YSU B;  3L71 H;  2HHH B;  3SR2 C;  4EFE A;  4F4L A;  2Y69 C;  1QLN A;  4RQF A;  4GT1 A;  3U0Z A;  4H0L B;  1W0J G;  3TJT A;  3CS5 A;  4FIP C;  5KMG A;  4PA3 A;  1BHB A;  3B8M A;  3D3I A;  1XNR O;  4WBN B;  1NVP B;  4TOI A;  1GM7 A;  1NS1 A;  1EBO A;  4X20 A;  5JQG A;  1ZUQ A;  5LMN B;  5B3S B;  4OPA A;  1BCC H;  1Q86 W;  4FM0 A;  3ZRW B;  3OTO B;  4LF4 O;  2Y48 A;  2L35 A;  4PI2 A;  2XT9 A;  5KA6 A;  3J7A U;  2XND G;  3M7M X;  5KX5 A;  2ODM A;  3FX7 A;  1YIJ V;  4RAI A;  3TXQ A;  4NXM O;  3CME V;  2WLK A;  2W0X A;  2DMX A;  1F51 A;  5D5Q A;  3WU2 Z;  2C2A A;  4DV7 B;  2BE3 A;  2Y0I A;  3NXS A;  1I94 O;  3STZ C;  3SPI A;  1JOY A;  3BVO A;  3JAS B;  3ABM C;  4JI1 B;  3BCC H;  4DR7 B;  1IUR A;  1YTF B;  2WA3 A;  2ZXW B;  2ILM A;  3SJB C;  3RW0 A;  2CH7 A;  1OCR B;  3Q4H A;  4DV1 O;  4ABM A;  1VQL V;  1K4C C;  1RSO B;  3CC2 V;  1EZV H;  4I4T B;  2DN9 A;  1CEZ A;  4X66 B;  1GMG A;  5E1A C;  3JAR B;  3CMA V;  3UCS C;  5IYD O;  1H2G A;  4JAV A;  1G1X B;  4LR3 A;  1NTK H;  1F7Y A;  3C90 A;  2PUS A;  4ZHQ A;  1NJI W;  1YJ9 V;  4KFM A;  5FNV A;  2KKW A;  2DQ3 A;  3JAM N;  5IWA B;  1COW G;  1MSW D;  2V1D A;  1UJW B;  2ZE8 A;  2K9P A;  4TV8 B;  3M8A A;  4FLZ A;  1AIL A;  2IM9 A;  2F1M A;  1TUB B;  1YSC A;  4WBN A;  3JAW B;  1M5I A;  1WB8 A;  4I0X B;  4JF3 A;  1SQB H;  2VQF B;  5L3E A;  4B3T B;  2WAM A;  3TET A;  5JVD A;  1JCH A;  2QM7 A;  1NH2 B;  2RQ6 A;  3B8N A;  1K3E A;  3IC9 A;  3E35 A;  2P4K A;  1GN4 A;  1I5X A;  3D3Q A;  3JYC A;  3EFF K;  5DM6 V;  3JAK A;  2EZO A;  4LFA O;  4DRX B;  3FAV A;  2R72 A;  1BGY H;  1US6 A;  4LFB B;  2X6B A;  1Y74 B;  1V9P A;  3WFV A;  5B1N A;  2ZE6 A;  2GSM B;  2XAQ A;  2UXB O;  4J42 A;  4JI8 B;  4HNA B;  3OTO O;  4I55 B;  1KUQ A;  1QNM A;  4UCV A;  3E8H A;  5J2U B;  3CJH B;  4FK5 C;  3OMI B;  2UXC B;  3O9O A;  4FVM A;  1KP2 A;  1BMF G;  4B08 A;  2WLN A;  4PA6 A;  2W6J G;  2F95 B;  2BCC H;  3ZCC A;  2N04 A;  3AG1 B;  3QO5 A;  1YXB A;  3RWR D;  4EKW A;  3WG7 B;  1XEQ A;  4DUY O;  4X66 O;  2AGA A;  4JAS A;  3DTU B;  1BQZ A;  1XL4 A;  2XOK G;  4H44 B;  1Q82 W;  2VS0 A;  1GN2 A;  5A2Q N;  5BR8 O;  4PD4 F;  3E8B A;  4FPP A;  4J7Z A;  3FB7 C;  2QWP B;  3K03 A;  3CCV V;  3K0G A;  3KZI Z;  4O4H A;  2E76 B;  4O2B A;  4LF8 O;  1GH6 A;  4MS2 A;  5LHG A;  1ZSP A;  1Q6U A;  5BMV A;  1WPB A;  1FD9 A;  1XUQ A;  2Z3Y A;  3ASN B;  4UCU A;  3LDC A;  3SPG A;  4BR6 A;  2IJK A;  4X1Y B;  5HFL A;  4J9Z B;  2OTL V;  4R7C A;  1H8H G;  2Q68 A;  4K3A A;  1Q6H A;  4DR3 O;  4DR2 O;  4UCS A;  1VQ9 V;  2E75 B;  1K73 W;  4TQF A;  5DED A;  4P2Z A;  2RJZ A;  1NTM H;  2CGN A;  3T1H B;  3MHH C;  4FMT A;  4GX2 A;  1X59 A;  5CB4 A;  1S5J A;  4IIJ A;  3LUT B;  3ZS8 C;  4FM1 A;  5EC2 C;  5FNV B;  1B04 A;  4AI8 A;  1V54 B;  2ZR2 A;  3ETG A;  4JYA O;  3DXR A;  1NR1 A;  2EIM C;  5B1B B;  1K8A W;  3ABM B;  3K06 A;  3D8C A;  2GUZ A;  4GX5 A;  3APQ A;  2ZXW C;  2N74 A;  4ZKI A;  5LOV B;  4W4K A;  1CXZ B;  2NLJ C;  3HKE A;  2EIN B;  5H6Q A;  1HP8 A;  2UXB B;  4GKJ B;  4OX9 O;  1M56 C;  3CX5 F;  4LH7 A;  2Z5U A;  2LGQ A;  2CUG A;  2YXH A;  1IXB A;  3IJ4 A;  1L0L H;  4K35 A;  1OCZ C;  1ZLZ A;  4LF9 B;  4DR1 B;  1SQV H;  1D5N A;  4B7E A;  4DV5 B;  1I94 B;  4JI2 B;  4IT5 A;  2ZE5 A;  3QTC A;  4K8X A;  1VAR A;  1S5H C;  1DLB A;  3FFQ A;  4YY3 B;  1VQ8 V;  4MVQ A;  4CC5 A;  1YZB A;  3K5O A;  2EBO A;  1M1K W;  4YXW G;  4JI4 B;  5C8Y A;  1R3L C;  2R70 A;  2WSS G;  4JI1 O;  5LGU A;  1NT2 B;  4LF9 O;  5GTH Z;  4O4H B;  3F5T A;  1VIB A;  3JD2 A;  3I56 V;  3OUF A;  3QO8 A;  2QEX V;  3BA9 A;  3CHX A;  2KG7 B;  4B3T O;  4TV9 B;  5K1P A;  3UO3 A;  4X65 O;  2CTQ A;  1N8R W;  1LUW A;  2F4V O;  1N0J A;  2QE7 G;  3OGC C;  1J5E O;  2IJH A;  4F6E A;  2X7R B;  4BWA A;  3N27 A;  4N21 A;  2EX3 A;  2WLL A;  4PDL A;  1Q7Y W;  5H5N A;  3EXA A;  2AW9 A;  2BSK B;  4MTO A;  4HNA A;  1AI4 A;  3SJC C;  5IYB O;  1IBM O;  1E1R G;  4PA9 A;  3PJS K;  1BL8 A;  1FPO A;  1SQF A;  3ZHU A;  1H2S B;  2P06 A;  1RM1 B;  3DXR B;  2RMK B;  1GN6 A;  2ZR3 A;  1JA8 A;  3FB6 C;  3OGI B;  4FFB A;  1NZ6 A;  1NBM G;  5CB4 B;  1MAB G;  2PYJ A;  3CSX A;  1R3I C;  4I4T A;  3RYC A;  1K34 A;  1JJ2 U;  3CRC A;  1GTO A;  3VQX A;  2HJF C;  2ZKO A;  1AJQ A;  5JJN B;  1WPX A;  2K1E A;  2QM8 A;  2LJ2 A;  1Y6X A;  1WP8 A;  3FYE B;  4MVO A;  4UV8 A;  3ZMU A;  1PPJ H;  4EEQ A;  2CTR A;  3RFR A;  1AR1 B;  4LNU B;  4FJC C;  2AHY A;  1KEC A;  5LOV A;  3VQV A;  4JPR A;  3N2G A;  1R6K A;  2OTJ V;  1QLE C;  1AB3 A;  1A32 A;  4FZ1 A;  1EZJ A;  4H37 A;  3GWO A;  3MAQ A;  3FYI B;  3SYP A;  4G27 B;  4PDM A;  3BAA A;  2LFR A;  2XAJ A;  2YI9 A;  3RVZ A;  3BRC A;  3RT3 C;  1XDC A;  1EFR G;  5IE9 A;  4DR2 B;  2UUC B;  1QVG U;  1R73 A;  3HKB A;  2GTA A;  1YJW V;  3A0H Z;  1PP9 H;  2JGU A;  2KG7 A;  1ZX3 A;  3SGI A;  5IY5 B;  4KHP B;  2FTK A;  2O57 A;  3JAT B;  1GK9 A;  1YF2 A;  2R9R B;  4D7T A;  3WB2 A;  1OCO B;  1FFT B;  1RFY A;  1FYJ A;  2EIM B;  1P7G A;  2QSA A;  4WFF A;  4ZBM A;  4CZZ A;  5CBF A;  1MMM A;  4TSF G;  2A9H A;  4Q6G A;  3UO2 A;  1YIT V;  5JWP A;  3SYO A;  5EBM C;  2Y69 B;  4RUF A;  2DE0 X;  3JAL B;  4DK0 A;  1VQM V;  1XHX A;  4KHP O;  2QGN A;  4QPK A;  2JJ2 G;  2WA4 A;  3OMN B;  1DTO A;  5IWA O;  2E74 B;  3ZHQ A;  2IH3 C;  4JI5 B;  2P67 A;  5LYJ B;  4ZI7 A;  2M6Y A;  3R65 A;  3ASN C;  3Q4H B;  1L0N H;  4JI6 B;  4DK1 A;  4JI5 O;  2OCH A;  3K3W A;  1R3K C;  2QWR B;  1IJG A;  1PNL A;  1SQQ H;  3KCX A;  4UB8 Z;  1SQG A;  4Z1M G;  5C8Y B;  2GUZ B;  4LFC B;  5CA0 A;  2MK3 A;  1LNQ A;  3HKC B;  3SDL A;  1CPY A;  1MZF A;  3T4D A;  4NTY A;  2HHH O;  2IBZ H;  4J11 A;  2QTO A;  2PZS A;  5IT9 N;  4LBE C;  1Y4M A;  4WFG A;  1TUB A;  4PHZ A;  5B1O A;  1IBL O;  2ZT9 B;  2PF4 E;  3CCU V;  1N33 B;  1NQT A;  4UUJ C;  3W7S A;  4NYK A;  2BOC C;  2HP8 A;  5K1X A;  4HZ3 A;  3ZRW A;  2ETN A;  2AXT Z;  2XAH A;  1QVF U;  1AI7 A;  3B4S A;  4JI2 O;  2CAZ C;  2F23 A;  2X6C A;  5LMN O;  5JH7 B;  4JI0 O;  1XMO O;  3RYH B;  4JZ2 A;  5KLV H;  2WLM A;  3SPJ A;  4JI6 O;  5ITZ A;  1Z2G A;  2XAS A;  4I9Q A;  4I5S A;  1HNZ O;  1URF A;  4K0K O;  2G38 A;  2HVJ C;  1O9G A;  1TVK A;  1DF5 A;  2QKC A;  4UXN A;  4AHC A;  3W7X A;  1PL0 A;  2AZ0 A;  1F23 A;  2EUL A;  1FFX A;  3M99 B;  4I55 A;  3B40 A;  1XNR B;  1K92 A;  1MOF A;  1K7D A;  1FXK B;  3AG4 C;  4FFB B;  4LF5 B;  4NKG B;  4X9Q A;  1KBH A;  3CRQ A;  2XAG A;  2FL4 A;  1AI6 A;  4X62 B;  5LHH A;  3W7U A;  3DGE A;  2IU0 A;  4A5U B;  1OV9 A;  1N36 O;  1BZK A;  3IC7 A;  1AI5 A;  1BT8 A;  1XNQ B;  3QG5 A;  4DV4 B;  4DV0 B;  3AG2 B;  3RYI A;  1GM8 A;  4DR7 O;  4B7K A;  1Y76 B;  1Q43 A;  4B3S O;  2QDO A;  1VQ4 V;  3OAA G;  2KB1 A;  2WLL B;  3L74 H;  3CWB H;  2EIK C;  3OTF A;  3OT7 A;  1XIL A;  2LGW A;  1ZL8 A;  4LF8 B;  4DR3 B;  2QWN B;  4O2B B;  1I7F A;  2Y4U A;  1H38 A;  3ZRS A;  3K57 A;  2PYL A;  4CC6 A;  2E3C A;  3AK2 A;  3JSN A;  2EJ7 A;  1HNX B;  2A06 H;  2GTS A;  3EVK A;  3H1L H;  3OEE G;  5LP6 C;  4IL6 Z;  1SQP H;  4BW9 A;  4LF5 O;  4ZI7 B;  5H9C A;  4KUM A;  4DV5 O;  3QNE A;  5KUM A;  1RP3 B;  1F4M A;  2Q67 A;  1SES A;  4TV9 A;  4FZ0 A;  3DC6 A;  4J9Y B;  5L3F A;  3RYC B;  2EZP A;  5IJ9 B;  4NXN B;  5KX5 B;  5EIB D;  3GB7 C;  2EIJ B;  4GYC B;  3CCL V;  1HNZ B;  2VWJ A;  3J81 N;  1VF6 A;  1HW7 A;  3W7W A;  4WFB V;  3IFX A;  3HKC A;  3P3P A;  1WB7 A;  3QF7 A;  2CTP A;  2QKS A;  1G8M A;  1XMQ O;  1PM9 A;  5IDJ A;  3K08 A;  1Q81 W;  1AJP A;  5FLX N;  1N4C A;  3BY6 A;  4TUY A;  4N23 A;  4R6Z A;  4LF6 B;  2Y4T A;  3OUS A;  5LA6 B;  2B1G A;  4OXS A;  5KAF Z;  1Q6I A;  3ETE A;  1VQ5 V;  2QA4 V;  2YC0 A;  2DWE C;  4LF7 B;  4X89 A;  4CH3 A;  4F6R A;  1N32 O;  4IHJ B;  3STL C;  4PV1 B;  3ML0 A;  4DUZ O;  2YID A;  4O4I A;  1VQK V;  1KP3 A;  1TGO A;  2JGD A;  4LWS A;  3UM7 A;  2HVK C;  1VP7 A;  1NVP D;  2ZNJ A;  1WN7 A;  4MVZ A;  3VQY A;  5B1A C;  2UXN A;  1THZ A;  4GX1 A;  4P9P A;  4ASU G;  3ZMV A;  4Z1V A;  4FLV A;  1XNQ O;  1XMQ B;  3FB5 C;  4MW8 A;  1SZT A;  4TQD A;  3ABK C;  1FFX B;  1K97 A;  3K0D A;  1I08 A;  3JAW A;  1G6U A;  4E4E A;  4UFZ A;  2OT5 A;  3B77 A;  5BXZ A;  2ZE7 A;  3RYI B;  5KAI Z;  1JVM A;  2NNU A;  2RCV A;  3GVM A;  4DUY B;  3BAB A;  4XDL A;  4DR5 O;  1P49 A;  1M4U A;  4BIZ A;  3P30 A;  2GDS A;  2HEP A;  3JAT A;  1X4T A;  3CPW U;  4U3J A;  4X64 O;  3FB8 C;  4B3R O;  5EBL C;  4IYH A;  4JYB A;  1Z5W A;  5GTI Z;  4QGP A;  2F43 G;  4O4J A;  5JH7 A;  1Q90 D;  4UB6 Z;  1UFI A;  5JCO A;  3ETD A;  3J80 N;  1IBK B;  2CTW A;  3GWK C;  1K5S A;  3NR7 A;  3LSS A;  2ITD C;  3L9D A;  4FFK A;  4FM2 A;  3ZJZ A;  3MDS A;  3E8F A;  2P4V A;  3CXH F;  1SET A;  1XOU A;  2CDY A;  4I50 A;  2FML A;  4BIU A;  4MVM A;  1MNG A;  1KD1 W;  2VQE O;  1SER A;  1D5A A;  4DO2 A;  4DR4 B;  1RM1 C;  2PY5 A;  3K79 A;  5LGT A;  4H33 A;  4JYC A;  5CMU A;  3H1H H;  3WG7 C;  4DV4 O;  3UT5 B;  3SPC A;  3EHB B;  3OE7 G;  4I9W A;  2JGD B;  4LWS B;  1AVM A;  3H1I H;  2FYU H;  3JSL A;  4BW5 A;  1OZ0 A;  4I7Z B;  1KC8 W;  3CRR A;  2HG5 C;  2DW4 A;  1GM9 A;  3W7T A;  4KL1 A;  1I0H A;  5IYZ A;  4C7U A;  4DV6 B;  2AHZ A;  4QJF B;  2WPD G;  1FJG B;  4MVR A;  3TCU A;  2JK5 C;  1P7B A;  1TAE A;  3G6E V;  1H2M A;  3P32 A;  2DQ0 A;  4FLW A;  3A8T A;  1B06 A;  3SYQ A;  5B1A B;  3K5N A;  5H2F Z;  2HJD A;  3T4Z A;  4B3M O;  3JD4 A;  3N2K B;  5KHK A;  1HDJ A;  4XDJ A;  2LFS A;  1JMK C;  4MTF A;  4GKK O;  3K9S A;  1KKD A;  3F7V C;  2LW7 A;  2YI8 A;  2EIK B;  4U3J B;  3AG3 B;  2VQE B;  3AG3 C;  3WB1 A;  4DR1 O;  3FKS G;  1AP5 A;  4WFA V;  2B5U A;  3RVY A;  4NB5 A;  3H1K H;  2OCC C;  3K5L A;  1MSD A;  5IJ0 A;  5DEC A;  3RGB A;  1VF5 B;  2QTS A;  2W6I G;  4NR1 A;  5EBW C;  1L1F A;  1ZL8 B;  4FLT A;  3G71 V;  2BTO A;  4PI0 A;  1BQ0 A;  2YIA A;  1E1Q G;  4JI3 B;  4BIO A;  1GN3 A;  2V4D A;  2CGO A;  4O4L A;  3S3X A;  1PKX A;  2QJ1 A;  1L8D A;  1PV0 A;  3AG1 C;  4O2A A;  1WA8 A;  2Q4P A;  1KKC A;  4PEL A;  4MVS A;  2RNB A;  3K04 A;  1LR1 A;  1YTF D;  1XL6 A;  3K9A A;  4O4I B;  3ZBH A;  3K59 A;  2Q8V A;  4MTG A;  3AG7 A;  5LYJ A;  3THO A;  2V7Q G;  3UKM A;  1ZAU A;  1QQC A;  4U3F H;  2QR4 A;  2ZCE A;  1GKF A;  2Y0P A;  1N34 O;  2JS3 A;  2Q6A A;  2XAF A;  3L70 H;  2Q73 A;  2E5L O;  2EIL B;  3AG2 C;  5D5P A;  1PD3 A;  4R50 A;  1WNS A;  1JX9 A;  3HKD B;  2R9I A;  3K5M A;  4ZIB A;  3L73 H;  2X0L A;  5CA0 B;  5L3C A;  4DUZ B;  1VQP V;  1JFF B;  2HFE C;  3E8G A;  1N34 B;  5JVD B;  2YXL A;  2DWD C;  1QR8 A;  2B9Z A;  4YIO A;  5B3S C;  3ZN0 A;  4DW0 A;  3IGA C;  3E22 A;  4NXM B;  2UUC O;  3ABL C;  3WB0 A;  5EC1 C;  1FJG O;  2JDI G;  4DV3 O;  1EN4 A;  1F4N A;  1V55 C;  3H9V A;  5CN0 A;  1M57 B;  3BFR A;  1SA0 A;  2GV9 A;  1QR9 A;  4PA4 A;  1HNW B;  4U7O A;  3RN4 A;  3HB3 B;  1MG1 A;  1N36 B;  4YIP A;  2RDC A;  3AG4 B;  5AG2 A;  2ADP A;  3LNN A;  1KU9 A;  2IW5 A;  4X62 O;  2UXD B;  4JI7 B;  1OHH G;  1OCC C;  4RQE A;  4DV1 B;  2AZ2 A;  4TUY B;  2LW1 A;  5LXT A;  2HLD G;  2RN9 A;  2A3Q A;  2Q69 A;  4JI8 O;  1R6N A;  3LNM B;  2OYQ A;  1OCC B;  1ZWI C;  4X1Y A;  1LUV A;  3G67 A;  2BOB C;  4WF9 V;  4BAY A;  4HBN A;  3H01 A;  1P84 F;  4NTX A;  4X20 B;  5EIB C;  3UT5 A;  2UU9 B;  5LMU B;  3CC7 V;  2YIB A;  3N2G B;  3LDD A;  5EZY B;  2JRI A;  5J9P C;  1AR5 A;  4O4J B;  1SS3 A;  4JZG A;  2X6A A;  3JAK B;  4KP4 A;  2BTQ A;  1HR0 B;  4MSW C;  1NTZ H;  4PA7 A;  1G4Y B;  1IVS A;  1QCE A;  5HFM A;  1XBL A;  2JIZ G;  1XRE A;  5JJE B;  4GX0 A;  1YJN V;  4CH4 A;  5LL6 Y;  1W0K G;  4JI7 O;  1ENV A;  3SJA C;  3CJH A;  1M56 B;  3HKE B;  2PI4 A;  2F93 B;  3RBZ A;  3ETQ A;  5J2T B;  4K0K B;  1YCI A;  4X1K B;  1H8E G;  5KUK A;  3ZN1 A;  4LFC O;  5BR8 B;  4LH6 A;  2Q9L A;  2M7W A;  4O2A B;  1I5Y A;  1BE3 H;  5KHG A;  3F7Y C;  2L6L A;  3L75 H;  3QO7 A;  3KDR A;  1VF7 A;  5GON B;  2JS5 A;  1SC5 B;  3ASO B;  3U11 A;  2YEV A;  1N33 O;  2P22 C;  3HKD A;  4HAM A;  4LFB O;  4CS3 A;  2ARH A;  3PN1 A;  2ZM6 B;  1XI1 A;  2DYR B;  4U7N A;  3CRA A;  2UUB B;  2VWK A;  4IYI A;  2D2C B;  1S76 D;  1KYO F;  1FXV A;  5KMG B;  1FXK C;  4WFE A;  1HNX O;  1M57 C;  2OWO A;  1FXH A;  4Q20 A;  4TV8 A;  4JTA B;  4WFH A;  4UCO A;  2KQX A;  5E79 Z;  2QWQ B;  1SA0 B;  4PJ0 Z;  4L87 A;  4CS4 A;  5IY5 C;  2ZNI A;  4FLY A;  2UUB O;  1H2K A;  1WJZ A;  4DXW A;  1Y74 A;  3T1C A;  5EYP A;  1H2N A;  2Z0A A;  2A79 B;  3RYF A;  1FS0 G;  3E86 A;  1IZ3 A;  2DYR C;  2XHB A;  5L3D A;  1JJO A;  1WP7 A;  1YEW A;  1TUE B;  3I55 V;  1B6Q A;  1R3J C;  5F2V O;  1ROP A;  1YVW A;  2YIB D;  1DGS A;  2WLJ A;  4JTC B;  2YDE A;  2YS8 A;  3U10 A;  3LSU A;  4JYA B;  4JV5 B;  2N05 A;  3MHS C;  3ASO C;  3SPH A;  1VQN V;  4GCZ A;  3VBB A;  1VQ6 V;  5BY1 A;  2QKA A;  3S3W A;  2UXX A;  1SZX A;  4G2K A;  1N32 B;  3N2K A;  4JI3 O;  4DV3 B;  1V54 C;  1WLE A;  2BTQ B;  3SYA A;  5IJ9 A;  1PNM A;  3ABT A;  3ZHV A;  2OIE A;  4QE7 A;  1S5L Z;  1QU7 A;  1DK1 A;  2IJJ A;  5J2U A;  1Y67 A;  3MD0 A;  5BZB A;  1EN5 A;  3CYO A;  5B66 Z;  1BSM A;  3ZMT A;  2P90 A;  5CA1 B;  4UV9 A;  1XHZ A;  1IXM A;  2CK3 G;  1N0N A;  1Y66 A;  1S3J A;  4MW3 A;  3JAL A;  4RWU A;  4DV6 O;  2ZQM A;  1IDS A;  1YI2 V;  2Q0O C;  2EIN C;  4J7J A;  3TK1 A;  4UCR A;  1VQO V;  3ABU A;  3I5D A;  3E22 B;  3CRM A;  1WA8 B;  4X1K A;  1Y76 A;  4ICG A;  3AEI A;  5LHI A;  2EIJ C;  1NH2 D;  4X65 B;  5LGN A;  1UPG A;  1YDX A;  3AK1 A;  4NVP A;  2P5O A;  2A7W A;  1S77 D;  1HNW O;  2ZD9 A;  2H3O A;  5L3G A;  3FAV B;  3UQ8 A;  4YHH O;  3VOU A;  3OFN G;  4CH6 A;  4IHJ A;  3APO A;  4AIL C;  5LBQ A;  4X88 A;  3ZRX A;  2B1I A;  4EB6 B;  1XMO B;  3DC5 A;  4JI0 B;  4LF7 O;  3VQW A;  1IBK O;  1ZTE A;  1SKV A;  2QWO B;  2FKX A;  5KHJ A;  4JYY A;  2D3O W;  1IBL B;  5EYP B;  3IAY A;  2IJI A;  3HR0 A;  2DOS A;  2Q7G A;  5LMU O;  1U97 A;  4UVA A;  3HKB B;  4F6R B;  1K9M W;  1XQ8 A;  4YJ3 B; 
#chains in the Genus database with same CATH homology
 1BS3 A;  1MMM A;  1WB7 A;  3KDR A;  3KKY A;  3BFR A;  1MSD A;  2CE4 A;  1AR4 A;  2QKC A;  1GN6 A;  1PM9 A;  3RN4 A;  1JA8 A;  1IXB A;  1VEW A;  4YIP A;  5AG2 A;  1ZLZ A;  2ADP A;  1Y67 A;  4FFK A;  1EM1 A;  1EN5 A;  1D5N A;  4X9Q A;  1GN3 A;  3MDS A;  1BSM A;  1GN2 A;  2CDY A;  1MNG A;  5A9G A;  1N0N A;  1VAR A;  3C3S A;  1AP5 A;  1IDS A;  1BT8 A;  1JR9 A;  1LUV A;  3QVN A;  1IX9 A;  1KKC A;  1ZSP A;  1PL4 A;  1AVM A;  1XUQ A;  3TJT A;  3AK1 A;  2ADQ B;  3OT7 A;  1XIL A;  4BR6 A;  1AR5 A;  1WB8 A;  4JZG A;  1I0H A;  3AK2 A;  4C7U A;  1MA1 A;  1ZUQ A;  3C3T A;  3EVK A;  3CEI A;  1XRE A;  3IC9 A;  1LUW A;  2P4K A;  1XDC A;  1I08 A;  1AP6 A;  1EN6 A;  1GN4 A;  4E4E A;  1N0J A;  1B06 A;  3AK3 A;  3DC5 A;  3DC6 A;  1ZTE A;  4YIO A;  2RCV A;  4F6E A;  4JYY A;  4GUN A;  3K9S A;  3LSU A;  2GDS A;  2AW9 A;  2QKA A;  1QNM A;  1SZX A;  1P7G A;  1EN4 A;  4JZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...