1AP5A

Tyr34->phe mutant of human mitochondrial manganese superoxide dismutase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Crystal structure of Y34F mutant human mitochondrial manganese superoxide dismutase and the functional role of tyrosine 34.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 66
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ap5A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ap5A02
2AW9A 1MMMA 1EM1A 3CEIA 1AP6A 1JR9A 2CDYA 1MA1A 1XUQA 2ADPA 1ZUQA 1B06A 4JYYA 3C3TA 3K9SA 1IDSA 1GN2A 1I08A 3AK2A 1WB8A 5AG2A 1EN6A 2ADQB 3C3SA 3EVKA 1N0JA 4BR6A 1AR4A 5A9GA 1MNGA 1XILA 4YIPA 1Y67A 1N0NA 3MDSA 4YIOA 1EN4A 3LSUA 3AK3A 1PM9A 1AP5A 4X9QA 3TJTA 4GUNA 1P7GA 3IC9A 3QVNA 1D5NA 2QKAA 1ZSPA 1XREA 1EN5A 1AVMA 1BT8A 1BSMA 1I0HA 1IX9A 1BS3A 4F6EA 4C7UA 1AR5A 4JZGA 1GN4A 1VARA 1WB7A 1KKCA 2GDSA 1LUWA 3DC5A 1MSDA 2CE4A 1XDCA 1PL4A 1JA8A 4JZ2A 1IXBA 3RN4A 2P4KA 3BFRA 1GN6A 1LUVA 1QNMA 3KKYA 3DC6A 1SZXA 3OT7A 1VEWA 1GN3A 1ZLZA 2RCVA 1ZTEA 2QKCA 4FFKA 4E4EA 3AK1A
chains in the Genus database with same CATH superfamily
4D7TA 1YI2V 2A0LA 4ASUG 1JX9A 4J7JA 2E5LO 1K4CC 1R6NA 3ZMZA 2GBOA 2HVKC 1M90W 1AJPA 4LNUA 2PI4A 3FB8C 3WB2A 1L8DA 2EILB 4O2BA 3MAQA 2ZXWC 4Q20A 1XQ8A 3T4ZA 1UPGA 5GONA 4X1KA 4B3SO 2OWOA 1SQBH 1R6TA 1N0NA 5FL7G 4GKKO 1TUBA 2R9AA 3FB5C 4YHHO 4EFBA 3SPHA 5LP6C 4Z1VA 3ABUA 1K73W 3AEIA 3I55V 1FFXB 1G6UA 5LHHA 4X62B 4DRXB 4X20B 4PHZA 4B3RO 3U0ZA 4X66O 2UXDB 2F4VB 2QE7G 1JFFA 3BA8A 1X59A 3CCMV 1VARA 5CA3A 1I7FA 2HFEC 1KKCA 4R6ZA 3Q4HB 3R66A 4Z1MG 1QU7A 4X88A 1G1XB 1K4DC 2ARHA 1E1QG 1YTFB 4QIWF 1DTOA 5JQGA 1KECA 2PUSA 1FFTB 5B1BC 5LOVA 1R3LC 2X7RB 4DK1A 2PGGA 3MHSC 1PPJH 5JCOA 3ZRXA 3SYOA 2LW1A 4DR3B 1IBMO 1VQ7V 2FMLA 4FK5C 4I0XB 1AP6A 2QWNB 4JASA 2CDYA 2RMKB 1CPYA 1ZUQA 3BY6A 3RYIA 4FFBA 4QE7A 5KHIA 4UB8Z 2HLDG 5H5NA 4ZI7B 2JS5A 5JVDA 5HFLA 2K9PA 2XAQA 1Z5WA 3OTOB 3IAYA 2QR4A 5AG2A 4UUJC 1OCOC 1KC8W 3L9DA 4QNHB 4BWAA 1WA8A 4JTCB 2RN9A 3H1IH 3J81N 2D3OW 1H38A 3AG3C 4O4JB 2ZNJA 5CN0A 1OCRB 3ZIAG 1ORQC 4DR5O 3ZMSA 2WLIA 3CJHA 2IU0A 4JYCA 1KQSU 4DR1B 1QVGU 2EJ7A 4LFBB 3HKBB 1NTMH 3W7UA 1ZSPA 2ZM6O 2XOKG 1AROP 3JASA 2E74B 4DV4O 2UU9B 2PYLA 5LMUB 1HP8A 2YIAA 3ZHSA 4HAMA 2QM7A 2Q7GA 3ABKB 3UM7A 1JA8A 2OIEA 1FJGB 5B3SB 3K3WA 2WSSG 1I94B 4JI4B 2VS0A 1UFIA 3RVZA 5IE9A 3ZN1A 1SZXA 2V4DA 2HR3A 4BIOA 1MZFA 3STLC 4LFCO 3RYCB 4EB6A 2CTPA 4DV0B 3AG4B 5CBHA 3CCJV 3J80N 2PI5A 3A0HZ 2EIKC 1YJWV 3KG2A 4LH6A 4PA3A 2D2CB 2ITDC 5H6RA 3LDCA 1RM1B 1FYJA 4RUEA 4LF5O 4O4IA 1IURA 1U97A 2ZINA 1P4RA 4JI6O 1HNWB 1K3EA 2BSKA 2C2AA 3AG2C 4DV2O 2F93B 4B08A 5LP6A 5J2TB 3ZMVA 2ZE6A 2EIMC 2QKSA 4DV3B 1U96A 2QJ1A 2FL4A 4ZIBA 1P49A 2PY5A 4JAAA 3H1JH 2M6YA 4DR4B 3E8BA 4O4LA 5IJ0B 2B5UA 2OCCB 4JI8B 4PA6A 3VQVA 2A06H 4JYBA 2YIDA 3RVYA 1EN4A 1FOUA 4G2KA 1PM9A 5LGUA 4X89A 1EBOA 4QGPA 4P9OA 3C90A 3EXAA 3CC2V 3ML0A 4UVAA 4L87A 1M57C 1KYOF 1M9NA 1QHTA 3IGAC 2KQXA 1AI4A 4JTAB 2CE4A 4TWKA 1XNQB 3SGIA 2YXLA 4WFHA 5EC1C 3BFRA 2KG7A 1FXHA 1SESA 4LF6B 4I4TA 3AG1B 2O57A 1XEQA 3A0BZ 1Y66A 4MVZA 3X2QB 1T5EA 2JGDA 1ZTEA 1MOFA 1NR7A 3IFXA 1XNRO 5IYDO 3HR0A 4NB5A 3L73H 1IBKO 4I50A 1DLBA 3N2KB 4W4LA 1BZKA 1WJZA 2R9IA 3OUSA 1WPXA 5B1AC 3VBBA 2VQFO 2UXCO 4ZOLB 4FM1A 1FKAO 2DMXA 5KHHA 3G6EV 1IDSA 4UCTA 1VQLV 1H8HG 2Q0AA 5BR8B 5KHJA 3PJSK 3K08A 2DJVA 3W7XA 4HZ3A 2Q68A 1NVPB 1HR0O 4JTDB 1H2SB 5IWAO 2WLNA 3W7WA 3HKEB 4JI7O 5BZBA 2UUAB 3JYCA 2IBZH 2H3OA 2QWQB 2Q9LA 4X9QA 4IT5A 4GZRB 1FD9A 1V54B 2NR5A 4FJCC 5TISZ 1YF2A 1PL0A 1EZVH 4IYHA 1SQXH 2VWKA 2BOBC 3GWKC 1R3IC 3ZHVA 3P30A 3ZHTA 1HNZB 1PP9H 2F1MA 1WNSA 2EILC 2KB1A 1SERA 4N23A 1VEWA 4DR6B 4UCUA 3DTUB 4UCRA 1F7YA 2UUBB 2Y69C 4TQFA 1XOUA 3NR7A 5B5EZ 1F51A 2VQEO 2UUCO 4LF4B 3AK1A 2PF4E 3UO2A 3BRCA 4FIPC 3EFFK 2YS8A 2EIJB 2ETNA 2BTOA 3KCYA 2YI8A 4UCSA 4FLTA 1N36B 5EBMC 5L3EA 1M5IA 4MT8A 4LF8O 3OEEG 4KHPO 2GTAA 1NJIW 2Y4TA 5KMGA 2XNDG 4LFAO 2YIBA 1WB8A 2L35A 1S77D 2ADQB 3ZRWA 4O2AB 2Y4UA 2Q6AA 3UCSC 4J41A 4JI1B 5LXTA 4UFZA 5LBQA 1B3QA 1VQ9V 1K9MW 3B2EE 1YIJV 2DW4A 2JEUA 3W7TA 4JI2O 3JAKA 4EKWA 3JD1A 4FLUA 1FXKC 4X65B 2JVDA 4X1YB 2OYQA 3TJTA 4H33A 5LGTA 3HKDA 1N34O 4DV6B 4J7ZA 4BW9A 2XTAA 5DM6V 5JH7A 2ZCEA 3E89A 2DYSB 5C93A 1Q86W 2CGNA 4B3MO 2IU3A 1AR5A 5D5QA 1YEWA 1GM7A 1LUWA 4OX9B 1KUQA 4WBNB 4X64O 3CCRV 4AILC 3ZEDA 1P84F 5LYJA 4QPKA 5H9CA 5FNVA 2E75B 4D7SA 1N4CA 2IH1C 1NQTA 2Z5UA 1K7DA 1NBMG 3KKYA 4RQFA 1Q82W 2DE0X 4DW0A 1BE3H 3RYHA 2DWEC 3ZMTA 3HB3B 1TVKB 2ZDIC 3E22A 1FPOA 4WF9V 3D8CA 1PNLA 3LNNA 3KDRA 5LMNB 1M4UA 4MVMA 2WLLB 4IYIA 1OCRC 4U3JB 4CS3A 4FZ0A 2WLMA 1FS0G 3IC7A 3RW0A 5EZYB 3FYEB 4ZHQA 3DGEA 1OCZC 2Z0AA 5K1PA 3B40A 1VQMV 3ZMUA 4PELA 3SPCA 3P32A 1GK9A 2BE3A 1GRJA 5IYBO 4AQYB 2JJ1G 4DV5B 3ETDA 1J95A 1M93A 4R7CA 2DQ3A 4GT1A 2QGNA 2ZR2A 3ABKC 3G4SV 5B3SC 2HVJC 3ASOB 4GX0A 1XMOO 2CUGA 3CCSV 1R3JC 2IJKA 1Y74A 1AI6A 4R50A 1NZ6A 4PV1B 3ABLB 4PA7A 2RJZA 2W0XA 5EBWC 2WLKA 2Y0IA 3SYPA 2NLJC 4ABMA 3PN1A 4FM0A 4IHJB 1MSWD 3F5TA 2OTJV 2YEVA 2IJHA 3OM3B 1XREA 3ETQA 2GV9A 3B09A 2E5LB 3F7VC 2ZIMA 3K5NA 1RM1C 3CD6V 4PI0A 4F6EA 4C7UA 3STZC 1GM9A 3GVMA 2GDSA 3K03A 4LNUB 1ZX3A 2XAFA 2UXXA 1NI8A 1FFXA 2F23A 1DF4A 2R9RB 4DK0A 1I5YA 4GLXA 4CC5A 3N27A 1RSOB 4DRXA 5BMVB 4X20A 3ICXA 4CH6A 3T4DA 2P6JA 3BAAA 3ZCCA 1VQ6V 1JMKC 4GKKB 4UB6Z 4YHHB 3L72H 3BEHA 1KD1W 2OCCC 1ZL8B 1SC5B 4KXRA 1FXVA 4YJ2B 4IGGA 3MD0A 2GSMB 4JI5O 1QLEC 4XBFA 3SPIA 1VMGA 4X66B 5EK0A 1ZWIC 4U3FH 3QO8A 4JYYA 1VF6C 1N33O 3C3TA 3KCXA 3QO7A 3SPJA 4O4HB 1Q90D 4EEQA 5ITZB 1FXKA 4F6RB 1D5AA 4TV9A 1Q8IA 1H2KA 3D3IA 1EN6A 2P67A 2QWRB 3T1HB 1S72V 5DEDA 3CRMA 5LOVB 2RQ6A 1JQ0A 1BQZA 3B4SA 4WFEA 3AG1C 5CBGA 4DUYB 4J11A 1JPXA 1NKDA 3L75H 4ZI7A 3CC4V 4YIOA 3U11A 1PKXA 2XUMA 3SJAC 1VF7A 3JSNA 1IBMB 1K8AW 2EX3A 4GYCB 2WA3A 2CGOA 5LHGA 4PD4F 2XAHA 2WLHA 2ZDIA 1BSMA 3FD9A 4J10A 4FFBB 2WWWA 1BQ0A 1GH6A 2Y48A 3JAWB 3E8FA 4GKJO 1YITV 4AI8A 2P4KA 3UO3A 1QCEA 1WPBA 5KAFZ 1YDXA 2BCCH 1L1FA 4DR1O 3BHPA 3HKBA 3FAVB 1OCCB 1SQQH 4PA4A 1RP3B 3CRCA 4NTXA 4RO2A 3E8GA 3OW2U 2N04A 2GUZB 4DR5B 1V55B 3A2FA 4E4EA 1THZA 3E86A 5IY5B 4MVQA 2DQ0A 3RGBA 2Q7EA 2IW5A 4ZKIA 5IYZA 1N32B 5CMUA 3BABA 1I94O 4JI4O 4OGQB 2ZM6B 4Z2WA 2JS3A 2QTSA 5JWPA 2B9ZA 4DV4B 2BTQA 1M56B 4CBCA 1GN2A 3RYCA 5IYCO 4DV0O 3AK2A 3VOUA 3ZHQA 1RPOA 3OR6C 1AJQA 2ZD9A 3C3SA 4K0KO 2LGWA 2YXHA 4GCZA 2EINB 1OV9A 2AZ0A 3L71H 1BHAA 3WU2Z 4UVCA 1HNWO 2LGQA 4D6TH 3JSLA 1H5WA 4JYAO 2H94A 4LFCB 1YVWA 4EB6B 4NTWA 2P90A 5EIBC 5J2TA 4IL6Z 1Z5VA 1S3JA 1DGSA 1SS3A 3MHHC 1AI5A 2ATKC 3O9OA 5CA0B 2F95B 4DR4O 4O4IB 1J5EB 2NNUA 4LF5B 4OPHA 3H01A 3G80A 4JI6B 2BSKB 1BT8A 2EIJC 4LC1A 4OXSA 5IJ0A 1MZEA 1GN4A 4DV2B 3CCQV 4FLZA 3T1CA 3OMNB 5H2FZ 5IDJA 1TA8A 3T1YO 1R73A 2XAGA 1YJ9V 3ZBHA 4MVUA 1SETA 4GX2A 4DV1O 2V7QG 3DC6A 2F43G 2DYRB 1VF6A 5KX5B 5L3GA 4DR2B 2OCHA 1CEZA 5J9PC 4JV5O 3CYOA 1NH2D 2QA4V 4JAVA 2B1GA 4G27B 1Q5OA 4PA9A 5B1BB 2EBOA 2WLJA 3JARB 1MMMA 5LL6Y 3THOA 4MVRA 4RAIA 2YICA 1XUQA 3B77A 4CH4A 5CA1B 1NU1H 4DUZB 5B1NA 4NXNB 3ABMB 4J9YB 1E1RG 4RUFA 2ZE8A 5EYPB 3LDEA 4JGSA 3CMAV 3N2KA 1N0JA 4MTXA 1YHQV 3K79A 1BMFG 3M99B 5A9GA 4ZOLA 3BVOA 2YC0A 3ETGA 4KFMA 2X6CA 3CCVV 1DF5A 1XNRB 3N2GA 4OPAA 1SKVA 1IBKB 3JD4A 1M1KW 1BGYH 3E2EA 4HYOA 3K5MA 2OTLV 4J7KA 3DXRB 3CXHF 1IXMA 2VQFB 2UXCB 3G6BA 1IBLO 3K04A 2B1IA 4MW8A 3BA9A 1F4MA 3FFQA 1MSDA 2E76B 4P2ZA 1AR1B 1XDCA 5FLXN 3HKEA 4H0LB 3JALB 5EBLC 4X8AA 1HNXO 4JF3A 3CHXA 5CB4B 1GN6A 1TUEB 3JAMN 4TV8B 4LF7O 4P30A 3SPGA 4YJ3A 2HHHO 3F7YC 3ASOC 3L70H 3JATB 3RYFB 5KLVH 1PV0A 4JI0O 1JVMA 1WAZA 3CE2A 4BIZA 3UT5B 5IWAB 3ZJZA 2QKCA 4JPRA 4JI7B 1HW7A 4DW1A 1XMQO 4MTGA 3ABLC 1ENVA 4CH5A 2VWJA 1KP2A 2AHZA 1AB3A 4TUYB 4UXNA 3H9VA 1HNZO 1LNQA 4E2LA 1AILA 1HWYA 1GM8A 2Q0OC 4IIJB 2VRZA 2UUBO 4PI2A 1SA0A 4MVSA 2UXBO 2CTQA 3HKCA 1ZAUA 5L3BA 4WFBV 4U7OA 3K57A 1B04A 1NS1A 2DOSA 1GMGA 4B3TO 4YXWG 3CB2A 1KB9F 4LF9O 3VQWA 1NTZH 2EIMB 3MDSA 3TK1A 2RNBA 4MS2A 2RDCA 1JJOA 2A9HA 3LSUA 2UUCB 4H44B 4GUNA 2XT9A 1F4NA 2CH7B 1IZ3A 4O2AA 4NXMB 2FB5A 3HPLC 1BCCH 2Q73A 2XHBA 4JI1O 2L6LA 5C8YB 4DV7O 5IT9N 4LF8B 1BS3A 3K5OA 4KHPB 2GTSA 2F66C 1PNMA 4LCUC 2YI9A 4LFAB 2IM9A 4X1YA 3FYIB 2Q67A 2V1DA 2HEPA 3FX7A 4FLXA 3RBZA 3OTFA 5KHKA 5IJ9B 2G38A 4KL1A 3EHBB 1H2GA 1K33A 4TSFG 4OX9O 3E83A 3LSSA 4DR7O 3JAKB 3CXCU 5J2UB 4I55A 1KP3A 4PDRA 4CS2A 2YIBD 1N34B 3K9AA 4WFAV 4NR1A 1EM1A 5KUKA 1A32A 3QNEA 3SDLA 5B1OA 2WAMA 1YSCA 1TVKA 2AHYA 1VP7A 4X64B 1H8EG 1VQPV 2WLLA 2FYUH 4U3JA 3TCUA 2H8PC 5EZYA 1Y76B 2JDIG 3U10A 3ZN0A 1VQ5V 3H1LH 4P9PA 1MG1A 3CC7V 1GTOA 3LNMB 4NYKA 3RYHB 2FTKA 1OCCC 4YY3O 1XILA 1K92A 4JI3B 4LWSB 5GTIZ 3CRQA 5LA6B 2ODMA 1V55C 3JD3A 3IJ4A 2LJ2A 4TQDA 5IY5C 2QKAA 3G67A 4FLWA 1VQOV 3D36C 2QWPB 4NKGB 5L3FA 4X1IB 3K59A 4J9ZB 4CZZA 1CXZB 3DC5A 3S3XA 4HNAB 2AZ2A 4J42A 3RN4A 1LUVA 3CSXA 1QNMA 3AG4C 1XMOB 2HP8A 1SQGA 4IHJA 1H2MA 4WCEV 3QO5A 1AI7A 1Y74B 4UCOA 4MVOA 4QPJA 1BL8A 2ILMA 1GN3A 2EINC 4MW3A 4L8JA 3K0DA 3K5LA 1GAXA 3JCUZ 2CK3G 4FFKA 3DSQA 5FPOA 1Q6IA 4O2BB 2Y0PA 1I5XA 2Q8VA 2YEVB 4X62O 5GONB 4X1KB 1RSOA 4B3SB 1MA1A 5BMVA 2Y69B 4K3AA 3WG7B 1W0KG 2UXDO 2F4VO 3QG5A 2K1EA 4NTYA 1Q3EA 3FB7C 5FPRA 1QR9A 1TUBB 2P4VA 3OFNG 5JJNB 1ZL8A 2ZE5A 3Q4HA 3M7MX 3CS5A 1EZJA 3LDDA 1VQKV 4YJ2A 2OIGA 4KUMA 5LGNA 4B3RB 3B8NA 1JFFB 5KAIZ 4WFFA 3SJCC 2LW7A 2DYRC 3ZHUA 1CP9A 3P3NA 2MK3A 4O4HA 1QLNA 5ITZA 1N8RW 4F6RA 2Q5ZA 3CP1A 2HG5C 4RWUA 2AGAA 2LO1A 3A0RA 2PYJA 3T1HO 4DO2A 4BAYA 4JI5B 3IC9A 5JQGB 4DR3O 3QVNA 5L3CA 2E3CA 1XHZA 4I0XA 2YSUB 1B6QA 3QF7A 1RPRA 2LFRA 4JZGA 4DUYO 1N33B 1TAEA 1WB7A 2IJIA 1FXKB 4UVBA 4MTFA 5E79Z 4TV9B 3SYQA 3X2QC 3J7AU 2Z3YA 3OTOO 2P5OA 3ABMC 3CWBH 1GKFA 2YUAA 2A3QA 4FLYA 1K5SA 4DXWA 2ZQMA 1XL4A 1YTFD 3OMAB 3M8AA 1HDJA 4PDMA 3OT7A 3RYIB 1QQCA 4O4JA 2QSAA 1AJNA 3GWOA 2HKOA 3JAWA 1K5QA 1ROPA 4H37A 5JVDB 1SQPH 4CC6A 1URFA 4I5SA 4LH7A 1QR8A 2Q7HA 4NVPA 3CCUV 1UJWB 2QDOA 4LP8A 2ZIOA 4RQEA 3H1HH 1Q6HA 1WA8B 4LFBO 1SQFA 3FAVA 3H1KH 2GHYA 2ADPA 2UU9O 2WA4A 5GW7A 5LMUO 3ASNB 4EFEA 2LFSA 4GKJB 5F2VO 2GUZA 1FJGO 3OR7C 2WLIB 4I9WA 3CJHB 1Y4MA 1OCZB 2HJFC 1N32O 3D36A 4AHCA 1R3KC 1R1BA 3B8MA 1V54C 2DN9A 2QTOA 3UKMA 1P7BA 3JASB 4MSWC 1Y67A 3SJQC 1S5HC 3LSQA 5KA6A 5IYZB 3E8HA 1F23A 5D5PA 4DYLA 1VQ8V 2XAJA 2JRIA 1BHBA 2BTQB 1FAFA 3FKSG 4K35A 5GTHZ 5L3DA 2JGUA 1Z2GA 1PL4A 3BPZA 1O9GA 4FMTA 1KBHA 4DV3O 2ZXWB 4FVMA 4K0KB 2QM8A 3K58A 5CA0A 1J5EO 2M7WA 3BCCH 2ZNIA 2EJRA 4H13B 3TXSA 4XDJA 3QTCA 2N05A 3JCZA 4JYAB 4JI8O 1X4TA 5LP6B 1NH2B 2MW2B 4K8XA 3K06A 4K8ZA 2ZE7A 2CTRA 4Q6GA 1KMIZ 2IJJA 3WFVA 1JJ2U 5E1AC 5KX5A 4O4LB 3KZIZ 4R8CA 4DR2O 5BY1A 4LBEC 1XNQO 4J80A 3L74H 1SZTA 1PD3A 2P7TC 1QLEB 3GB7C 1YZBA 3T1YB 1S0VA 4XDKA 2QWOB 3K0GA 1NTKH 3JARA 4WFGA 4LF6O 3OUFA 4DV1B 2YXYA 3JD0A 3CX5F 2UXNA 5CA1A 1KKDA 3CRRA 4DUZO 4W4KA 3WB1A 2A79B 2DYSC 4XDLA 1L0NH 4JV5B 4NXNO 3OAAG 1K34A 2PZSA 1EFRG 2ZKOA 5EYPA 1S5JA 2KG7B 1YCIA 2R70A 4I4TB 2KKWA 3CRAA 3RT3C 4G28B 1EN5A 2LP7A 1AVMA 1G4YB 2IH3C 1OJHA 2JGDB 5CBFA 2Q4PA 1OCOB 4FM2A 1IXBA 4QJFB 5BR8O 4I50B 1LR1A 1JNBA 1L0LH 5KA5A 4CS4A 1JOYA 1W59A 2EULA 3AG3B 2DWDC 2EZOA 3DXRA 1WLEA 3ZRSA 2QEXV 1DK1A 2JJ2G 1ZLZA 5H6QA 3APOA 1SQVH 3E35A 2UUAO 3JALA 3N2GB 3OEHG 5CB4A 3O65A 4TV8A 3CEIA 3ABTA 2X6AA 5JJEB 1IBLB 3JATA 3RYFA 1HR0B 1Q43A 2EZPA 3SYCA 3K9SA 3WB0A 3D3QA 2LQTA 3UT5A 1I08A 1Q6UA 1Y6XA 3NXSA 1E79G 1HNXB 1WP8A 3APQA 3SR2C 1XBLA 2XASA 4TUYA 4A5UB 5K1XA 4LF7B 4PDLA 4YJ3B 1SF9A 2HHHB 1AR4A 4DR6O 1NVPD 4IIJA 4JI0B 4CH3A 1S76D 3CCLV 5EC2C 3OGCC 4TT3G 5A2QN 2EIKB 1XMQB 4FPPA 4LF4O 1S5LZ 3I5DA 4GX1A 1P7GA 4ZBMA 4LR3A 2ITCC 4TOIA 1JCHA 4PJ0Z 3RWRD 3CMEV 3AG2B 1Q81W 1N36O 1IX9A 2W0FC 1SA0B 4U7NA 3S3WA 2UXBB 3WG7C 3HKCB 3LUTB 3OD4A 1XHXA 2VQEB 2YDEA 2QM4A 1O9HA 5KHGA 3A8TA 4N21A 4B3TB 4I9QA 2CH7A 4NXMO 5BXZA 1VQ4V 2ZT9B 2JEXA 2BOCC 3SJBC 4LF9B 1PNKA 3ETEA 1GO3F 4BIUA 5C8YA 2W6JG 3FB6C 1QBZA 4PDVA 1RFYA 5EIBD 3TETA 3I56V 2RCVA 5KMGB 3OMIB 3SYAA 3W7SA 2HJDA 1US6A 4X65O 2R72A 5DECA 4BW5A 2AW9A 3ZRWB 4DV6O 1XL6A 1JR9A 1M57B 1YXBA 5IJ9A 5LXTB 4DV7B 5KUMA 1B06A 2CAZC 2OT5A 3CCEV 1OHHG 1W2BU 3UQ8A 4QE9A 4WBNA 4JI2B 1COWG 5J2UA 4JAUA 2JK5C 2X6BA 1W0JG 3ZRVA 3HKDB 3EVKA 5JCOC 3G71V 4HBNA 3TXQA 5JH7B 1TGOA 3AG7A 1YJNV 4BR6A 2A7WA 3JD2A 1VF5B 3R65A 2P22C 1KU9A 3OE7G 4KP4A 1VQNV 1H2NA 4UCVA 4B3MB 1MNGA 4YIPA 4B7KA 4DR7B 2W6IG 5LHIA 2WPDG 3ZHRA 5LYJB 5LMNO 2P06A 4I55B 3AK3A 5FNVB 3T2MA 1AP5A 3VQYA 3ZX6A 5JJJB 4I7ZB 4UV9A 1IJGA 1NT2B 5B1AB 1Y76A 1D5NA 2N74A 1Q7YW 1R6KA 1I0HA 1D2DA 4JI3O 2AXTZ 1V9PA 1WP7A 2ZR3A 3E22B 4ICGA 4LWSA 5B66Z 5HFMA 3TGUH 3F5WC 1QVFU 4AQYO 4JZ2A 4DV5O 1XI1A 4FLVA 1VIBA 5LA6A 1SRYA 1OZ0A 3ASNC 3VQXA 1WN7A 1G8MA 2Q69A 5DN6G 4UV8A 3OGIB 4ZHQB 4B7EA 1IVSA 4FZ1A 3CPWU 3RFRA 2CTWA 4X1IA 4F4LA 2X0LA 3P3PA 4YY3B 1MABG 1H2LA 2FKXA 2PTMA 3ZS8C 2KSDA 4GX5A 2NN4A 4HNAA 2JIZG 1M56C 4MTOA 1NR1A 1K97A
chains in the Genus database with same CATH topology
2AW9A 1MMMA 1EM1A 3CEIA 1AP6A 1JR9A 2CDYA 1MA1A 1XUQA 2ADPA 1ZUQA 1B06A 4JYYA 3C3TA 3K9SA 1IDSA 1GN2A 1I08A 3AK2A 1WB8A 5AG2A 1EN6A 2ADQB 3C3SA 3EVKA 1N0JA 4BR6A 1AR4A 5A9GA 1MNGA 1XILA 4YIPA 1Y67A 1N0NA 3MDSA 4YIOA 1EN4A 3LSUA 3AK3A 1PM9A 1AP5A 4X9QA 3TJTA 4GUNA 1P7GA 3IC9A 3QVNA 1D5NA 2QKAA 1ZSPA 1XREA 1EN5A 1AVMA 1BT8A 1BSMA 1I0HA 1IX9A 1BS3A 4F6EA 4C7UA 1AR5A 4JZGA 1GN4A 1VARA 1WB7A 1KKCA 2GDSA 1LUWA 3DC5A 1MSDA 2CE4A 1XDCA 1PL4A 1JA8A 4JZ2A 1IXBA 3RN4A 2P4KA 3BFRA 1GN6A 1LUVA 1QNMA 3KKYA 3DC6A 1SZXA 3OT7A 1VEWA 1GN3A 1ZLZA 2RCVA 1ZTEA 2QKCA 3KDRA 4FFKA 4E4EA 3AK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AW9 A;  1MMM A;  1EM1 A;  3CEI A;  1AP6 A;  1JR9 A;  2CDY A;  1MA1 A;  1XUQ A;  2ADP A;  1ZUQ A;  1B06 A;  4JYY A;  3C3T A;  3K9S A;  1IDS A;  1GN2 A;  1I08 A;  3AK2 A;  1WB8 A;  5AG2 A;  1EN6 A;  2ADQ B;  3C3S A;  3EVK A;  1N0J A;  4BR6 A;  1AR4 A;  5A9G A;  1MNG A;  1XIL A;  4YIP A;  1Y67 A;  1N0N A;  3MDS A;  4YIO A;  1EN4 A;  3LSU A;  3AK3 A;  1PM9 A;  1AP5 A;  4X9Q A;  3TJT A;  4GUN A;  1P7G A;  3IC9 A;  3QVN A;  1D5N A;  2QKA A;  1ZSP A;  1XRE A;  1EN5 A;  1AVM A;  1BT8 A;  1BSM A;  1I0H A;  1IX9 A;  1BS3 A;  4F6E A;  4C7U A;  1AR5 A;  4JZG A;  1GN4 A;  1VAR A;  1WB7 A;  1KKC A;  2GDS A;  1LUW A;  3DC5 A;  1MSD A;  2CE4 A;  1XDC A;  1PL4 A;  1JA8 A;  4JZ2 A;  1IXB A;  3RN4 A;  2P4K A;  3BFR A;  1GN6 A;  1LUV A;  1QNM A;  3KKY A;  3DC6 A;  1SZX A;  3OT7 A;  1VEW A;  1GN3 A;  1ZLZ A;  2RCV A;  1ZTE A;  2QKC A;  4FFK A;  4E4E A;  3AK1 A; 
#chains in the Genus database with same CATH topology
 4D7T A;  1YI2 V;  2A0L A;  4ASU G;  1JX9 A;  4J7J A;  2E5L O;  1K4C C;  1R6N A;  3ZMZ A;  2GBO A;  2HVK C;  1M90 W;  1AJP A;  4LNU A;  2PI4 A;  3FB8 C;  3WB2 A;  1L8D A;  2EIL B;  4O2B A;  3MAQ A;  2ZXW C;  4Q20 A;  1XQ8 A;  3T4Z A;  1UPG A;  5GON A;  4X1K A;  4B3S O;  2OWO A;  1SQB H;  1R6T A;  1N0N A;  5FL7 G;  4GKK O;  1TUB A;  2R9A A;  3FB5 C;  4YHH O;  4EFB A;  3SPH A;  5LP6 C;  4Z1V A;  3ABU A;  1K73 W;  3AEI A;  3I55 V;  1FFX B;  1G6U A;  5LHH A;  4X62 B;  4DRX B;  4X20 B;  4PHZ A;  4B3R O;  3U0Z A;  4X66 O;  2UXD B;  2F4V B;  2QE7 G;  1JFF A;  3BA8 A;  1X59 A;  3CCM V;  1VAR A;  5CA3 A;  1I7F A;  2HFE C;  1KKC A;  4R6Z A;  3Q4H B;  3R66 A;  4Z1M G;  1QU7 A;  4X88 A;  1G1X B;  1K4D C;  2ARH A;  1E1Q G;  1YTF B;  4QIW F;  1DTO A;  5JQG A;  1KEC A;  2PUS A;  1FFT B;  5B1B C;  5LOV A;  1R3L C;  2X7R B;  4DK1 A;  2PGG A;  3MHS C;  1PPJ H;  5JCO A;  3ZRX A;  3SYO A;  2LW1 A;  4DR3 B;  1IBM O;  1VQ7 V;  2FML A;  4FK5 C;  4I0X B;  1AP6 A;  2QWN B;  4JAS A;  2CDY A;  2RMK B;  1CPY A;  1ZUQ A;  3BY6 A;  3RYI A;  4FFB A;  4QE7 A;  5KHI A;  4UB8 Z;  2HLD G;  5H5N A;  4ZI7 B;  2JS5 A;  5JVD A;  5HFL A;  2K9P A;  2XAQ A;  1Z5W A;  3OTO B;  3IAY A;  2QR4 A;  5AG2 A;  4UUJ C;  1OCO C;  1KC8 W;  3L9D A;  4QNH B;  4BWA A;  1WA8 A;  4JTC B;  2RN9 A;  3H1I H;  3J81 N;  2D3O W;  1H38 A;  3AG3 C;  4O4J B;  2ZNJ A;  5CN0 A;  1OCR B;  3ZIA G;  1ORQ C;  4DR5 O;  3ZMS A;  2WLI A;  3CJH A;  2IU0 A;  4JYC A;  1KQS U;  4DR1 B;  1QVG U;  2EJ7 A;  4LFB B;  3HKB B;  1NTM H;  3W7U A;  1ZSP A;  2ZM6 O;  2XOK G;  1ARO P;  3JAS A;  2E74 B;  4DV4 O;  2UU9 B;  2PYL A;  5LMU B;  1HP8 A;  2YIA A;  3ZHS A;  4HAM A;  2QM7 A;  2Q7G A;  3ABK B;  3UM7 A;  1JA8 A;  2OIE A;  1FJG B;  5B3S B;  3K3W A;  2WSS G;  1I94 B;  4JI4 B;  2VS0 A;  1UFI A;  3RVZ A;  5IE9 A;  3ZN1 A;  1SZX A;  2V4D A;  2HR3 A;  4BIO A;  1MZF A;  3STL C;  4LFC O;  3RYC B;  4EB6 A;  2CTP A;  4DV0 B;  3AG4 B;  5CBH A;  3CCJ V;  3J80 N;  2PI5 A;  3A0H Z;  2EIK C;  1YJW V;  3KG2 A;  4LH6 A;  4PA3 A;  2D2C B;  2ITD C;  5H6R A;  3LDC A;  1RM1 B;  1FYJ A;  4RUE A;  4LF5 O;  4O4I A;  1IUR A;  1U97 A;  2ZIN A;  1P4R A;  4JI6 O;  1HNW B;  1K3E A;  2BSK A;  2C2A A;  3AG2 C;  4DV2 O;  2F93 B;  4B08 A;  5LP6 A;  5J2T B;  3ZMV A;  2ZE6 A;  2EIM C;  2QKS A;  4DV3 B;  1U96 A;  2QJ1 A;  2FL4 A;  4ZIB A;  1P49 A;  2PY5 A;  4JAA A;  3H1J H;  2M6Y A;  4DR4 B;  3E8B A;  4O4L A;  5IJ0 B;  2B5U A;  2OCC B;  4JI8 B;  4PA6 A;  3VQV A;  2A06 H;  4JYB A;  2YID A;  3RVY A;  1EN4 A;  1FOU A;  4G2K A;  1PM9 A;  5LGU A;  4X89 A;  1EBO A;  4QGP A;  4P9O A;  3C90 A;  3EXA A;  3CC2 V;  3ML0 A;  4UVA A;  4L87 A;  1M57 C;  1KYO F;  1M9N A;  1QHT A;  3IGA C;  2KQX A;  1AI4 A;  4JTA B;  2CE4 A;  4TWK A;  1XNQ B;  3SGI A;  2YXL A;  4WFH A;  5EC1 C;  3BFR A;  2KG7 A;  1FXH A;  1SES A;  4LF6 B;  4I4T A;  3AG1 B;  2O57 A;  1XEQ A;  3A0B Z;  1Y66 A;  4MVZ A;  3X2Q B;  1T5E A;  2JGD A;  1ZTE A;  1MOF A;  1NR7 A;  3IFX A;  1XNR O;  5IYD O;  3HR0 A;  4NB5 A;  3L73 H;  1IBK O;  4I50 A;  1DLB A;  3N2K B;  4W4L A;  1BZK A;  1WJZ A;  2R9I A;  3OUS A;  1WPX A;  5B1A C;  3VBB A;  2VQF O;  2UXC O;  4ZOL B;  4FM1 A;  1FKA O;  2DMX A;  5KHH A;  3G6E V;  1IDS A;  4UCT A;  1VQL V;  1H8H G;  2Q0A A;  5BR8 B;  5KHJ A;  3PJS K;  3K08 A;  2DJV A;  3W7X A;  4HZ3 A;  2Q68 A;  1NVP B;  1HR0 O;  4JTD B;  1H2S B;  5IWA O;  2WLN A;  3W7W A;  3HKE B;  4JI7 O;  5BZB A;  2UUA B;  3JYC A;  2IBZ H;  2H3O A;  2QWQ B;  2Q9L A;  4X9Q A;  4IT5 A;  4GZR B;  1FD9 A;  1V54 B;  2NR5 A;  4FJC C;  5TIS Z;  1YF2 A;  1PL0 A;  1EZV H;  4IYH A;  1SQX H;  2VWK A;  2BOB C;  3GWK C;  1R3I C;  3ZHV A;  3P30 A;  3ZHT A;  1HNZ B;  1PP9 H;  2F1M A;  1WNS A;  2EIL C;  2KB1 A;  1SER A;  4N23 A;  1VEW A;  4DR6 B;  4UCU A;  3DTU B;  4UCR A;  1F7Y A;  2UUB B;  2Y69 C;  4TQF A;  1XOU A;  3NR7 A;  5B5E Z;  1F51 A;  2VQE O;  2UUC O;  4LF4 B;  3AK1 A;  2PF4 E;  3UO2 A;  3BRC A;  4FIP C;  3EFF K;  2YS8 A;  2EIJ B;  2ETN A;  2BTO A;  3KCY A;  2YI8 A;  4UCS A;  4FLT A;  1N36 B;  5EBM C;  5L3E A;  1M5I A;  4MT8 A;  4LF8 O;  3OEE G;  4KHP O;  2GTA A;  1NJI W;  2Y4T A;  5KMG A;  2XND G;  4LFA O;  2YIB A;  1WB8 A;  2L35 A;  1S77 D;  2ADQ B;  3ZRW A;  4O2A B;  2Y4U A;  2Q6A A;  3UCS C;  4J41 A;  4JI1 B;  5LXT A;  4UFZ A;  5LBQ A;  1B3Q A;  1VQ9 V;  1K9M W;  3B2E E;  1YIJ V;  2DW4 A;  2JEU A;  3W7T A;  4JI2 O;  3JAK A;  4EKW A;  3JD1 A;  4FLU A;  1FXK C;  4X65 B;  2JVD A;  4X1Y B;  2OYQ A;  3TJT A;  4H33 A;  5LGT A;  3HKD A;  1N34 O;  4DV6 B;  4J7Z A;  4BW9 A;  2XTA A;  5DM6 V;  5JH7 A;  2ZCE A;  3E89 A;  2DYS B;  5C93 A;  1Q86 W;  2CGN A;  4B3M O;  2IU3 A;  1AR5 A;  5D5Q A;  1YEW A;  1GM7 A;  1LUW A;  4OX9 B;  1KUQ A;  4WBN B;  4X64 O;  3CCR V;  4AIL C;  3ZED A;  1P84 F;  5LYJ A;  4QPK A;  5H9C A;  5FNV A;  2E75 B;  4D7S A;  1N4C A;  2IH1 C;  1NQT A;  2Z5U A;  1K7D A;  1NBM G;  3KKY A;  4RQF A;  1Q82 W;  2DE0 X;  4DW0 A;  1BE3 H;  3RYH A;  2DWE C;  3ZMT A;  3HB3 B;  1TVK B;  2ZDI C;  3E22 A;  1FPO A;  4WF9 V;  3D8C A;  1PNL A;  3LNN A;  3KDR A;  5LMN B;  1M4U A;  4MVM A;  2WLL B;  4IYI A;  1OCR C;  4U3J B;  4CS3 A;  4FZ0 A;  2WLM A;  1FS0 G;  3IC7 A;  3RW0 A;  5EZY B;  3FYE B;  4ZHQ A;  3DGE A;  1OCZ C;  2Z0A A;  5K1P A;  3B40 A;  1VQM V;  3ZMU A;  4PEL A;  3SPC A;  3P32 A;  1GK9 A;  2BE3 A;  1GRJ A;  5IYB O;  4AQY B;  2JJ1 G;  4DV5 B;  3ETD A;  1J95 A;  1M93 A;  4R7C A;  2DQ3 A;  4GT1 A;  2QGN A;  2ZR2 A;  3ABK C;  3G4S V;  5B3S C;  2HVJ C;  3ASO B;  4GX0 A;  1XMO O;  2CUG A;  3CCS V;  1R3J C;  2IJK A;  1Y74 A;  1AI6 A;  4R50 A;  1NZ6 A;  4PV1 B;  3ABL B;  4PA7 A;  2RJZ A;  2W0X A;  5EBW C;  2WLK A;  2Y0I A;  3SYP A;  2NLJ C;  4ABM A;  3PN1 A;  4FM0 A;  4IHJ B;  1MSW D;  3F5T A;  2OTJ V;  2YEV A;  2IJH A;  3OM3 B;  1XRE A;  3ETQ A;  2GV9 A;  3B09 A;  2E5L B;  3F7V C;  2ZIM A;  3K5N A;  1RM1 C;  3CD6 V;  4PI0 A;  4F6E A;  4C7U A;  3STZ C;  1GM9 A;  3GVM A;  2GDS A;  3K03 A;  4LNU B;  1ZX3 A;  2XAF A;  2UXX A;  1NI8 A;  1FFX A;  2F23 A;  1DF4 A;  2R9R B;  4DK0 A;  1I5Y A;  4GLX A;  4CC5 A;  3N27 A;  1RSO B;  4DRX A;  5BMV B;  4X20 A;  3ICX A;  4CH6 A;  3T4D A;  2P6J A;  3BAA A;  3ZCC A;  1VQ6 V;  1JMK C;  4GKK B;  4UB6 Z;  4YHH B;  3L72 H;  3BEH A;  1KD1 W;  2OCC C;  1ZL8 B;  1SC5 B;  4KXR A;  1FXV A;  4YJ2 B;  4IGG A;  3MD0 A;  2GSM B;  4JI5 O;  1QLE C;  4XBF A;  3SPI A;  1VMG A;  4X66 B;  5EK0 A;  1ZWI C;  4U3F H;  3QO8 A;  4JYY A;  1VF6 C;  1N33 O;  3C3T A;  3KCX A;  3QO7 A;  3SPJ A;  4O4H B;  1Q90 D;  4EEQ A;  5ITZ B;  1FXK A;  4F6R B;  1D5A A;  4TV9 A;  1Q8I A;  1H2K A;  3D3I A;  1EN6 A;  2P67 A;  2QWR B;  3T1H B;  1S72 V;  5DED A;  3CRM A;  5LOV B;  2RQ6 A;  1JQ0 A;  1BQZ A;  3B4S A;  4WFE A;  3AG1 C;  5CBG A;  4DUY B;  4J11 A;  1JPX A;  1NKD A;  3L75 H;  4ZI7 A;  3CC4 V;  4YIO A;  3U11 A;  1PKX A;  2XUM A;  3SJA C;  1VF7 A;  3JSN A;  1IBM B;  1K8A W;  2EX3 A;  4GYC B;  2WA3 A;  2CGO A;  5LHG A;  4PD4 F;  2XAH A;  2WLH A;  2ZDI A;  1BSM A;  3FD9 A;  4J10 A;  4FFB B;  2WWW A;  1BQ0 A;  1GH6 A;  2Y48 A;  3JAW B;  3E8F A;  4GKJ O;  1YIT V;  4AI8 A;  2P4K A;  3UO3 A;  1QCE A;  1WPB A;  5KAF Z;  1YDX A;  2BCC H;  1L1F A;  4DR1 O;  3BHP A;  3HKB A;  3FAV B;  1OCC B;  1SQQ H;  4PA4 A;  1RP3 B;  3CRC A;  4NTX A;  4RO2 A;  3E8G A;  3OW2 U;  2N04 A;  2GUZ B;  4DR5 B;  1V55 B;  3A2F A;  4E4E A;  1THZ A;  3E86 A;  5IY5 B;  4MVQ A;  2DQ0 A;  3RGB A;  2Q7E A;  2IW5 A;  4ZKI A;  5IYZ A;  1N32 B;  5CMU A;  3BAB A;  1I94 O;  4JI4 O;  4OGQ B;  2ZM6 B;  4Z2W A;  2JS3 A;  2QTS A;  5JWP A;  2B9Z A;  4DV4 B;  2BTQ A;  1M56 B;  4CBC A;  1GN2 A;  3RYC A;  5IYC O;  4DV0 O;  3AK2 A;  3VOU A;  3ZHQ A;  1RPO A;  3OR6 C;  1AJQ A;  2ZD9 A;  3C3S A;  4K0K O;  2LGW A;  2YXH A;  4GCZ A;  2EIN B;  1OV9 A;  2AZ0 A;  3L71 H;  1BHA A;  3WU2 Z;  4UVC A;  1HNW O;  2LGQ A;  4D6T H;  3JSL A;  1H5W A;  4JYA O;  2H94 A;  4LFC B;  1YVW A;  4EB6 B;  4NTW A;  2P90 A;  5EIB C;  5J2T A;  4IL6 Z;  1Z5V A;  1S3J A;  1DGS A;  1SS3 A;  3MHH C;  1AI5 A;  2ATK C;  3O9O A;  5CA0 B;  2F95 B;  4DR4 O;  4O4I B;  1J5E B;  2NNU A;  4LF5 B;  4OPH A;  3H01 A;  3G80 A;  4JI6 B;  2BSK B;  1BT8 A;  2EIJ C;  4LC1 A;  4OXS A;  5IJ0 A;  1MZE A;  1GN4 A;  4DV2 B;  3CCQ V;  4FLZ A;  3T1C A;  3OMN B;  5H2F Z;  5IDJ A;  1TA8 A;  3T1Y O;  1R73 A;  2XAG A;  1YJ9 V;  3ZBH A;  4MVU A;  1SET A;  4GX2 A;  4DV1 O;  2V7Q G;  3DC6 A;  2F43 G;  2DYR B;  1VF6 A;  5KX5 B;  5L3G A;  4DR2 B;  2OCH A;  1CEZ A;  5J9P C;  4JV5 O;  3CYO A;  1NH2 D;  2QA4 V;  4JAV A;  2B1G A;  4G27 B;  1Q5O A;  4PA9 A;  5B1B B;  2EBO A;  2WLJ A;  3JAR B;  1MMM A;  5LL6 Y;  3THO A;  4MVR A;  4RAI A;  2YIC A;  1XUQ A;  3B77 A;  4CH4 A;  5CA1 B;  1NU1 H;  4DUZ B;  5B1N A;  4NXN B;  3ABM B;  4J9Y B;  1E1R G;  4RUF A;  2ZE8 A;  5EYP B;  3LDE A;  4JGS A;  3CMA V;  3N2K A;  1N0J A;  4MTX A;  1YHQ V;  3K79 A;  1BMF G;  3M99 B;  5A9G A;  4ZOL A;  3BVO A;  2YC0 A;  3ETG A;  4KFM A;  2X6C A;  3CCV V;  1DF5 A;  1XNR B;  3N2G A;  4OPA A;  1SKV A;  1IBK B;  3JD4 A;  1M1K W;  1BGY H;  3E2E A;  4HYO A;  3K5M A;  2OTL V;  4J7K A;  3DXR B;  3CXH F;  1IXM A;  2VQF B;  2UXC B;  3G6B A;  1IBL O;  3K04 A;  2B1I A;  4MW8 A;  3BA9 A;  1F4M A;  3FFQ A;  1MSD A;  2E76 B;  4P2Z A;  1AR1 B;  1XDC A;  5FLX N;  3HKE A;  4H0L B;  3JAL B;  5EBL C;  4X8A A;  1HNX O;  4JF3 A;  3CHX A;  5CB4 B;  1GN6 A;  1TUE B;  3JAM N;  4TV8 B;  4LF7 O;  4P30 A;  3SPG A;  4YJ3 A;  2HHH O;  3F7Y C;  3ASO C;  3L70 H;  3JAT B;  3RYF B;  5KLV H;  1PV0 A;  4JI0 O;  1JVM A;  1WAZ A;  3CE2 A;  4BIZ A;  3UT5 B;  5IWA B;  3ZJZ A;  2QKC A;  4JPR A;  4JI7 B;  1HW7 A;  4DW1 A;  1XMQ O;  4MTG A;  3ABL C;  1ENV A;  4CH5 A;  2VWJ A;  1KP2 A;  2AHZ A;  1AB3 A;  4TUY B;  4UXN A;  3H9V A;  1HNZ O;  1LNQ A;  4E2L A;  1AIL A;  1HWY A;  1GM8 A;  2Q0O C;  4IIJ B;  2VRZ A;  2UUB O;  4PI2 A;  1SA0 A;  4MVS A;  2UXB O;  2CTQ A;  3HKC A;  1ZAU A;  5L3B A;  4WFB V;  4U7O A;  3K57 A;  1B04 A;  1NS1 A;  2DOS A;  1GMG A;  4B3T O;  4YXW G;  3CB2 A;  1KB9 F;  4LF9 O;  3VQW A;  1NTZ H;  2EIM B;  3MDS A;  3TK1 A;  2RNB A;  4MS2 A;  2RDC A;  1JJO A;  2A9H A;  3LSU A;  2UUC B;  4H44 B;  4GUN A;  2XT9 A;  1F4N A;  2CH7 B;  1IZ3 A;  4O2A A;  4NXM B;  2FB5 A;  3HPL C;  1BCC H;  2Q73 A;  2XHB A;  4JI1 O;  2L6L A;  5C8Y B;  4DV7 O;  5IT9 N;  4LF8 B;  1BS3 A;  3K5O A;  4KHP B;  2GTS A;  2F66 C;  1PNM A;  4LCU C;  2YI9 A;  4LFA B;  2IM9 A;  4X1Y A;  3FYI B;  2Q67 A;  2V1D A;  2HEP A;  3FX7 A;  4FLX A;  3RBZ A;  3OTF A;  5KHK A;  5IJ9 B;  2G38 A;  4KL1 A;  3EHB B;  1H2G A;  1K33 A;  4TSF G;  4OX9 O;  3E83 A;  3LSS A;  4DR7 O;  3JAK B;  3CXC U;  5J2U B;  4I55 A;  1KP3 A;  4PDR A;  4CS2 A;  2YIB D;  1N34 B;  3K9A A;  4WFA V;  4NR1 A;  1EM1 A;  5KUK A;  1A32 A;  3QNE A;  3SDL A;  5B1O A;  2WAM A;  1YSC A;  1TVK A;  2AHY A;  1VP7 A;  4X64 B;  1H8E G;  1VQP V;  2WLL A;  2FYU H;  4U3J A;  3TCU A;  2H8P C;  5EZY A;  1Y76 B;  2JDI G;  3U10 A;  3ZN0 A;  1VQ5 V;  3H1L H;  4P9P A;  1MG1 A;  3CC7 V;  1GTO A;  3LNM B;  4NYK A;  3RYH B;  2FTK A;  1OCC C;  4YY3 O;  1XIL A;  1K92 A;  4JI3 B;  4LWS B;  5GTI Z;  3CRQ A;  5LA6 B;  2ODM A;  1V55 C;  3JD3 A;  3IJ4 A;  2LJ2 A;  4TQD A;  5IY5 C;  2QKA A;  3G67 A;  4FLW A;  1VQO V;  3D36 C;  2QWP B;  4NKG B;  5L3F A;  4X1I B;  3K59 A;  4J9Z B;  4CZZ A;  1CXZ B;  3DC5 A;  3S3X A;  4HNA B;  2AZ2 A;  4J42 A;  3RN4 A;  1LUV A;  3CSX A;  1QNM A;  3AG4 C;  1XMO B;  2HP8 A;  1SQG A;  4IHJ A;  1H2M A;  4WCE V;  3QO5 A;  1AI7 A;  1Y74 B;  4UCO A;  4MVO A;  4QPJ A;  1BL8 A;  2ILM A;  1GN3 A;  2EIN C;  4MW3 A;  4L8J A;  3K0D A;  3K5L A;  1GAX A;  3JCU Z;  2CK3 G;  4FFK A;  3DSQ A;  5FPO A;  1Q6I A;  4O2B B;  2Y0P A;  1I5X A;  2Q8V A;  2YEV B;  4X62 O;  5GON B;  4X1K B;  1RSO A;  4B3S B;  1MA1 A;  5BMV A;  2Y69 B;  4K3A A;  3WG7 B;  1W0K G;  2UXD O;  2F4V O;  3QG5 A;  2K1E A;  4NTY A;  1Q3E A;  3FB7 C;  5FPR A;  1QR9 A;  1TUB B;  2P4V A;  3OFN G;  5JJN B;  1ZL8 A;  2ZE5 A;  3Q4H A;  3M7M X;  3CS5 A;  1EZJ A;  3LDD A;  1VQK V;  4YJ2 A;  2OIG A;  4KUM A;  5LGN A;  4B3R B;  3B8N A;  1JFF B;  5KAI Z;  4WFF A;  3SJC C;  2LW7 A;  2DYR C;  3ZHU A;  1CP9 A;  3P3N A;  2MK3 A;  4O4H A;  1QLN A;  5ITZ A;  1N8R W;  4F6R A;  2Q5Z A;  3CP1 A;  2HG5 C;  4RWU A;  2AGA A;  2LO1 A;  3A0R A;  2PYJ A;  3T1H O;  4DO2 A;  4BAY A;  4JI5 B;  3IC9 A;  5JQG B;  4DR3 O;  3QVN A;  5L3C A;  2E3C A;  1XHZ A;  4I0X A;  2YSU B;  1B6Q A;  3QF7 A;  1RPR A;  2LFR A;  4JZG A;  4DUY O;  1N33 B;  1TAE A;  1WB7 A;  2IJI A;  1FXK B;  4UVB A;  4MTF A;  5E79 Z;  4TV9 B;  3SYQ A;  3X2Q C;  3J7A U;  2Z3Y A;  3OTO O;  2P5O A;  3ABM C;  3CWB H;  1GKF A;  2YUA A;  2A3Q A;  4FLY A;  1K5S A;  4DXW A;  2ZQM A;  1XL4 A;  1YTF D;  3OMA B;  3M8A A;  1HDJ A;  4PDM A;  3OT7 A;  3RYI B;  1QQC A;  4O4J A;  2QSA A;  1AJN A;  3GWO A;  2HKO A;  3JAW A;  1K5Q A;  1ROP A;  4H37 A;  5JVD B;  1SQP H;  4CC6 A;  1URF A;  4I5S A;  4LH7 A;  1QR8 A;  2Q7H A;  4NVP A;  3CCU V;  1UJW B;  2QDO A;  4LP8 A;  2ZIO A;  4RQE A;  3H1H H;  1Q6H A;  1WA8 B;  4LFB O;  1SQF A;  3FAV A;  3H1K H;  2GHY A;  2ADP A;  2UU9 O;  2WA4 A;  5GW7 A;  5LMU O;  3ASN B;  4EFE A;  2LFS A;  4GKJ B;  5F2V O;  2GUZ A;  1FJG O;  3OR7 C;  2WLI B;  4I9W A;  3CJH B;  1Y4M A;  1OCZ B;  2HJF C;  1N32 O;  3D36 A;  4AHC A;  1R3K C;  1R1B A;  3B8M A;  1V54 C;  2DN9 A;  2QTO A;  3UKM A;  1P7B A;  3JAS B;  4MSW C;  1Y67 A;  3SJQ C;  1S5H C;  3LSQ A;  5KA6 A;  5IYZ B;  3E8H A;  1F23 A;  5D5P A;  4DYL A;  1VQ8 V;  2XAJ A;  2JRI A;  1BHB A;  2BTQ B;  1FAF A;  3FKS G;  4K35 A;  5GTH Z;  5L3D A;  2JGU A;  1Z2G A;  1PL4 A;  3BPZ A;  1O9G A;  4FMT A;  1KBH A;  4DV3 O;  2ZXW B;  4FVM A;  4K0K B;  2QM8 A;  3K58 A;  5CA0 A;  1J5E O;  2M7W A;  3BCC H;  2ZNI A;  2EJR A;  4H13 B;  3TXS A;  4XDJ A;  3QTC A;  2N05 A;  3JCZ A;  4JYA B;  4JI8 O;  1X4T A;  5LP6 B;  1NH2 B;  2MW2 B;  4K8X A;  3K06 A;  4K8Z A;  2ZE7 A;  2CTR A;  4Q6G A;  1KMI Z;  2IJJ A;  3WFV A;  1JJ2 U;  5E1A C;  5KX5 A;  4O4L B;  3KZI Z;  4R8C A;  4DR2 O;  5BY1 A;  4LBE C;  1XNQ O;  4J80 A;  3L74 H;  1SZT A;  1PD3 A;  2P7T C;  1QLE B;  3GB7 C;  1YZB A;  3T1Y B;  1S0V A;  4XDK A;  2QWO B;  3K0G A;  1NTK H;  3JAR A;  4WFG A;  4LF6 O;  3OUF A;  4DV1 B;  2YXY A;  3JD0 A;  3CX5 F;  2UXN A;  5CA1 A;  1KKD A;  3CRR A;  4DUZ O;  4W4K A;  3WB1 A;  2A79 B;  2DYS C;  4XDL A;  1L0N H;  4JV5 B;  4NXN O;  3OAA G;  1K34 A;  2PZS A;  1EFR G;  2ZKO A;  5EYP A;  1S5J A;  2KG7 B;  1YCI A;  2R70 A;  4I4T B;  2KKW A;  3CRA A;  3RT3 C;  4G28 B;  1EN5 A;  2LP7 A;  1AVM A;  1G4Y B;  2IH3 C;  1OJH A;  2JGD B;  5CBF A;  2Q4P A;  1OCO B;  4FM2 A;  1IXB A;  4QJF B;  5BR8 O;  4I50 B;  1LR1 A;  1JNB A;  1L0L H;  5KA5 A;  4CS4 A;  1JOY A;  1W59 A;  2EUL A;  3AG3 B;  2DWD C;  2EZO A;  3DXR A;  1WLE A;  3ZRS A;  2QEX V;  1DK1 A;  2JJ2 G;  1ZLZ A;  5H6Q A;  3APO A;  1SQV H;  3E35 A;  2UUA O;  3JAL A;  3N2G B;  3OEH G;  5CB4 A;  3O65 A;  4TV8 A;  3CEI A;  3ABT A;  2X6A A;  5JJE B;  1IBL B;  3JAT A;  3RYF A;  1HR0 B;  1Q43 A;  2EZP A;  3SYC A;  3K9S A;  3WB0 A;  3D3Q A;  2LQT A;  3UT5 A;  1I08 A;  1Q6U A;  1Y6X A;  3NXS A;  1E79 G;  1HNX B;  1WP8 A;  3APQ A;  3SR2 C;  1XBL A;  2XAS A;  4TUY A;  4A5U B;  5K1X A;  4LF7 B;  4PDL A;  4YJ3 B;  1SF9 A;  2HHH B;  1AR4 A;  4DR6 O;  1NVP D;  4IIJ A;  4JI0 B;  4CH3 A;  1S76 D;  3CCL V;  5EC2 C;  3OGC C;  4TT3 G;  5A2Q N;  2EIK B;  1XMQ B;  4FPP A;  4LF4 O;  1S5L Z;  3I5D A;  4GX1 A;  1P7G A;  4ZBM A;  4LR3 A;  2ITC C;  4TOI A;  1JCH A;  4PJ0 Z;  3RWR D;  3CME V;  3AG2 B;  1Q81 W;  1N36 O;  1IX9 A;  2W0F C;  1SA0 B;  4U7N A;  3S3W A;  2UXB B;  3WG7 C;  3HKC B;  3LUT B;  3OD4 A;  1XHX A;  2VQE B;  2YDE A;  2QM4 A;  1O9H A;  5KHG A;  3A8T A;  4N21 A;  4B3T B;  4I9Q A;  2CH7 A;  4NXM O;  5BXZ A;  1VQ4 V;  2ZT9 B;  2JEX A;  2BOC C;  3SJB C;  4LF9 B;  1PNK A;  3ETE A;  1GO3 F;  4BIU A;  5C8Y A;  2W6J G;  3FB6 C;  1QBZ A;  4PDV A;  1RFY A;  5EIB D;  3TET A;  3I56 V;  2RCV A;  5KMG B;  3OMI B;  3SYA A;  3W7S A;  2HJD A;  1US6 A;  4X65 O;  2R72 A;  5DEC A;  4BW5 A;  2AW9 A;  3ZRW B;  4DV6 O;  1XL6 A;  1JR9 A;  1M57 B;  1YXB A;  5IJ9 A;  5LXT B;  4DV7 B;  5KUM A;  1B06 A;  2CAZ C;  2OT5 A;  3CCE V;  1OHH G;  1W2B U;  3UQ8 A;  4QE9 A;  4WBN A;  4JI2 B;  1COW G;  5J2U A;  4JAU A;  2JK5 C;  2X6B A;  1W0J G;  3ZRV A;  3HKD B;  3EVK A;  5JCO C;  3G71 V;  4HBN A;  3TXQ A;  5JH7 B;  1TGO A;  3AG7 A;  1YJN V;  4BR6 A;  2A7W A;  3JD2 A;  1VF5 B;  3R65 A;  2P22 C;  1KU9 A;  3OE7 G;  4KP4 A;  1VQN V;  1H2N A;  4UCV A;  4B3M B;  1MNG A;  4YIP A;  4B7K A;  4DR7 B;  2W6I G;  5LHI A;  2WPD G;  3ZHR A;  5LYJ B;  5LMN O;  2P06 A;  4I55 B;  3AK3 A;  5FNV B;  3T2M A;  1AP5 A;  3VQY A;  3ZX6 A;  5JJJ B;  4I7Z B;  4UV9 A;  1IJG A;  1NT2 B;  5B1A B;  1Y76 A;  1D5N A;  2N74 A;  1Q7Y W;  1R6K A;  1I0H A;  1D2D A;  4JI3 O;  2AXT Z;  1V9P A;  1WP7 A;  2ZR3 A;  3E22 B;  4ICG A;  4LWS A;  5B66 Z;  5HFM A;  3TGU H;  3F5W C;  1QVF U;  4AQY O;  4JZ2 A;  4DV5 O;  1XI1 A;  4FLV A;  1VIB A;  5LA6 A;  1SRY A;  1OZ0 A;  3ASN C;  3VQX A;  1WN7 A;  1G8M A;  2Q69 A;  5DN6 G;  4UV8 A;  3OGI B;  4ZHQ B;  4B7E A;  1IVS A;  4FZ1 A;  3CPW U;  3RFR A;  2CTW A;  4X1I A;  4F4L A;  2X0L A;  3P3P A;  4YY3 B;  1MAB G;  1H2L A;  2FKX A;  2PTM A;  3ZS8 C;  2KSD A;  4GX5 A;  2NN4 A;  4HNA A;  2JIZ G;  1M56 C;  4MTO A;  1NR1 A;  1K97 A; 
#chains in the Genus database with same CATH homology
 2AW9 A;  1MMM A;  1EM1 A;  3CEI A;  1AP6 A;  1JR9 A;  2CDY A;  1MA1 A;  1XUQ A;  2ADP A;  1ZUQ A;  1B06 A;  4JYY A;  3C3T A;  3K9S A;  1IDS A;  1GN2 A;  1I08 A;  3AK2 A;  1WB8 A;  5AG2 A;  1EN6 A;  2ADQ B;  3C3S A;  3EVK A;  1N0J A;  4BR6 A;  1AR4 A;  5A9G A;  1MNG A;  1XIL A;  4YIP A;  1Y67 A;  1N0N A;  3MDS A;  4YIO A;  1EN4 A;  3LSU A;  3AK3 A;  1PM9 A;  1AP5 A;  4X9Q A;  3TJT A;  4GUN A;  1P7G A;  3IC9 A;  3QVN A;  1D5N A;  2QKA A;  1ZSP A;  1XRE A;  1EN5 A;  1AVM A;  1BT8 A;  1BSM A;  1I0H A;  1IX9 A;  1BS3 A;  4F6E A;  4C7U A;  1AR5 A;  4JZG A;  1GN4 A;  1VAR A;  1WB7 A;  1KKC A;  2GDS A;  1LUW A;  3DC5 A;  1MSD A;  2CE4 A;  1XDC A;  1PL4 A;  1JA8 A;  4JZ2 A;  1IXB A;  3RN4 A;  2P4K A;  3BFR A;  1GN6 A;  1LUV A;  1QNM A;  3KKY A;  3DC6 A;  1SZX A;  3OT7 A;  1VEW A;  1GN3 A;  1ZLZ A;  2RCV A;  1ZTE A;  2QKC A;  3KDR A;  4FFK A;  4E4E A;  3AK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...