1AP5A

Tyr34->phe mutant of human mitochondrial manganese superoxide dismutase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Crystal structure of Y34F mutant human mitochondrial manganese superoxide dismutase and the functional role of tyrosine 34.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 66
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ap5A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ap5A02
1XUQA 2GDSA 1JA8A 4GUNA 4JZ2A 1GN6A 4X9QA 1LUVA 1P7GA 1XILA 4FFKA 1EM1A 5AG2A 1WB8A 3TJTA 1SZXA 1N0JA 3MDSA 1MSDA 2ADQB 1AR4A 4BR6A 1AVMA 3IC9A 2RCVA 1GN4A 4JYYA 1PL4A 4YIOA 1EN5A 3AK1A 3EVKA 2ADPA 1I08A 1ZUQA 3AK3A 2QKAA 1MA1A 3C3SA 1PM9A 2AW9A 1Y67A 3CEIA 3LSUA 1B06A 3QVNA 2CDYA 1LUWA 1ZSPA 4JZGA 1ZTEA 3K9SA 1VEWA 3BFRA 1MNGA 3RN4A 1AP5A 1N0NA 3AK2A 1GN2A 3C3TA 1XDCA 4F6EA 3OT7A 1XREA 1WB7A 1D5NA 2P4KA 5A9GA 1BT8A 1IXBA 1EN4A 1JR9A 1KKCA 1GN3A 1AP6A 1BSMA 4YIPA 3KKYA 3DC6A 2CE4A 1IX9A 1ZLZA 1QNMA 1BS3A 1MMMA 4C7UA 1I0HA 1EN6A 2QKCA 1AR5A 4E4EA 3DC5A 1IDSA 1VARA
chains in the Genus database with same CATH superfamily
5LHHA 4DK0A 3RYCB 1SETA 1JA8A 1JX9A 1Q82W 1DK1A 3CXHF 4FM0A 4EFBA 3P30A 3ZMZA 4JI7B 2Y69C 4J11A 3I55V 1FJGB 5GTIZ 3JD0A 4LF5O 2YUAA 4CC5A 4UCSA 1F4MA 1Y76A 3L75H 2BCCH 1FXKB 3N2KB 3TK1A 2GTAA 2IJHA 2W0XA 1XL4A 1AVMA 1FKAO 4OX9B 4JV5O 4FFBA 3U0ZA 3RFRA 3TXSA 2XAQA 3ABLC 4GZRB 2CTWA 4D7SA 3RVYA 2HJDA 3STLC 3KCXA 5LP6A 1FFTB 3H1HH 3E8FA 1TUBB 2FL4A 2QKAA 3B8NA 1Y4MA 3CRQA 4FJCC 2OIGA 1P84F 3W7SA 4ABMA 1Y76B 4DV1B 2EX3A 4DR7B 1XNRB 2OTLV 2DQ3A 1Q6HA 5B1BB 4X1YB 3VBBA 3AK2A 1Q86W 3JCUZ 1RP3B 1EBOA 5LOVA 2GUZA 1K73W 3BA8A 5LGUA 1AJPA 2XOKG 5E79Z 2P4KA 4DV3O 4TV9B 1GO3F 2BOCC 4JF3A 3D36C 1GKFA 2A9HA 1SKVA 5H9CA 2QM8A 2EBOA 1QNMA 3O65A 5FPRA 4DR2O 2B5UA 1Q8IA 1S5HC 3AG3C 4G2KA 3E89A 4J7KA 4NYKA 1WNSA 4DXWA 3LSQA 2ZNJA 4WFAV 4DV4O 3ML0A 2OYQA 2V7QG 2AXTZ 1R3LC 4PDMA 4DK1A 1NVPB 3AG4B 4QE7A 1TUEB 3WB0A 3MD0A 5A2QN 1OCCB 2EIJB 1Q7YW 3OTOB 3HKDA 2YEVA 1ZAUA 1AR4A 4U7OA 1VP7A 3BPZA 2EILB 3ETGA 5H5NA 2XNDG 2JJ1G 2Q5ZA 3ZS8C 1UPGA 3ABMB 4LF8O 1BHAA 1KQSU 1IXMA 3HKCB 5EZYB 1TAEA 3K0DA 1XI1A 5CBFA 2XASA 2XAHA 2UUCO 5KLVH 1H8EG 3L72H 1QLEC 2HFEC 1DTOA 5KA5A 3T1YO 1XMOB 3K57A 4UUJC 4PD4F 2IJKA 2R9RB 1FFXA 2ZE7A 5JCOC 4O4LA 1Q81W 4X8AA 4UVBA 2LFRA 4JI4B 2DE0X 4JGSA 4PDLA 1N33B 3OR7C 3HKBB 5A9GA 4X20B 1WJZA 3B09A 4F6RB 5LL6Y 4GKJB 2BSKA 3LUTB 5LMUO 3STZC 3Q4HA 3QNEA 4LH7A 2UUCB 2XHBA 5EYPA 5D5PA 4O2BA 3CRRA 1MZFA 1NH2B 1SERA 1QU7A 3ZJZA 3TGUH 1FFXB 3QTCA 1ZX3A 4J42A 1R73A 2F1MA 5BXZA 2Q7HA 4JI6O 4B3SO 1US6A 2F43G 3VQVA 5E1AC 2F4VO 4UCUA 1LUVA 4LF7B 1EM1A 1SC5B 3SPGA 3BVOA 1IVSA 4LFBB 1S5JA 4XDKA 2IW5A 1KECA 3G4SV 2N74A 3MDSA 3Q4HB 4B3MB 5IT9N 1MSDA 3QO8A 4DV2O 2WLMA 2QWNB 4DUYO 1R3JC 2RCVA 4FM1A 3CRMA 4HYOA 1PL4A 1S3JA 4WFBV 3CB2A 1VQLV 2EJ7A 1FPOA 1N36B 1DF4A 2Q9LA 2FMLA 2WLJA 3ZHTA 4AQYO 1KUQA 1YHQV 4YXWG 2XUMA 2XTAA 3JSLA 4PV1B 4RAIA 3FKSG 3CC2V 1GTOA 4RUEA 4GX0A 2P6JA 2WLIB 3HKEA 1JJ2U 3ASOB 2PYLA 2AW9A 2YXYA 2H3OA 4OGQB 1EZVH 1VQ4V 2ZQMA 1W59A 1ZSPA 2WLLA 4LH6A 1PKXA 4J7JA 1GAXA 1GM7A 1QBZA 3T1HO 4F4LA 1H2SB 5L3CA 4DV6O 1HNZB 3W7UA 1N32O 5JVDA 2M7WA 2JEUA 4LWSA 5LGNA 3FFQA 1KKCA 2QTSA 4AQYB 5EBMC 3UT5B 3HKEB 3L74H 4FIPC 5IYCO 3CXCU 3WB2A 5J2TA 2Q0AA 3H1IH 1HDJA 1WP8A 1SQQH 5JWPA 3F7VC 3LDEA 2WLLB 4TOIA 1FXKC 1OCRB 1BE3H 1XHXA 3RVZA 2UUBB 5KAIZ 3ZHQA 4DR1O 3EHBB 1SQPH 4I0XB 4G28B 2YXLA 3CC4V 1NJIW 1NKDA 2YC0A 3A0HZ 4DR6O 2P22C 5IJ0B 4DV6B 3CX5F 2AZ0A 5FL7G 1N0JA 3ASNB 1SA0A 2WLNA 3SJQC 3CE2A 2QDOA 1NTMH 3K3WA 3CSXA 4K0KB 3WFVA 1OHHG 4CBCA 1NVPD 4OPHA 4JYYA 1YCIA 4YIOA 1HWYA 4ZHQB 2QEXV 2VQEO 3QO7A 4I4TA 4DW0A 4WF9V 1NR7A 3ZRXA 1RM1B 1P4RA 2ZDIC 3H1LH 1BQ0A 4K8XA 1HNXB 4CH3A 4J80A 3SPJA 2RDCA 1AR1B 3NXSA 3M7MX 4MT8A 5LMNO 3QVNA 3CYOA 1KP3A 3ZHSA 3SYQA 1HNWB 4IL6Z 2YI8A 3RN4A 3C90A 1SESA 1N0NA 4NXNO 4FLYA 2YDEA 3APOA 3AG2B 3IFXA 4LFCO 2JJ2G 3C3TA 3WG7B 4O4JB 3H9VA 3OR6C 1K4DC 1TA8A 4I50A 3H1KH 5K1PA 4HNAA 4MVOA 3CCLV 2XT9A 3ZRSA 3JATB 4X1KA 1BSMA 4TQFA 1QVGU 2QWRB 2UXDB 2YXHA 3AG4C 1CPYA 4JI0B 1DLBA 2P4VA 1BS3A 2EIJC 2HEPA 4R6ZA 4DR5B 3DGEA 2XAJA 1PNMA 3JARA 2VWKA 2Q73A 1VARA 2EILC 2EZPA 4JTAB 1QLEB 5CA1A 2O57A 4O4HB 2E5LO 1Q6IA 1K9MW 2OCCB 2R72A 3ZHUA 3ABMC 1HR0O 2P06A 4X64O 3CCMV 3JAKB 3CC7V 3SJCC 5LGTA 5JH7A 3RYHB 2D2CB 3HR0A 2K1EA 4LNUA 5LYJB 2ZKOA 4DV7B 4GKKO 1K33A 4DRXA 2X7RB 4J9YB 5JJJB 5EC1C 4B3TO 3A0BZ 4FLVA 2HKOA 3T4DA 4B08A 2MW2B 5CA1B 4AILC 5ITZB 5FLXN 2ADPA 5BMVB 1XMQB 1FOUA 2ZCEA 2VQFB 1IURA 4RQFA 2E5LB 3JSNA 3THOA 2EIMB 2QTOA 4CZZA 5KA6A 4BIOA 4CS4A 1RSOA 2UXCB 1V9PA 4YY3O 2EINB 4ZI7B 2F93B 1Y67A 3AG7A 2EZOA 1OCZB 4R50A 1X59A 2L6LA 4MTOA 2AZ2A 1SRYA 4R8CA 4GKKB 3T2MA 4AHCA 3CCEV 4MTXA 1WP7A 1TVKA 3ZX6A 1S77D 4X1IA 1T5EA 3SPHA 4KHPB 5C93A 5IDJA 1NZ6A 4X65B 3JASA 3MHHC 2E76B 3BAAA 4H13B 1CP9A 2MK3A 5GONA 1I94B 1JR9A 5LXTB 3E22A 1XQ8A 3ZHVA 2Y4TA 2HVKC 4LF6O 1RSOB 1R3KC 4UV8A 1Q5OA 3E86A 2BOBC 4DW1A 1H8HG 4DR4O 4YY3B 5B3SC 1AR5A 5IY5B 1K8AW 1VQKV 4UB6Z 1TVKB 1XUQA 4KP4A 4DR3O 5IE9A 2UXBO 3SYOA 1XILA 2EIKB 2B1IA 1WB8A 3B4SA 3E22B 4EEQA 1EFRG 4YHHB 3CP1A 4B3RO 1FYJA 3L9DA 3BA9A 3X2QB 5BR8B 2CK3G 3E8GA 4R7CA 3ASOC 1K92A 3ZMUA 4RUFA 2PYJA 2PGGA 4DR4B 2LW1A 3MAQA 1COWG 3CCQV 2ZR2A 4JYAO 3VQXA 2ZM6B 4NTYA 1JOYA 3JD2A 3FAVA 4LF4B 4U3JB 4BIZA 1IBLB 1AJQA 1IZ3A 3L73H 1YJNV 4D6TH 5CN0A 2AGAA 2DQ0A 4JAVA 5KMGB 3LSUA 4B3RB 3J80N 3DSQA 3W7WA 1BGYH 4JZGA 1ZTEA 3EFFK 4YJ3A 1VEWA 2YIBA 1ZL8A 4KL1A 4Q6GA 5JJEB 5IYDO 4ZBMA 1BCCH 1MABG 2UXNA 2YIAA 1PV0A 3ETEA 3ZMTA 4NKGB 4PA6A 1OCRC 4UCVA 1P49A 3OT7A 1ENVA 1E79G 4TV8A 1MZEA 5KHJA 3FB6C 3U10A 4LF5B 4FFBB 1NR1A 1JJOA 3OMIB 4XBFA 2BTOA 2DWEC 2DYRB 4X88A 3ASNC 1OCOB 1BQZA 3APQA 4JV5B 4LC1A 2NR5A 4IIJA 1RFYA 4BAYA 2PY5A 3F5WC 4O4IA 2WPDG 4JZ2A 5LP6B 1XOUA 2RN9A 5H6RA 1JNBA 1WA8A 1JQ0A 2Q67A 1RM1C 2Q6AA 5CA3A 2YIDA 1VF6A 2JK5C 2Z5UA 2B9ZA 2OIEA 1H2NA 1SQGA 1KB9F 2WLHA 4JASA 2FTKA 2GV9A 3L70H 4WBNA 1KD1W 5LOVB 2GUZB 1GM8A 3CMAV 3CCJV 3IGAC 1VQ8V 3SDLA 4FPPA 3N2GA 3AG2C 4QPKA 4DV3B 3RYFA 1YVWA 4LBEC 1WA8B 1Q43A 3WG7C 1V54B 1M57C 4QJFB 3CWBH 3FYIB 4UXNA 3CCRV 3G80A 3JYCA 3A2FA 3R65A 3CEIA 4DR2B 3OW2U 1N34O 4NTWA 3G6EV 2A79B 4IGGA 5KUKA 1CXZB 3BFRA 1M9NA 4GYCB 4IHJA 1Y66A 3W7TA 4DV4B 2IM9A 3B2EE 4KXRA 1I5YA 2KB1A 2A06H 2QE7G 3RYFB 1W2BU 1Y74A 3HKDB 2OCCC 2YEVB 3CS5A 2ZE6A 4N23A 2IJIA 1OV9A 2A7WA 1PNKA 2EJRA 5KX5A 3OD4A 2F23A 4IHJB 4LF8B 4FK5C 4B7EA 4FLZA 1CEZA 5GW7A 2X6BA 3RYIA 1WN7A 2Q4PA 3KCYA 2ZIMA 4IYHA 2QWQB 2NN4A 1S5LZ 2ZE5A 1MSWD 2RQ6A 1NU1H 5IYZA 1R6TA 2EIMC 3T1YB 1AJNA 4O4LB 2EINC 4PI2A 5KX5B 4OXSA 1W0KG 4NB5A 3OUSA 3W7XA 1OCZC 2Q69A 4K8ZA 1FAFA 1K97A 1AI4A 1K5QA 4PHZA 1R1BA 1L0NH 3ZMSA 2BSKB 4J10A 2QM7A 2ZNIA 5B3SB 2FB5A 3OM3B 2PI5A 5EYPB 5LMUB 4FMTA 4O2BB 1B06A 1J95A 4EKWA 2LGWA 2CDYA 4JI5O 5CA0A 4JI1O 4W4KA 4TSFG 3KZIZ 3CPWU 2JGDA 4Z2WA 5IY5C 2PF4E 2Z3YA 4JI6B 4B3SB 1YJ9V 4EFEA 3HB3B 2F4VB 3OTFA 4TUYA 4X89A 1M93A 3FD9A 4MVUA 1FXVA 1AP6A 4YIPA 2EIKC 1YTFD 1IX9A 1O9GA 4DV2B 5EIBD 2ETNA 1WLEA 2W6JG 1JFFA 3X2QC 4DUYB 1EN6A 1YXBA 2C2AA 4UV9A 2LFSA 4D7TA 3ICXA 4DYLA 3JD4A 4MW3A 4J41A 4JI5B 2UUAO 4JI1B 5J2UA 1GMGA 1X4TA 4DUZO 2LQTA 5BY1A 3JAMN 4GUNA 1OJHA 3CRCA 2VRZA 3QG5A 2PZSA 3ZBHA 4FLTA 1OZ0A 1Z2GA 4CC6A 2YIBD 2E74B 3RGBA 3H1JH 5C8YA 4LFAO 2EULA 3BABA 1WAZA 1IBKO 2BTQA 3RW0A 1ROPA 4G27B 4JAAA 1NBMG 5JVDB 3T1HB 2DOSA 4LWSB 2KG7A 1G1XB 1N32B 1F4NA 1B04A 2QM4A 2ZR3A 1FD9A 5EIBC 2R9AA 5J2TB 1VQMV 1MA1A 5F2VO 1EZJA 4MVSA 1JPXA 2OTJV 1FXHA 1XNQO 1SQXH 4N21A 2Q68A 3QO5A 3GWOA 1Z5WA 4JAUA 3CHXA 2DYSB 4YJ2A 2DYRC 3DXRA 1OCOC 3JD1A 1QCEA 1NTZH 4P2ZA 4DR1B 1IBKB 2X6AA 4GX1A 3D3QA 1VQ6V 1AI7A 3A0RA 1WB7A 4DR6B 1D5NA 4H37A 1J5EO 3ZEDA 3P32A 1IXBA 5LP6C 1SA0B 2K9PA 3VQYA 1E1QG 3I56V 1AI5A 4JI3O 2UU9O 1IJGA 1IBMO 1XL6A 3DC6A 3ZMVA 1K34A 2P90A 2DJVA 4DO2A 2G38A 2A3QA 4I55A 3VOUA 5B1AB 1I0HA 3D3IA 3ZHRA 5IWAO 3J7AU 1KYOF 1M57B 2DW4A 2VQEB 2WSSG 4I4TB 1VIBA 5DM6V 1YJWV 2ATKC 4X9QA 2PI4A 1PL0A 4DV0O 1R6KA 1H2GA 3TXQA 3K06A 3BRCA 2QA4V 1V54C 3IAYA 5LMNB 2ADQB 4PA3A 2LO1A 2HHHO 4JPRA 1GN4A 4NXNB 1BHBA 4LFCB 4I50B 4W4LA 5GTHZ 4HNAB 5KHHA 4P9PA 1R3IC 4X1KB 4RQEA 3AK1A 3BEHA 3K5OA 2A0LA 1L1FA 2WAMA 5LHGA 4LF9O 4NXMO 4I5SA 4CS2A 3OEHG 4GX2A 3SPCA 1LR1A 3DTUB 3JARB 4U3FH 2F66C 3FB7C 5KHGA 1RPOA 3CRAA 1PP9H 1H2MA 3ABKB 3K5LA 3CCVV 2JVDA 3OGIB 2KKWA 2Q7GA 1M5IA 1HR0B 3J81N 5JH7B 2PUSA 4X64B 4LNUB 1NS1A 5EBLC 3FB8C 3AEIA 5FPOA 5IJ9A 4DRXB 2QJ1A 2LP7A 2FYUH 1JMKC 1V55B 4B3TB 4X62O 4QNHB 3FB5C 4XDJA 1BZKA 3U11A 1GN6A 3OEEG 4LR3A 3ABUA 4FFKA 4UVAA 4GLXA 3NR7A 2HP8A 1O9HA 1NQTA 1SZXA 1UFIA 5B5EZ 1QHTA 5IJ9B 1UJWB 5K1XA 2HR3A 4BR6A 5CBGA 1H2LA 1PPJH 4JYCA 4QPJA 4X1IB 2Q8VA 4X66O 4J7ZA 4DV5O 3JASB 4X62B 4ICGA 1F51A 5GONB 1G6UA 2QWOB 3RYCA 5KHKA 4QE9A 3T4ZA 1I08A 2KQXA 1FJGO 5DEDA 2QR4A 4I7ZB 2JGUA 4UCRA 4LF6B 1ZWIC 5DECA 4TQDA 1PM9A 2HJFC 2IU3A 1HP8A 1QVFU 3CCUV 1GH6A 4PJ0Z 1D2DA 2E75B 3K9SA 1U97A 4OX9O 1FXKA 3N2KA 2IU0A 3UKMA 4MVRA 5DN6G 4GCZA 1KC8W 1SQBH 3AG1B 3K59A 4DR3B 2RMKB 1QLNA 2UXBB 2RNBA 3JALA 1TGOA 2CTPA 2F95B 1EN4A 3IJ4A 1GN3A 2LJ2A 1TUBA 5LA6A 4HAMA 4DV1O 1MOFA 1KMIZ 4DR7O 1YTFB 5L3BA 1XNRO 1E1RG 2PTMA 3CJHA 3IC7A 5CB4A 4X1YA 4JYAB 3FAVB 3HPLC 1W0JG 2IJJA 2ZDIA 3JALB 3P3PA 5L3EA 2W6IG 2ZIOA 4TV9A 1XHZA 1NTKH 3K5MA 1NT2B 1K3EA 2ARHA 1VQNV 5LA6B 4YJ3B 1ZL8B 3MHSC 3SPIA 4WFHA 2GTSA 1Q3EA 3ETDA 3ZIAG 3IC9A 4MVQA 5H6QA 3JAWA 4P9OA 1Y6XA 3CJHB 1RPRA 5CB4B 4FLWA 4TV8B 2DYSC 3OMAB 2CH7A 2P7TC 3EXAA 4GT1A 2XAFA 4AI8A 5B1NA 5L3DA 1AILA 2QGNA 3K03A 4MW8A 2LGQA 1M56B 2VS0A 3OTOO 5EC2C 1YSCA 2YICA 3F7YC 4WFGA 3UCSC 4IIJB 1U96A 5EBWC 4O4IB 3JAWB 2ITDC 5B1AC 4Z1VA 1SF9A 1YI2V 3M99B 5D5QA 4Z1MG 4F6EA 2HVJC 3RWRD 4FZ1A 2CH7B 3WB1A 5EZYA 4UCOA 3HKCA 5B66Z 2OWOA 4ZOLA 4PDRA 1A32A 1NI8A 5JJNB 1XMOO 4WBNB 4PELA 4MTGA 4BWAA 1L8DA 1VQOV 1KKDA 1JVMA 5KHIA 3R66A 3N2GB 2Y48A 3SGIA 2OCHA 4JI4O 1N33O 4I9WA 1H5WA 4HBNA 2DMXA 1G4YB 5TISZ 2GSMB 2AHZA 3A8TA 4CS3A 1AB3A 3TJTA 3HKBA 4GKJO 4X20A 4ZOLB 4F6RA 3PJSK 4QIWF 1N34B 2WA3A 2KSDA 2NNUA 1QQCA 1I7FA 4A5UB 4H33A 4FLXA 4QGPA 3BHPA 2Z0AA 3N27A 3SYPA 2AHYA 3ABKC 3ZN1A 4P30A 4LF7O 1Y74B 3E8HA 4JI2O 1ZUQA 1BMFG 4LFBO 4FM2A 2IBZH 2Q7EA 2R70A 1GK9A 1N8RW 4B3MO 4GX5A 2P67A 3M8AA 4K35A 2N05A 1M90W 3ZRWA 1N36O 1V55C 4JYBA 1GN2A 2Y0PA 3CCSV 2ZD9A 3SYCA 3RYIB 1N4CA 3ZCCA 3WU2Z 1Q90D 1BT8A 3SJBC 5IYZB 2ZINA 1PNLA 3KKYA 3B77A 1F23A 3LSSA 3TCUA 4OPAA 1VQ7V 4JI2B 3K58A 4H44B 2WLIA 3JCZA 1XEQA 3E2EA 1R6NA 4C7UA 2CUGA 4TWKA 2ZXWC 1S72V 3CMEV 3ZN0A 3ZRWB 4PI0A 3SYAA 3GB7C 1IDSA 2ZT9B 2QSAA 3ETQA 2GDSA 1HNZO 2WA4A 3K04A 2QKSA 2E3CA 1P7BA 5HFLA 1YITV 3ZRVA 1VQ5V 2ITCC 5CA0B 3UT5A 1SZTA 4FVMA 4MS2A 2JGDB 1YF2A 4KFMA 4MVMA 2YI9A 5H2FZ 2UUBO 2FKXA 3UQ8A 4TUYB 2Y69B 3K08A 3LNMB 3TETA 1VMGA 3LDCA 3EVKA 1JCHA 1KU9A 2N04A 2P5OA 4U7NA 4I0XA 3AG1C 4LCUC 5KAFZ 3F5TA 1AI6A 2CAZC 2DWDC 5IJ0A 4UCTA 1JFFB 1YIJV 3UO3A 4E2LA 4UVCA 1LUWA 1Q6UA 4JI8O 4K0KO 3ABLB 1M4UA 5J2UB 1KBHA 1MNGA 5IYBO 2UUAB 1GM9A 4DUZB 3G6BA 4ZHQA 4MTFA 4HZ3A 4I9QA 3D36A 1XREA 3S3WA 1XBLA 5LHIA 5C8YB 1HNXO 4L87A 4WCEV 1VQ9V 1B3QA 4ZIBA 4JTCB 4LFAB 3KG2A 1ZLZA 1MMMA 1PD3A 2BTQB 1HNWO 5JQGA 4BW5A 3CD6V 4UB8Z 1GRJA 2YS8A 2KG7B 3K0GA 4JI8B 4BW9A 1AROP 2WWWA 2HLDG 2V4DA 2ILMA 1S76D 3G71V 3FYEB 1SQFA 5B1BC 4O4JA 3RT3C 3OAAG 2X6CA 3LNNA 2Q0OC 2UXDO 4LP8A 1BL8A 1L0LH 3JATA 5HFMA 4JI0O 2JRIA 3K79A 3AG3B 1G8MA 2JS3A 4RWUA 1XNQB 1H2KA 1M56C 4DR5O 3JD3A 4YJ2B 3DXRB 3UM7A 5L3FA 5JQGB 2H8PC 3S3XA 3QF7A 3B8MA 2IH1C 4NVPA 2GBOA 4Q20A 1THZA 3OGCC 4IT5A 4MVZA 3RBZA 2L35A 2ZE8A 4PDVA 1WPXA 1J5EB 4O4HA 4IYIA 1I5XA 2LW7A 3AK3A 3ABTA 4KUMA 1DF5A 1H38A 4JI3B 2UU9B 4O2AA 4WFEA 4I55B 1IBMB 2JDIG 2OT5A 1QR9A 5JCOA 3JAKA 4DV7O 3KDRA 1D5AA 1VF6C 2NLJC 3E8BA 3RYHA 2W0FC 5LYJA 1F7YA 3OFNG 4FLUA 5IWAB 1B6QA 2D3OW 5FNVA 1OCCC 1HW7A 1AP5A 2CTQA 4JTDB 3SR2C 5EK0A 1XMQO 1YEWA 3BY6A 4DV0B 5ITZA 2VQFO 1S0VA 2X0LA 5BMVA 3UO2A 3E83A 1FS0G 4H0LB 2UXCO 3K9AA 4O2AB 2DN9A 5L3GA 4FZ0A 1NH2D 4ZI7A 3BCCH 2XAGA 2IH3C 2QKCA 3FX7A 3O9OA 2HHHB 4E4EA 5FNVB 1M1KW 2WLKA 4CH5A 1MG1A 2CGNA 1K7DA 2M6YA 4TT3G 4ZKIA 1VQPV 3L71H 3K5NA 4KHPO 1SS3A 4X65O 2CTRA 1VF7A 3VQWA 1P7GA 3E35A 5AG2A 1I94O 1DGSA 3GVMA 2R9IA 5CBHA 4LF9B 4NXMB 5LXTA 4L8JA 1LNQA 1K4CC 5LBQA 2QWPB 3OMNB 5BZBA 1URFA 5B1OA 1ORQC 3LDDA 3P3NA 3GWKC 2RJZA 2UXXA 1EN5A 3PN1A 1SQVH 4NTXA 4PA7A 3OE7G 2HG5C 2ZXWB 1K5SA 3D8CA 3C3SA 1VF5B 3H01A 4YHHO 4UFZA 2BE3A 4EB6A 4B7KA 1WPBA 5BR8O 3T1CA 2JEXA 2B1GA 4ASUG 4PA9A 1Z5VA 3G67A 1KP2A 4CH4A 3SJAC 4J9ZB 4MSWC 2JIZG 3I5DA 4K3AA 2GHYA 4BIUA 2CGOA 1XDCA 4JI7O 5J9PC 2ZM6O 4PA4A 3B40A 4LF4O 4XDLA 1IBLO 1YZBA 4RO2A 2VWJA 4U3JA 2YSUB 2V1DA 1YDXA 4EB6B 2CE4A 2ODMA 5CMUA 4WFFA 1QR8A 2Y0IA 2Y4UA 4NR1A 5KMGA 4CH6A 3OUFA 2JS5A 2H94A 4X66B 3DC5A 4DV5B 5KUMA
chains in the Genus database with same CATH topology
1XUQA 2GDSA 1JA8A 4GUNA 4JZ2A 1GN6A 4X9QA 1LUVA 1P7GA 1XILA 4FFKA 1EM1A 5AG2A 1WB8A 3TJTA 1SZXA 1N0JA 3MDSA 1MSDA 2ADQB 1AR4A 4BR6A 1AVMA 3IC9A 2RCVA 1GN4A 4JYYA 1PL4A 4YIOA 1EN5A 3AK1A 3EVKA 2ADPA 1I08A 1ZUQA 3AK3A 2QKAA 1MA1A 3C3SA 1PM9A 2AW9A 1Y67A 3CEIA 3LSUA 1B06A 3QVNA 3KDRA 2CDYA 1LUWA 1ZSPA 4JZGA 1ZTEA 3K9SA 1VEWA 3BFRA 1MNGA 3RN4A 1AP5A 1N0NA 3AK2A 1GN2A 3C3TA 1XDCA 4F6EA 3OT7A 1XREA 1WB7A 1D5NA 2P4KA 5A9GA 1BT8A 1IXBA 1EN4A 1JR9A 1KKCA 1GN3A 1AP6A 1BSMA 4YIPA 3KKYA 3DC6A 2CE4A 1IX9A 1ZLZA 1QNMA 1BS3A 1MMMA 4C7UA 1I0HA 1EN6A 2QKCA 1AR5A 4E4EA 3DC5A 1IDSA 1VARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XUQ A;  2GDS A;  1JA8 A;  4GUN A;  4JZ2 A;  1GN6 A;  4X9Q A;  1LUV A;  1P7G A;  1XIL A;  4FFK A;  1EM1 A;  5AG2 A;  1WB8 A;  3TJT A;  1SZX A;  1N0J A;  3MDS A;  1MSD A;  2ADQ B;  1AR4 A;  4BR6 A;  1AVM A;  3IC9 A;  2RCV A;  1GN4 A;  4JYY A;  1PL4 A;  4YIO A;  1EN5 A;  3AK1 A;  3EVK A;  2ADP A;  1I08 A;  1ZUQ A;  3AK3 A;  2QKA A;  1MA1 A;  3C3S A;  1PM9 A;  2AW9 A;  1Y67 A;  3CEI A;  3LSU A;  1B06 A;  3QVN A;  2CDY A;  1LUW A;  1ZSP A;  4JZG A;  1ZTE A;  3K9S A;  1VEW A;  3BFR A;  1MNG A;  3RN4 A;  1AP5 A;  1N0N A;  3AK2 A;  1GN2 A;  3C3T A;  1XDC A;  4F6E A;  3OT7 A;  1XRE A;  1WB7 A;  1D5N A;  2P4K A;  5A9G A;  1BT8 A;  1IXB A;  1EN4 A;  1JR9 A;  1KKC A;  1GN3 A;  1AP6 A;  1BSM A;  4YIP A;  3KKY A;  3DC6 A;  2CE4 A;  1IX9 A;  1ZLZ A;  1QNM A;  1BS3 A;  1MMM A;  4C7U A;  1I0H A;  1EN6 A;  2QKC A;  1AR5 A;  4E4E A;  3DC5 A;  1IDS A;  1VAR A; 
#chains in the Genus database with same CATH topology
 5LHH A;  4DK0 A;  3RYC B;  1SET A;  1JA8 A;  1JX9 A;  1Q82 W;  1DK1 A;  3CXH F;  4FM0 A;  4EFB A;  3P30 A;  3ZMZ A;  4JI7 B;  2Y69 C;  4J11 A;  3I55 V;  1FJG B;  5GTI Z;  3JD0 A;  4LF5 O;  2YUA A;  4CC5 A;  4UCS A;  1F4M A;  1Y76 A;  3L75 H;  2BCC H;  1FXK B;  3N2K B;  3TK1 A;  2GTA A;  2IJH A;  2W0X A;  1XL4 A;  1AVM A;  1FKA O;  4OX9 B;  4JV5 O;  4FFB A;  3U0Z A;  3RFR A;  3TXS A;  2XAQ A;  3ABL C;  4GZR B;  2CTW A;  4D7S A;  3RVY A;  2HJD A;  3STL C;  3KCX A;  5LP6 A;  1FFT B;  3H1H H;  3E8F A;  1TUB B;  2FL4 A;  2QKA A;  3B8N A;  1Y4M A;  3CRQ A;  4FJC C;  2OIG A;  1P84 F;  3W7S A;  4ABM A;  1Y76 B;  4DV1 B;  2EX3 A;  4DR7 B;  1XNR B;  2OTL V;  2DQ3 A;  1Q6H A;  5B1B B;  4X1Y B;  3VBB A;  3AK2 A;  1Q86 W;  3JCU Z;  1RP3 B;  1EBO A;  5LOV A;  2GUZ A;  1K73 W;  3BA8 A;  5LGU A;  1AJP A;  2XOK G;  5E79 Z;  2P4K A;  4DV3 O;  4TV9 B;  1GO3 F;  2BOC C;  4JF3 A;  3D36 C;  1GKF A;  2A9H A;  1SKV A;  5H9C A;  2QM8 A;  2EBO A;  1QNM A;  3O65 A;  5FPR A;  4DR2 O;  2B5U A;  1Q8I A;  1S5H C;  3AG3 C;  4G2K A;  3E89 A;  4J7K A;  4NYK A;  1WNS A;  4DXW A;  3LSQ A;  2ZNJ A;  4WFA V;  4DV4 O;  3ML0 A;  2OYQ A;  2V7Q G;  2AXT Z;  1R3L C;  4PDM A;  4DK1 A;  1NVP B;  3AG4 B;  4QE7 A;  1TUE B;  3WB0 A;  3MD0 A;  5A2Q N;  1OCC B;  2EIJ B;  1Q7Y W;  3OTO B;  3HKD A;  2YEV A;  1ZAU A;  1AR4 A;  4U7O A;  1VP7 A;  3BPZ A;  2EIL B;  3ETG A;  5H5N A;  2XND G;  2JJ1 G;  2Q5Z A;  3ZS8 C;  1UPG A;  3ABM B;  4LF8 O;  1BHA A;  1KQS U;  1IXM A;  3HKC B;  5EZY B;  1TAE A;  3K0D A;  1XI1 A;  5CBF A;  2XAS A;  2XAH A;  2UUC O;  5KLV H;  1H8E G;  3L72 H;  1QLE C;  2HFE C;  1DTO A;  5KA5 A;  3T1Y O;  1XMO B;  3K57 A;  4UUJ C;  4PD4 F;  2IJK A;  2R9R B;  1FFX A;  2ZE7 A;  5JCO C;  4O4L A;  1Q81 W;  4X8A A;  4UVB A;  2LFR A;  4JI4 B;  2DE0 X;  4JGS A;  4PDL A;  1N33 B;  3OR7 C;  3HKB B;  5A9G A;  4X20 B;  1WJZ A;  3B09 A;  4F6R B;  5LL6 Y;  4GKJ B;  2BSK A;  3LUT B;  5LMU O;  3STZ C;  3Q4H A;  3QNE A;  4LH7 A;  2UUC B;  2XHB A;  5EYP A;  5D5P A;  4O2B A;  3CRR A;  1MZF A;  1NH2 B;  1SER A;  1QU7 A;  3ZJZ A;  3TGU H;  1FFX B;  3QTC A;  1ZX3 A;  4J42 A;  1R73 A;  2F1M A;  5BXZ A;  2Q7H A;  4JI6 O;  4B3S O;  1US6 A;  2F43 G;  3VQV A;  5E1A C;  2F4V O;  4UCU A;  1LUV A;  4LF7 B;  1EM1 A;  1SC5 B;  3SPG A;  3BVO A;  1IVS A;  4LFB B;  1S5J A;  4XDK A;  2IW5 A;  1KEC A;  3G4S V;  2N74 A;  3MDS A;  3Q4H B;  4B3M B;  5IT9 N;  1MSD A;  3QO8 A;  4DV2 O;  2WLM A;  2QWN B;  4DUY O;  1R3J C;  2RCV A;  4FM1 A;  3CRM A;  4HYO A;  1PL4 A;  1S3J A;  4WFB V;  3CB2 A;  1VQL V;  2EJ7 A;  1FPO A;  1N36 B;  1DF4 A;  2Q9L A;  2FML A;  2WLJ A;  3ZHT A;  4AQY O;  1KUQ A;  1YHQ V;  4YXW G;  2XUM A;  2XTA A;  3JSL A;  4PV1 B;  4RAI A;  3FKS G;  3CC2 V;  1GTO A;  4RUE A;  4GX0 A;  2P6J A;  2WLI B;  3HKE A;  1JJ2 U;  3ASO B;  2PYL A;  2AW9 A;  2YXY A;  2H3O A;  4OGQ B;  1EZV H;  1VQ4 V;  2ZQM A;  1W59 A;  1ZSP A;  2WLL A;  4LH6 A;  1PKX A;  4J7J A;  1GAX A;  1GM7 A;  1QBZ A;  3T1H O;  4F4L A;  1H2S B;  5L3C A;  4DV6 O;  1HNZ B;  3W7U A;  1N32 O;  5JVD A;  2M7W A;  2JEU A;  4LWS A;  5LGN A;  3FFQ A;  1KKC A;  2QTS A;  4AQY B;  5EBM C;  3UT5 B;  3HKE B;  3L74 H;  4FIP C;  5IYC O;  3CXC U;  3WB2 A;  5J2T A;  2Q0A A;  3H1I H;  1HDJ A;  1WP8 A;  1SQQ H;  5JWP A;  3F7V C;  3LDE A;  2WLL B;  4TOI A;  1FXK C;  1OCR B;  1BE3 H;  1XHX A;  3RVZ A;  2UUB B;  5KAI Z;  3ZHQ A;  4DR1 O;  3EHB B;  1SQP H;  4I0X B;  4G28 B;  2YXL A;  3CC4 V;  1NJI W;  1NKD A;  2YC0 A;  3A0H Z;  4DR6 O;  2P22 C;  5IJ0 B;  4DV6 B;  3CX5 F;  2AZ0 A;  5FL7 G;  1N0J A;  3ASN B;  1SA0 A;  2WLN A;  3SJQ C;  3CE2 A;  2QDO A;  1NTM H;  3K3W A;  3CSX A;  4K0K B;  3WFV A;  1OHH G;  4CBC A;  1NVP D;  4OPH A;  4JYY A;  1YCI A;  4YIO A;  1HWY A;  4ZHQ B;  2QEX V;  2VQE O;  3QO7 A;  4I4T A;  4DW0 A;  4WF9 V;  1NR7 A;  3ZRX A;  1RM1 B;  1P4R A;  2ZDI C;  3H1L H;  1BQ0 A;  4K8X A;  1HNX B;  4CH3 A;  4J80 A;  3SPJ A;  2RDC A;  1AR1 B;  3NXS A;  3M7M X;  4MT8 A;  5LMN O;  3QVN A;  3CYO A;  1KP3 A;  3ZHS A;  3SYQ A;  1HNW B;  4IL6 Z;  2YI8 A;  3RN4 A;  3C90 A;  1SES A;  1N0N A;  4NXN O;  4FLY A;  2YDE A;  3APO A;  3AG2 B;  3IFX A;  4LFC O;  2JJ2 G;  3C3T A;  3WG7 B;  4O4J B;  3H9V A;  3OR6 C;  1K4D C;  1TA8 A;  4I50 A;  3H1K H;  5K1P A;  4HNA A;  4MVO A;  3CCL V;  2XT9 A;  3ZRS A;  3JAT B;  4X1K A;  1BSM A;  4TQF A;  1QVG U;  2QWR B;  2UXD B;  2YXH A;  3AG4 C;  1CPY A;  4JI0 B;  1DLB A;  2P4V A;  1BS3 A;  2EIJ C;  2HEP A;  4R6Z A;  4DR5 B;  3DGE A;  2XAJ A;  1PNM A;  3JAR A;  2VWK A;  2Q73 A;  1VAR A;  2EIL C;  2EZP A;  4JTA B;  1QLE B;  5CA1 A;  2O57 A;  4O4H B;  2E5L O;  1Q6I A;  1K9M W;  2OCC B;  2R72 A;  3ZHU A;  3ABM C;  1HR0 O;  2P06 A;  4X64 O;  3CCM V;  3JAK B;  3CC7 V;  3SJC C;  5LGT A;  5JH7 A;  3RYH B;  2D2C B;  3HR0 A;  2K1E A;  4LNU A;  5LYJ B;  2ZKO A;  4DV7 B;  4GKK O;  1K33 A;  4DRX A;  2X7R B;  4J9Y B;  5JJJ B;  5EC1 C;  4B3T O;  3A0B Z;  4FLV A;  2HKO A;  3T4D A;  4B08 A;  2MW2 B;  5CA1 B;  4AIL C;  5ITZ B;  5FLX N;  2ADP A;  5BMV B;  1XMQ B;  1FOU A;  2ZCE A;  2VQF B;  1IUR A;  4RQF A;  2E5L B;  3JSN A;  3THO A;  2EIM B;  2QTO A;  4CZZ A;  5KA6 A;  4BIO A;  4CS4 A;  1RSO A;  2UXC B;  1V9P A;  4YY3 O;  2EIN B;  4ZI7 B;  2F93 B;  1Y67 A;  3AG7 A;  2EZO A;  1OCZ B;  4R50 A;  1X59 A;  2L6L A;  4MTO A;  2AZ2 A;  1SRY A;  4R8C A;  4GKK B;  3T2M A;  4AHC A;  3CCE V;  4MTX A;  1WP7 A;  1TVK A;  3ZX6 A;  1S77 D;  4X1I A;  1T5E A;  3SPH A;  4KHP B;  5C93 A;  5IDJ A;  1NZ6 A;  4X65 B;  3JAS A;  3MHH C;  2E76 B;  3BAA A;  4H13 B;  1CP9 A;  2MK3 A;  5GON A;  1I94 B;  1JR9 A;  5LXT B;  3E22 A;  1XQ8 A;  3ZHV A;  2Y4T A;  2HVK C;  4LF6 O;  1RSO B;  1R3K C;  4UV8 A;  1Q5O A;  3E86 A;  2BOB C;  4DW1 A;  1H8H G;  4DR4 O;  4YY3 B;  5B3S C;  1AR5 A;  5IY5 B;  1K8A W;  1VQK V;  4UB6 Z;  1TVK B;  1XUQ A;  4KP4 A;  4DR3 O;  5IE9 A;  2UXB O;  3SYO A;  1XIL A;  2EIK B;  2B1I A;  1WB8 A;  3B4S A;  3E22 B;  4EEQ A;  1EFR G;  4YHH B;  3CP1 A;  4B3R O;  1FYJ A;  3L9D A;  3BA9 A;  3X2Q B;  5BR8 B;  2CK3 G;  3E8G A;  4R7C A;  3ASO C;  1K92 A;  3ZMU A;  4RUF A;  2PYJ A;  2PGG A;  4DR4 B;  2LW1 A;  3MAQ A;  1COW G;  3CCQ V;  2ZR2 A;  4JYA O;  3VQX A;  2ZM6 B;  4NTY A;  1JOY A;  3JD2 A;  3FAV A;  4LF4 B;  4U3J B;  4BIZ A;  1IBL B;  1AJQ A;  1IZ3 A;  3L73 H;  1YJN V;  4D6T H;  5CN0 A;  2AGA A;  2DQ0 A;  4JAV A;  5KMG B;  3LSU A;  4B3R B;  3J80 N;  3DSQ A;  3W7W A;  1BGY H;  4JZG A;  1ZTE A;  3EFF K;  4YJ3 A;  1VEW A;  2YIB A;  1ZL8 A;  4KL1 A;  4Q6G A;  5JJE B;  5IYD O;  4ZBM A;  1BCC H;  1MAB G;  2UXN A;  2YIA A;  1PV0 A;  3ETE A;  3ZMT A;  4NKG B;  4PA6 A;  1OCR C;  4UCV A;  1P49 A;  3OT7 A;  1ENV A;  1E79 G;  4TV8 A;  1MZE A;  5KHJ A;  3FB6 C;  3U10 A;  4LF5 B;  4FFB B;  1NR1 A;  1JJO A;  3OMI B;  4XBF A;  2BTO A;  2DWE C;  2DYR B;  4X88 A;  3ASN C;  1OCO B;  1BQZ A;  3APQ A;  4JV5 B;  4LC1 A;  2NR5 A;  4IIJ A;  1RFY A;  4BAY A;  2PY5 A;  3F5W C;  4O4I A;  2WPD G;  4JZ2 A;  5LP6 B;  1XOU A;  2RN9 A;  5H6R A;  1JNB A;  1WA8 A;  1JQ0 A;  2Q67 A;  1RM1 C;  2Q6A A;  5CA3 A;  2YID A;  1VF6 A;  2JK5 C;  2Z5U A;  2B9Z A;  2OIE A;  1H2N A;  1SQG A;  1KB9 F;  2WLH A;  4JAS A;  2FTK A;  2GV9 A;  3L70 H;  4WBN A;  1KD1 W;  5LOV B;  2GUZ B;  1GM8 A;  3CMA V;  3CCJ V;  3IGA C;  1VQ8 V;  3SDL A;  4FPP A;  3N2G A;  3AG2 C;  4QPK A;  4DV3 B;  3RYF A;  1YVW A;  4LBE C;  1WA8 B;  1Q43 A;  3WG7 C;  1V54 B;  1M57 C;  4QJF B;  3CWB H;  3FYI B;  4UXN A;  3CCR V;  3G80 A;  3JYC A;  3A2F A;  3R65 A;  3CEI A;  4DR2 B;  3OW2 U;  1N34 O;  4NTW A;  3G6E V;  2A79 B;  4IGG A;  5KUK A;  1CXZ B;  3BFR A;  1M9N A;  4GYC B;  4IHJ A;  1Y66 A;  3W7T A;  4DV4 B;  2IM9 A;  3B2E E;  4KXR A;  1I5Y A;  2KB1 A;  2A06 H;  2QE7 G;  3RYF B;  1W2B U;  1Y74 A;  3HKD B;  2OCC C;  2YEV B;  3CS5 A;  2ZE6 A;  4N23 A;  2IJI A;  1OV9 A;  2A7W A;  1PNK A;  2EJR A;  5KX5 A;  3OD4 A;  2F23 A;  4IHJ B;  4LF8 B;  4FK5 C;  4B7E A;  4FLZ A;  1CEZ A;  5GW7 A;  2X6B A;  3RYI A;  1WN7 A;  2Q4P A;  3KCY A;  2ZIM A;  4IYH A;  2QWQ B;  2NN4 A;  1S5L Z;  2ZE5 A;  1MSW D;  2RQ6 A;  1NU1 H;  5IYZ A;  1R6T A;  2EIM C;  3T1Y B;  1AJN A;  4O4L B;  2EIN C;  4PI2 A;  5KX5 B;  4OXS A;  1W0K G;  4NB5 A;  3OUS A;  3W7X A;  1OCZ C;  2Q69 A;  4K8Z A;  1FAF A;  1K97 A;  1AI4 A;  1K5Q A;  4PHZ A;  1R1B A;  1L0N H;  3ZMS A;  2BSK B;  4J10 A;  2QM7 A;  2ZNI A;  5B3S B;  2FB5 A;  3OM3 B;  2PI5 A;  5EYP B;  5LMU B;  4FMT A;  4O2B B;  1B06 A;  1J95 A;  4EKW A;  2LGW A;  2CDY A;  4JI5 O;  5CA0 A;  4JI1 O;  4W4K A;  4TSF G;  3KZI Z;  3CPW U;  2JGD A;  4Z2W A;  5IY5 C;  2PF4 E;  2Z3Y A;  4JI6 B;  4B3S B;  1YJ9 V;  4EFE A;  3HB3 B;  2F4V B;  3OTF A;  4TUY A;  4X89 A;  1M93 A;  3FD9 A;  4MVU A;  1FXV A;  1AP6 A;  4YIP A;  2EIK C;  1YTF D;  1IX9 A;  1O9G A;  4DV2 B;  5EIB D;  2ETN A;  1WLE A;  2W6J G;  1JFF A;  3X2Q C;  4DUY B;  1EN6 A;  1YXB A;  2C2A A;  4UV9 A;  2LFS A;  4D7T A;  3ICX A;  4DYL A;  3JD4 A;  4MW3 A;  4J41 A;  4JI5 B;  2UUA O;  4JI1 B;  5J2U A;  1GMG A;  1X4T A;  4DUZ O;  2LQT A;  5BY1 A;  3JAM N;  4GUN A;  1OJH A;  3CRC A;  2VRZ A;  3QG5 A;  2PZS A;  3ZBH A;  4FLT A;  1OZ0 A;  1Z2G A;  4CC6 A;  2YIB D;  2E74 B;  3RGB A;  3H1J H;  5C8Y A;  4LFA O;  2EUL A;  3BAB A;  1WAZ A;  1IBK O;  2BTQ A;  3RW0 A;  1ROP A;  4G27 B;  4JAA A;  1NBM G;  5JVD B;  3T1H B;  2DOS A;  4LWS B;  2KG7 A;  1G1X B;  1N32 B;  1F4N A;  1B04 A;  2QM4 A;  2ZR3 A;  1FD9 A;  5EIB C;  2R9A A;  5J2T B;  1VQM V;  1MA1 A;  5F2V O;  1EZJ A;  4MVS A;  1JPX A;  2OTJ V;  1FXH A;  1XNQ O;  1SQX H;  4N21 A;  2Q68 A;  3QO5 A;  3GWO A;  1Z5W A;  4JAU A;  3CHX A;  2DYS B;  4YJ2 A;  2DYR C;  3DXR A;  1OCO C;  3JD1 A;  1QCE A;  1NTZ H;  4P2Z A;  4DR1 B;  1IBK B;  2X6A A;  4GX1 A;  3D3Q A;  1VQ6 V;  1AI7 A;  3A0R A;  1WB7 A;  4DR6 B;  1D5N A;  4H37 A;  1J5E O;  3ZED A;  3P32 A;  1IXB A;  5LP6 C;  1SA0 B;  2K9P A;  3VQY A;  1E1Q G;  3I56 V;  1AI5 A;  4JI3 O;  2UU9 O;  1IJG A;  1IBM O;  1XL6 A;  3DC6 A;  3ZMV A;  1K34 A;  2P90 A;  2DJV A;  4DO2 A;  2G38 A;  2A3Q A;  4I55 A;  3VOU A;  5B1A B;  1I0H A;  3D3I A;  3ZHR A;  5IWA O;  3J7A U;  1KYO F;  1M57 B;  2DW4 A;  2VQE B;  2WSS G;  4I4T B;  1VIB A;  5DM6 V;  1YJW V;  2ATK C;  4X9Q A;  2PI4 A;  1PL0 A;  4DV0 O;  1R6K A;  1H2G A;  3TXQ A;  3K06 A;  3BRC A;  2QA4 V;  1V54 C;  3IAY A;  5LMN B;  2ADQ B;  4PA3 A;  2LO1 A;  2HHH O;  4JPR A;  1GN4 A;  4NXN B;  1BHB A;  4LFC B;  4I50 B;  4W4L A;  5GTH Z;  4HNA B;  5KHH A;  4P9P A;  1R3I C;  4X1K B;  4RQE A;  3AK1 A;  3BEH A;  3K5O A;  2A0L A;  1L1F A;  2WAM A;  5LHG A;  4LF9 O;  4NXM O;  4I5S A;  4CS2 A;  3OEH G;  4GX2 A;  3SPC A;  1LR1 A;  3DTU B;  3JAR B;  4U3F H;  2F66 C;  3FB7 C;  5KHG A;  1RPO A;  3CRA A;  1PP9 H;  1H2M A;  3ABK B;  3K5L A;  3CCV V;  2JVD A;  3OGI B;  2KKW A;  2Q7G A;  1M5I A;  1HR0 B;  3J81 N;  5JH7 B;  2PUS A;  4X64 B;  4LNU B;  1NS1 A;  5EBL C;  3FB8 C;  3AEI A;  5FPO A;  5IJ9 A;  4DRX B;  2QJ1 A;  2LP7 A;  2FYU H;  1JMK C;  1V55 B;  4B3T B;  4X62 O;  4QNH B;  3FB5 C;  4XDJ A;  1BZK A;  3U11 A;  1GN6 A;  3OEE G;  4LR3 A;  3ABU A;  4FFK A;  4UVA A;  4GLX A;  3NR7 A;  2HP8 A;  1O9H A;  1NQT A;  1SZX A;  1UFI A;  5B5E Z;  1QHT A;  5IJ9 B;  1UJW B;  5K1X A;  2HR3 A;  4BR6 A;  5CBG A;  1H2L A;  1PPJ H;  4JYC A;  4QPJ A;  4X1I B;  2Q8V A;  4X66 O;  4J7Z A;  4DV5 O;  3JAS B;  4X62 B;  4ICG A;  1F51 A;  5GON B;  1G6U A;  2QWO B;  3RYC A;  5KHK A;  4QE9 A;  3T4Z A;  1I08 A;  2KQX A;  1FJG O;  5DED A;  2QR4 A;  4I7Z B;  2JGU A;  4UCR A;  4LF6 B;  1ZWI C;  5DEC A;  4TQD A;  1PM9 A;  2HJF C;  2IU3 A;  1HP8 A;  1QVF U;  3CCU V;  1GH6 A;  4PJ0 Z;  1D2D A;  2E75 B;  3K9S A;  1U97 A;  4OX9 O;  1FXK A;  3N2K A;  2IU0 A;  3UKM A;  4MVR A;  5DN6 G;  4GCZ A;  1KC8 W;  1SQB H;  3AG1 B;  3K59 A;  4DR3 B;  2RMK B;  1QLN A;  2UXB B;  2RNB A;  3JAL A;  1TGO A;  2CTP A;  2F95 B;  1EN4 A;  3IJ4 A;  1GN3 A;  2LJ2 A;  1TUB A;  5LA6 A;  4HAM A;  4DV1 O;  1MOF A;  1KMI Z;  4DR7 O;  1YTF B;  5L3B A;  1XNR O;  1E1R G;  2PTM A;  3CJH A;  3IC7 A;  5CB4 A;  4X1Y A;  4JYA B;  3FAV B;  3HPL C;  1W0J G;  2IJJ A;  2ZDI A;  3JAL B;  3P3P A;  5L3E A;  2W6I G;  2ZIO A;  4TV9 A;  1XHZ A;  1NTK H;  3K5M A;  1NT2 B;  1K3E A;  2ARH A;  1VQN V;  5LA6 B;  4YJ3 B;  1ZL8 B;  3MHS C;  3SPI A;  4WFH A;  2GTS A;  1Q3E A;  3ETD A;  3ZIA G;  3IC9 A;  4MVQ A;  5H6Q A;  3JAW A;  4P9O A;  1Y6X A;  3CJH B;  1RPR A;  5CB4 B;  4FLW A;  4TV8 B;  2DYS C;  3OMA B;  2CH7 A;  2P7T C;  3EXA A;  4GT1 A;  2XAF A;  4AI8 A;  5B1N A;  5L3D A;  1AIL A;  2QGN A;  3K03 A;  4MW8 A;  2LGQ A;  1M56 B;  2VS0 A;  3OTO O;  5EC2 C;  1YSC A;  2YIC A;  3F7Y C;  4WFG A;  3UCS C;  4IIJ B;  1U96 A;  5EBW C;  4O4I B;  3JAW B;  2ITD C;  5B1A C;  4Z1V A;  1SF9 A;  1YI2 V;  3M99 B;  5D5Q A;  4Z1M G;  4F6E A;  2HVJ C;  3RWR D;  4FZ1 A;  2CH7 B;  3WB1 A;  5EZY A;  4UCO A;  3HKC A;  5B66 Z;  2OWO A;  4ZOL A;  4PDR A;  1A32 A;  1NI8 A;  5JJN B;  1XMO O;  4WBN B;  4PEL A;  4MTG A;  4BWA A;  1L8D A;  1VQO V;  1KKD A;  1JVM A;  5KHI A;  3R66 A;  3N2G B;  2Y48 A;  3SGI A;  2OCH A;  4JI4 O;  1N33 O;  4I9W A;  1H5W A;  4HBN A;  2DMX A;  1G4Y B;  5TIS Z;  2GSM B;  2AHZ A;  3A8T A;  4CS3 A;  1AB3 A;  3TJT A;  3HKB A;  4GKJ O;  4X20 A;  4ZOL B;  4F6R A;  3PJS K;  4QIW F;  1N34 B;  2WA3 A;  2KSD A;  2NNU A;  1QQC A;  1I7F A;  4A5U B;  4H33 A;  4FLX A;  4QGP A;  3BHP A;  2Z0A A;  3N27 A;  3SYP A;  2AHY A;  3ABK C;  3ZN1 A;  4P30 A;  4LF7 O;  1Y74 B;  3E8H A;  4JI2 O;  1ZUQ A;  1BMF G;  4LFB O;  4FM2 A;  2IBZ H;  2Q7E A;  2R70 A;  1GK9 A;  1N8R W;  4B3M O;  4GX5 A;  2P67 A;  3M8A A;  4K35 A;  2N05 A;  1M90 W;  3ZRW A;  1N36 O;  1V55 C;  4JYB A;  1GN2 A;  2Y0P A;  3CCS V;  2ZD9 A;  3SYC A;  3RYI B;  1N4C A;  3ZCC A;  3WU2 Z;  1Q90 D;  1BT8 A;  3SJB C;  5IYZ B;  2ZIN A;  1PNL A;  3KKY A;  3B77 A;  1F23 A;  3LSS A;  3TCU A;  4OPA A;  1VQ7 V;  4JI2 B;  3K58 A;  4H44 B;  2WLI A;  3JCZ A;  1XEQ A;  3E2E A;  1R6N A;  4C7U A;  2CUG A;  4TWK A;  2ZXW C;  1S72 V;  3CME V;  3ZN0 A;  3ZRW B;  4PI0 A;  3SYA A;  3GB7 C;  1IDS A;  2ZT9 B;  2QSA A;  3ETQ A;  2GDS A;  1HNZ O;  2WA4 A;  3K04 A;  2QKS A;  2E3C A;  1P7B A;  5HFL A;  1YIT V;  3ZRV A;  1VQ5 V;  2ITC C;  5CA0 B;  3UT5 A;  1SZT A;  4FVM A;  4MS2 A;  2JGD B;  1YF2 A;  4KFM A;  4MVM A;  2YI9 A;  5H2F Z;  2UUB O;  2FKX A;  3UQ8 A;  4TUY B;  2Y69 B;  3K08 A;  3LNM B;  3TET A;  1VMG A;  3LDC A;  3EVK A;  1JCH A;  1KU9 A;  2N04 A;  2P5O A;  4U7N A;  4I0X A;  3AG1 C;  4LCU C;  5KAF Z;  3F5T A;  1AI6 A;  2CAZ C;  2DWD C;  5IJ0 A;  4UCT A;  1JFF B;  1YIJ V;  3UO3 A;  4E2L A;  4UVC A;  1LUW A;  1Q6U A;  4JI8 O;  4K0K O;  3ABL B;  1M4U A;  5J2U B;  1KBH A;  1MNG A;  5IYB O;  2UUA B;  1GM9 A;  4DUZ B;  3G6B A;  4ZHQ A;  4MTF A;  4HZ3 A;  4I9Q A;  3D36 A;  1XRE A;  3S3W A;  1XBL A;  5LHI A;  5C8Y B;  1HNX O;  4L87 A;  4WCE V;  1VQ9 V;  1B3Q A;  4ZIB A;  4JTC B;  4LFA B;  3KG2 A;  1ZLZ A;  1MMM A;  1PD3 A;  2BTQ B;  1HNW O;  5JQG A;  4BW5 A;  3CD6 V;  4UB8 Z;  1GRJ A;  2YS8 A;  2KG7 B;  3K0G A;  4JI8 B;  4BW9 A;  1ARO P;  2WWW A;  2HLD G;  2V4D A;  2ILM A;  1S76 D;  3G71 V;  3FYE B;  1SQF A;  5B1B C;  4O4J A;  3RT3 C;  3OAA G;  2X6C A;  3LNN A;  2Q0O C;  2UXD O;  4LP8 A;  1BL8 A;  1L0L H;  3JAT A;  5HFM A;  4JI0 O;  2JRI A;  3K79 A;  3AG3 B;  1G8M A;  2JS3 A;  4RWU A;  1XNQ B;  1H2K A;  1M56 C;  4DR5 O;  3JD3 A;  4YJ2 B;  3DXR B;  3UM7 A;  5L3F A;  5JQG B;  2H8P C;  3S3X A;  3QF7 A;  3B8M A;  2IH1 C;  4NVP A;  2GBO A;  4Q20 A;  1THZ A;  3OGC C;  4IT5 A;  4MVZ A;  3RBZ A;  2L35 A;  2ZE8 A;  4PDV A;  1WPX A;  1J5E B;  4O4H A;  4IYI A;  1I5X A;  2LW7 A;  3AK3 A;  3ABT A;  4KUM A;  1DF5 A;  1H38 A;  4JI3 B;  2UU9 B;  4O2A A;  4WFE A;  4I55 B;  1IBM B;  2JDI G;  2OT5 A;  1QR9 A;  5JCO A;  3JAK A;  4DV7 O;  3KDR A;  1D5A A;  1VF6 C;  2NLJ C;  3E8B A;  3RYH A;  2W0F C;  5LYJ A;  1F7Y A;  3OFN G;  4FLU A;  5IWA B;  1B6Q A;  2D3O W;  5FNV A;  1OCC C;  1HW7 A;  1AP5 A;  2CTQ A;  4JTD B;  3SR2 C;  5EK0 A;  1XMQ O;  1YEW A;  3BY6 A;  4DV0 B;  5ITZ A;  2VQF O;  1S0V A;  2X0L A;  5BMV A;  3UO2 A;  3E83 A;  1FS0 G;  4H0L B;  2UXC O;  3K9A A;  4O2A B;  2DN9 A;  5L3G A;  4FZ0 A;  1NH2 D;  4ZI7 A;  3BCC H;  2XAG A;  2IH3 C;  2QKC A;  3FX7 A;  3O9O A;  2HHH B;  4E4E A;  5FNV B;  1M1K W;  2WLK A;  4CH5 A;  1MG1 A;  2CGN A;  1K7D A;  2M6Y A;  4TT3 G;  4ZKI A;  1VQP V;  3L71 H;  3K5N A;  4KHP O;  1SS3 A;  4X65 O;  2CTR A;  1VF7 A;  3VQW A;  1P7G A;  3E35 A;  5AG2 A;  1I94 O;  1DGS A;  3GVM A;  2R9I A;  5CBH A;  4LF9 B;  4NXM B;  5LXT A;  4L8J A;  1LNQ A;  1K4C C;  5LBQ A;  2QWP B;  3OMN B;  5BZB A;  1URF A;  5B1O A;  1ORQ C;  3LDD A;  3P3N A;  3GWK C;  2RJZ A;  2UXX A;  1EN5 A;  3PN1 A;  1SQV H;  4NTX A;  4PA7 A;  3OE7 G;  2HG5 C;  2ZXW B;  1K5S A;  3D8C A;  3C3S A;  1VF5 B;  3H01 A;  4YHH O;  4UFZ A;  2BE3 A;  4EB6 A;  4B7K A;  1WPB A;  5BR8 O;  3T1C A;  2JEX A;  2B1G A;  4ASU G;  4PA9 A;  1Z5V A;  3G67 A;  1KP2 A;  4CH4 A;  3SJA C;  4J9Z B;  4MSW C;  2JIZ G;  3I5D A;  4K3A A;  2GHY A;  4BIU A;  2CGO A;  1XDC A;  4JI7 O;  5J9P C;  2ZM6 O;  4PA4 A;  3B40 A;  4LF4 O;  4XDL A;  1IBL O;  1YZB A;  4RO2 A;  2VWJ A;  4U3J A;  2YSU B;  2V1D A;  1YDX A;  4EB6 B;  2CE4 A;  2ODM A;  5CMU A;  4WFF A;  1QR8 A;  2Y0I A;  2Y4U A;  4NR1 A;  5KMG A;  4CH6 A;  3OUF A;  2JS5 A;  2H94 A;  4X66 B;  3DC5 A;  4DV5 B;  5KUM A; 
#chains in the Genus database with same CATH homology
 1XUQ A;  2GDS A;  1JA8 A;  4GUN A;  4JZ2 A;  1GN6 A;  4X9Q A;  1LUV A;  1P7G A;  1XIL A;  4FFK A;  1EM1 A;  5AG2 A;  1WB8 A;  3TJT A;  1SZX A;  1N0J A;  3MDS A;  1MSD A;  2ADQ B;  1AR4 A;  4BR6 A;  1AVM A;  3IC9 A;  2RCV A;  1GN4 A;  4JYY A;  1PL4 A;  4YIO A;  1EN5 A;  3AK1 A;  3EVK A;  2ADP A;  1I08 A;  1ZUQ A;  3AK3 A;  2QKA A;  1MA1 A;  3C3S A;  1PM9 A;  2AW9 A;  1Y67 A;  3CEI A;  3LSU A;  1B06 A;  3QVN A;  3KDR A;  2CDY A;  1LUW A;  1ZSP A;  4JZG A;  1ZTE A;  3K9S A;  1VEW A;  3BFR A;  1MNG A;  3RN4 A;  1AP5 A;  1N0N A;  3AK2 A;  1GN2 A;  3C3T A;  1XDC A;  4F6E A;  3OT7 A;  1XRE A;  1WB7 A;  1D5N A;  2P4K A;  5A9G A;  1BT8 A;  1IXB A;  1EN4 A;  1JR9 A;  1KKC A;  1GN3 A;  1AP6 A;  1BSM A;  4YIP A;  3KKY A;  3DC6 A;  2CE4 A;  1IX9 A;  1ZLZ A;  1QNM A;  1BS3 A;  1MMM A;  4C7U A;  1I0H A;  1EN6 A;  2QKC A;  1AR5 A;  4E4E A;  3DC5 A;  1IDS A;  1VAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...