4E4EA

Crystal structure of the y34f mutant of saccharomyces cerevisiae manganese superoxide dismutase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
204
structure length
190
Chain Sequence
VTLPDLWDFGALEPYISGQINELHYTHHQTFVNGFNTAVDQFQELSDLLAEPSPANARMIAIQQNIFHGGGFTNHCLFWENLAPESQGGGEPPTGALAAIDEQFGSLDELILTNTLAGVQGSGWAFIVNLSNGGLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNADYFAIWNVVNWEASRRFDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Six-coordinate manganese(3+) in catalysis by yeast manganese superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 64
structure length 190
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4e4eA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4e4eA02
1EM1A 5AG2A 4YIPA 1JR9A 1ZLZA 4GUNA 2ADQB 4FFKA 1AR4A 1ZTEA 3KKYA 2AW9A 4C7UA 3MDSA 1WB8A 4YIOA 1GN4A 4JZ2A 4JYYA 1N0JA 1LUWA 1AVMA 1PM9A 1QNMA 1AP6A 4E4EA 3CEIA 2CE4A 2QKCA 1AR5A 3AK1A 1ZSPA 3EVKA 1LUVA 1WB7A 1N0NA 3AK3A 1I0HA 1EN4A 3K9SA 5A9GA 1EN5A 3DC6A 4BR6A 1MA1A 1GN2A 1MNGA 1MSDA 3OT7A 1XDCA 1JA8A 1XREA 1Y67A 1AP5A 3BFRA 3TJTA 1IX9A 1IXBA 3C3SA 1BSMA 1XUQA 2RCVA 3AK2A 1P7GA 1VEWA 1KKCA 4F6EA 3QVNA 2GDSA 3C3TA 1D5NA 1SZXA 2QKAA 3DC5A 2ADPA 4X9QA 1I08A 1GN3A 1VARA 1MMMA 3RN4A 2P4KA 1EN6A 3LSUA 1BS3A 4JZGA 2CDYA 1BT8A 1IDSA 1ZUQA 1PL4A 1GN6A 3IC9A 1XILA 1B06A
chains in the Genus database with same CATH superfamily
1BCCH 2BTQB 2DOSA 3OR6C 3Q4HB 4DRXB 1VF7A 1QVGU 2WSSG 3S3XA 1K5QA 5LP6A 4DV2B 4GKJO 1TGOA 2UXBO 4ZKIA 1S0VA 2R9RB 2F23A 4X65B 3CCUV 4LR3A 2UXCB 2E75B 2M7WA 1IZ3A 4DV4O 3ABMC 5IJ0A 3SR2C 2X0LA 3JD3A 1SRYA 3IC7A 2PTMA 3SPGA 1N0JA 1OCRC 2X7RB 1A32A 5EYPB 1M9NA 2E3CA 5JH7A 5J2TB 3CCSV 3OW2U 5HFLA 3DTUB 3OFNG 2CUGA 2MW2B 3ZJZA 4J9YB 4QE9A 1SKVA 1WP8A 1KP2A 2A7WA 4DYLA 1HNWO 4DXWA 3K9SA 2LFRA 5B3SC 3IGAC 4LFCO 3SPJA 1QLNA 3EFFK 3FB5C 2YEVA 4I50B 3STLC 3H1IH 1IX9A 1NT2B 1RFYA 2Y0PA 2AZ0A 4DR2B 1NJIW 1M5IA 1Q86W 1QVFU 1VEWA 1RM1C 2WLLA 1CP9A 4ZIBA 5DN6G 3OE7G 3B2EE 4HZ3A 2Z0AA 3QO8A 2IJJA 3ASOB 4GX2A 2JS3A 2E76B 2Q7GA 3K59A 2KG7A 3JD0A 4W4LA 4YJ2B 1M57C 2PF4E 2HG5C 3D3IA 4IYIA 3RYHB 1HR0O 1OCOC 1LR1A 3D36C 1WA8B 2JGDA 1KB9F 2NN4A 1SA0A 1M93A 2H94A 3BAAA 1HNZB 3OGCC 4D7SA 3T1HO 2K9PA 3K08A 4MTGA 3CD6V 1FXKB 3HKEB 4CH6A 5KA6A 3ABLC 3OEEG 2ZIMA 5F2VO 3H1HH 4LF7O 3QNEA 3LUTB 4LF9O 3T1YB 4HYOA 3ZMSA 1ZL8A 3ABKB 4U3JB 4GX0A 1GRJA 1HP8A 4JYCA 3ETEA 1R73A 3FAVA 4BWAA 5C93A 2YDEA 3WB2A 4MTOA 5LGUA 1PM9A 1FXVA 2IH3C 3OTFA 1AP6A 5EBLC 2QKCA 3LDDA 2HHHO 4WFEA 1YHQV 4EB6B 2GHYA 5LGNA 4GX1A 3JAKA 4RQEA 1OZ0A 1WB7A 4DR1O 4B7KA 1IBKO 2ZD9A 4JGSA 4TWKA 3A0BZ 4I4TB 4WBNB 3FB7C 1AI5A 4CC5A 1QLEB 5CA3A 3CHXA 1L0LH 4UXNA 3H1KH 4JAAA 1JNBA 2DYSC 2XAHA 1COWG 3R65A 4BW5A 5J9PC 1VQMV 3T4DA 2RCVA 4JI6B 3CCEV 4X66O 4X20B 1NVPB 1YXBA 2GTSA 4TT3G 3CS5A 3MHSC 3RGBA 1SZXA 4FJCC 1QBZA 4MTXA 4PI0A 1KYOF 3H1JH 2A3QA 3JD1A 3D3QA 5DECA 5IJ0B 1QR9A 3FKSG 2DWEC 2YIBD 3CXCU 1W2BU 3J80N 4U7NA 4H37A 3KG2A 1S76D 5GONA 2BOCC 4EEQA 2NLJC 1YJNV 3RYIA 4DV7O 3WFVA 4MS2A 2YC0A 5L3EA 2JDIG 1XHXA 4B7EA 3IJ4A 4PA4A 1SERA 4PDMA 1ZTEA 3KKYA 4JTCB 2H3OA 4C7UA 4QPKA 1JJ2U 1WPBA 2QWPB 3RT3C 4LFAB 4QPJA 4L87A 3CRCA 3G67A 1DF4A 5B5EZ 5FLXN 3BY6A 5KHKA 1KC8W 4I0XB 2ZIOA 2F4VO 4B3MO 2RQ6A 4X1IA 5L3CA 1SQXH 4L8JA 2FTKA 3CC2V 2E5LO 2DN9A 3EVKA 2W6JG 4P9PA 1BGYH 1N0NA 4JAUA 5BR8B 4GX5A 2ZM6O 2YI9A 3E35A 2KG7B 2EIJC 1AROP 1N32O 4PV1B 1GH6A 3ZEDA 2VQEO 5IY5C 2JGDB 2Q5ZA 4X64O 4J42A 1SA0B 4PA9A 2EBOA 1KQSU 2OIGA 3JSNA 4DO2A 4B3TO 2UXDO 4N21A 4DUZO 1TA8A 2OTLV 4DV0O 4GZRB 5FPOA 4RO2A 2QKAA 2WLHA 1ZL8B 1N34O 3RN4A 4UB8Z 3FAVB 1BS3A 4PA7A 4P9OA 3CMAV 1BMFG 4LBEC 1PL4A 4FPPA 2IJKA 3P3NA 3FYIB 3LNMB 3QO7A 1CXZB 2H8PC 4YJ3A 1H2LA 1GK9A 1N8RW 5KMGB 2Y48A 1K34A 4CH4A 2LFSA 4CBCA 2XHBA 4R6ZA 3JAKB 2Q69A 4CC6A 1ROPA 2ADQB 4UCTA 4JI0O 5LP6C 1PP9H 5KA5A 3K04A 1SQBH 5LMUO 3M99B 1S3JA 2HFEC 5CBFA 3ZHSA 1W0KG 1WB8A 2XASA 5BY1A 1XI1A 1K92A 1NVPD 2WLJA 3QTCA 1P7BA 2OIEA 3SJAC 4BIZA 2PYJA 2GUZA 3K5MA 4TUYB 2A06H 4J10A 2UUAO 2V1DA 3X2QC 3OMIB 4DV6O 4GYCB 3K3WA 2LGQA 1LNQA 1AI6A 2P67A 1XDCA 4DR5O 1SZTA 3BVOA 4GKKO 2QR4A 3UM7A 2EILC 4YHHO 3JD2A 1YSCA 5GONB 3BHPA 1YEWA 2V7QG 2ZNJA 1P7GA 4DK1A 5BMVA 1I94B 1KKCA 3RYIB 3SPHA 3ETGA 5KHHA 1VQ8V 1VIBA 2DJVA 4LF5B 2ADPA 2DYRC 3MHHC 1H2KA 1XMOB 3GB7C 3LSSA 5JCOC 4YY3B 3ABUA 1ENVA 2YUAA 1BT8A 4NXMO 3EHBB 3A0RA 2BTOA 4MVUA 1Q7YW 4X1YA 3RVZA 4X1IB 4MVMA 3W7SA 4NTYA 1UPGA 4DV3B 4H44B 3ABMB 1JFFA 2WA3A 4O2BB 1P84F 2GSMB 2YXYA 1O9GA 1OCRB 4KUMA 4O4JA 1CEZA 1NQTA 1MOFA 1YIJV 3SGIA 3FFQA 5BZBA 1K7DA 1XL6A 3BEHA 4CS3A 4IIJB 2IU0A 3WB1A 3OUFA 1P49A 4DW1A 2QA4V 1SQPH 4ZBMA 4Q20A 2CTQA 3PJSK 1FFXB 2JEXA 3E8FA 1WN7A 1WNSA 5B3SB 3B4SA 3HKDA 1G8MA 2JIZG 3OGIB 4R8CA 3FB6C 2ZE6A 1IBLB 1I0HA 2AGAA 2VQFO 5LA6B 4BR6A 4LCUC 2CTWA 3F5WC 2UU9B 3OTOO 1NI8A 4NXNO 1RM1B 5BXZA 1F4NA 3VQYA 4NKGB 1H2GA 1US6A 2IJIA 1RSOA 1XUQA 3SPIA 4Z2WA 4MVRA 1XNRO 4B3RO 4MW3A 2WA4A 2ZR3A 3QF7A 1Y76A 1JMKC 1Q6IA 3LSQA 1JCHA 2WLMA 5JWPA 1YI2V 3ZRVA 1M57B 1JPXA 4DV1O 2EIKC 1OCOB 4FM0A 1AJPA 2XT9A 3T1CA 3SJCC 4DR6B 3K0GA 3ASNC 1IDSA 4PD4F 4FK5C 1XMQB 3ABLB 1PD3A 1OJHA 3UO3A 4OPHA 3SJBC 4BW9A 3UCSC 3F5TA 1JR9A 4I7ZB 4JI7B 2Q7EA 5LHIA 2HR3A 2RN9A 4XBFA 2WLKA 1N36B 1R1BA 5CA1B 1KUQA 5LMNB 3J7AU 4PDVA 1OCCC 1XEQA 3OM3B 3G4SV 1VQ5V 4WFAV 1R3IC 4D6TH 4LF6B 1L0NH 3VOUA 1R3JC 4LFBO 1QNMA 4FFBA 4PI2A 1FD9A 1AR5A 4X62B 3TXQA 2AHZA 5KX5B 1B04A 2R9AA 5L3DA 3LDEA 1KECA 1F7YA 3JALB 2DYSB 2HJFC 3J81N 5EZYA 4TQDA 3RVYA 1VQPV 2DWDC 4MVSA 4FZ1A 3KZIZ 2B1IA 1Y67A 4K8ZA 1TVKB 5LHHA 2IM9A 3O65A 3ZHRA 4GKJB 2OT5A 4O4LB 5FNVB 1PV0A 2UXBB 2EX3A 3OUSA 2EIMB 3WU2Z 1NTMH 4LF8O 1NKDA 1JFFB 1Q5OA 2GDSA 3THOA 1H5WA 4DV4B 3DC5A 1HNXO 1GN3A 5A2QN 1EFRG 4NVPA 4KFMA 1O9HA 1PNKA 4UV9A 4LNUA 2R72A 1JJOA 2CGOA 2PY5A 3JSLA 4KP4A 1XILA 4KHPO 3BA8A 5FL7G 1H2NA 1BZKA 4U3FH 5LBQA 4ZI7A 3W7TA 3HKDB 1I5XA 3A2FA 1IVSA 1HNWB 2PI4A 3DGEA 4EFEA 5JCOA 1SQGA 3TK1A 1EZVH 4RUEA 3E83A 2N05A 4LFCB 1YDXA 1ZLZA 4HNAA 5B1OA 3APQA 1BHAA 4WCEV 2ATKC 2PI5A 1IXMA 1VF5B 3L73H 4OX9O 2FB5A 3U0ZA 3MDSA 3ETDA 1XHZA 3JD4A 1KP3A 4YIOA 3RWRD 5D5PA 2UUCO 2ZINA 2ZDIA 3B8MA 4QIWF 4TV8A 3B09A 1AI7A 1Y76B 3K79A 3E86A 5IWAO 3JCUZ 4JI3B 5JQGA 2EIJB 4AHCA 1PL0A 5IY5B 1MA1A 2AHYA 4FLUA 3AG1C 2OCCC 3B77A 4RUFA 2A0LA 1HR0B 1Y6XA 4MSWC 2FMLA 5B66Z 4DR3O 1GO3F 3T1HB 5B1NA 1EBOA 4JI4O 4IHJB 1N33O 3A0HZ 3LNNA 5KHJA 1K4CC 4XDLA 3HKCB 4E2LA 3QVNA 2A79B 4LF7B 3ZHUA 4LF9B 2Q6AA 1J5EO 3AG2C 2JGUA 4FLXA 2O57A 1I08A 2BOBC 2W6IG 1HW7A 2EINC 3N2GA 2CDYA 1AR1B 2YXLA 2XOKG 4A5UB 1FJGO 1WLEA 2UXXA 3ZRWA 4DW0A 1NH2B 2HHHB 2G38A 1V54C 3P32A 4FFBB 2AXTZ 4MW8A 2GBOA 4IT5A 5LP6B 4F6RA 1SETA 4DR1B 1IBKB 1DK1A 2CH7A 4JV5O 2F66C 4IYHA 1GAXA 1GM9A 4FIPC 2ILMA 2EIMC 2RJZA 4JF3A 4JI1O 3JARA 1K33A 1NS1A 5CBHA 3SYAA 5JH7B 4X66B 3U11A 1V9PA 3X2QB 2D3OW 1GN4A 1IJGA 1AVMA 3G80A 2K1EA 2MK3A 2XAGA 1VQKV 4LF4O 1KMIZ 4WFFA 5TISZ 2HJDA 2CTRA 3AG3C 3W7XA 2W0FC 1PPJH 2EILB 2YEVB 5H6QA 1TUBA 4RAIA 2DMXA 3OMNB 3MAQA 1VQNV 1WP7A 1K97A 2DQ3A 1TAEA 1M56C 3D8CA 3G6EV 2WLLB 1J95A 2RDCA 4MT8A 3CRQA 1VQ6V 4DV7B 3H9VA 2DYRB 1Q81W 4DR7O 2QGNA 3R66A 3CRRA 1B6QA 4TV9A 1BQZA 1YTFB 4Z1MG 3E22A 1K9MW 1D5AA 4HNAB 1URFA 1NTKH 4H33A 3CCRV 3JCZA 2CAZC 2EJ7A 2LW1A 3CCLV 4OXSA 1MSWD 4UB6Z 3LSUA 1FS0G 5DM6V 2QWNB 2F4VB 4B3MB 1WJZA 5CA0A 3FX7A 2E5LB 5KHGA 3SDLA 3TCUA 2ZM6B 1W0JG 1M4UA 1Q82W 1F51A 5H6RA 2FL4A 1N32B 1MZFA 4GLXA 1VQ4V 2LW7A 3HR0A 2BCCH 4DV5O 5KHIA 4X64B 4UUJC 1VP7A 4UCRA 4FLYA 4J7JA 3CX5F 2WLIA 4XDJA 4B3TB 2UXDB 4DUZB 1Q6HA 3P3PA 4DV0B 2PZSA 4PELA 4ZHQA 2LJ2A 4K8XA 3VQWA 4I5SA 1N34B 4JI2O 1IBMO 2R70A 2UUBO 2JEUA 3VBBA 2ITCC 2FYUH 4G2KA 2JS5A 2QDOA 3N2GB 1XNQO 3IAYA 4LC1A 3ZMVA 5C8YA 3BFRA 4JI8O 1PNMA 3G6BA 4FLVA 2EIKB 2Q4PA 2ZQMA 4F6RB 4JI0B 3ICXA 4U7OA 2JJ1G 3ASNB 5JJJB 5LMUB 3I55V 5CBGA 1HWYA 4AQYO 5IYDO 1UJWB 5GTIZ 2PGGA 2EULA 2YIDA 3FYEB 3MD0A 4JYAO 4X89A 2DE0X 4PJ0Z 3CCJV 4JZGA 1RP3B 3TGUH 3A8TA 5KAFZ 5LXTA 4UVBA 2UUAB 4EFBA 2VS0A 3E8HA 4DV6B 4YIPA 1KKDA 1E79G 3UKMA 4AI8A 1OCCB 3Q4HA 4UCUA 4DRXA 5B1AB 5H5NA 1E1RG 4FM2A 3UT5A 4GUNA 4DR5B 2Q0AA 1TUBB 1GTOA 4FFKA 4LH6A 4GKKB 1YVWA 4YHHB 5JVDA 4J11A 4JI5B 4NTXA 2R9IA 1QHTA 4MVZA 2ODMA 1LUWA 1VQ7V 1R6NA 2GV9A 2YXHA 2ZDIC 3AEIA 5EYPA 3E8BA 5K1XA 2KSDA 3E22B 5J2TA 3BABA 2YIBA 1EN4A 4NXMB 1EN5A 3KCYA 3RBZA 2YS8A 4OGQB 2JVDA 2KKWA 5LOVA 3CRAA 2WLNA 2JK5C 3ZBHA 2DQ0A 3CWBH 1SS3A 3K57A 4UCSA 5IJ9A 2P5OA 5CA0B 1W59A 3QO5A 3GWKC 2B5UA 4I9WA 1G1XB 4I50A 1M90W 1K73W 5EBWC 2M6YA 3CXHF 3HB3B 1MZEA 5GW7A 1JVMA 1RPOA 4ASUG 2ZNIA 4DUYO 2VWJA 2NR5A 5CB4A 2GTAA 4PDLA 1FFTB 2VWKA 1WAZA 4YJ3B 4GCZA 4TQFA 1F4MA 2FKXA 3W7WA 3UO2A 2WLIB 4DR4O 3ML0A 3CB2A 1BL8A 1EM1A 3FD9A 4ZHQB 4WFGA 3RYHA 2VQFB 4QNHB 1OHHG 3OTOB 1WPXA 4NXNB 1PNLA 2IBZH 3QG5A 5D5QA 3HKEA 3CPWU 1OCZC 4B3SO 1XNRB 5C8YB 2GUZB 4JPRA 4JYBA 4B3RB 4R50A 3F7VC 3ZHQA 1YJ9V 2YSUB 3PN1A 4X1KA 2IU3A 5L3GA 1GKFA 5IYCO 4DV1B 3AG1B 2OCCB 4ICGA 2IJHA 5EIBD 3T4ZA 3WG7C 1BHBA 4ABMA 3U10A 3LDCA 4K0KB 3SYOA 3FB8C 4NB5A 1Q8IA 4CS2A 5IYZA 2OTJV 5B1AC 1UFIA 4DV2O 4HAMA 3CRMA 1JA8A 1VF6A 4WFHA 3RYFA 3ZRSA 4X65O 2CTPA 4WBNA 5BMVB 2UXCO 2Y4TA 3VQXA 2QM4A 1DLBA 1YJWV 5JJNB 3AG2B 3AG7A 2ZR2A 2HKOA 2EINB 1DGSA 3SPCA 2PUSA 1D5NA 1V55C 4X20A 3UT5B 1SQQH 3ZMTA 1V54B 3K9AA 2E74B 1VARA 5B1BC 1MMMA 3BPZA 4UFZA 1JQ0A 5JVDB 2P4VA 2X6CA 4LFBB 2Q0OC 4O2AA 4X1YB 2B9ZA 1B06A 4P2ZA 1ZWIC 5EBMC 2UXNA 1NR7A 2AZ2A 1X4TA 4X8AA 2Q7HA 4DR2O 1VQLV 4O4JB 5H9CA 3TETA 2PYLA 1ZX3A 5EK0A 5KAIZ 2OYQA 1S77D 5LOVB 3E8GA 2OCHA 5KUKA 3ZN0A 5LYJA 2XAFA 5IJ9B 4JZ2A 4NR1A 4QJFB 4J9ZB 3AG3B 4LF8B 4MVOA 2ZE7A 1JX9A 3OMAB 4I55A 2ZCEA 4TSFG 3OAAG 5L3FA 3ZN1A 1HNXB 3HPLC 1KU9A 2RNBA 4I0XA 4O4HA 3K5LA 1HNZO 3N27A 1M56B 2P7TC 3ZRXA 3CMEV 2HVKC 1H2SB 1OV9A 4ZOLA 5CB4B 4P30A 4RQFA 2X6AA 4F4LA 3P30A 4QE7A 1ORQC 4PA3A 2ZE8A 1K3EA 1Y4MA 4B08A 2QWRB 4KHPB 1H8EG 4Z1VA 2WPDG 1RSOB 4IGGA 4O4IA 1XREA 4G28B 4JI3O 3T1YO 1Y74A 2XUMA 3ZX6A 1D2DA 2B1GA 2DW4A 2F93B 3AK2A 3OEHG 2VRZA 3CSXA 4BIUA 5H2FZ 4F6EA 2Y69C 1R6TA 1XOUA 3JASA 1SQFA 4OX9B 2A9HA 1B3QA 5IDJA 2Q8VA 3AG4C 3C90A 2UUCB 3H1LH 2ZXWC 3ZCCA 3ZS8C 3O9OA 5LL6Y 2HP8A 2YICA 4UCVA 5EC2C 5IWAB 5KUMA 4FLWA 4X1KB 4R7CA 4J7KA 4OPAA 3OD4A 4JI6O 3RW0A 5KMGA 1SQVH 2ZKOA 4WF9V 2F1MA 5IYZB 4DR3B 5JJEB 2X6BA 1YITV 3TXSA 4JI4B 3JAWA 4BAYA 2AW9A 3RYFB 1H2MA 1N33B 4N23A 1SESA 3K5OA 2YIAA 3JATA 4J7ZA 4JYYA 1K4DC 4D7TA 3CC7V 3T2MA 2CE4A 1X59A 1J5EB 5EZYB 5IT9N 5LGTA 1QQCA 3GWOA 2N74A 2P06A 1MABG 2NNUA 1ZSPA 1VMGA 2HEPA 1LUVA 4TUYA 3AK3A 3CCMV 3DC6A 1FJGB 3OT7A 2CGNA 4MVQA 4MTFA 4O2AB 4UCOA 4RWUA 4CS4A 1R3KC 2QM8A 4NTWA 4I9QA 4JV5B 4K35A 3GVMA 1NZ6A 4LFAO 3APOA 5GTHZ 3SJQC 4JI1B 3L71H 3VQVA 5IE9A 4UVAA 2KQXA 2JJ2G 1BE3H 3CCQV 4LNUB 1E1QG 2XNDG 1GM7A 3L72H 2P4KA 4XDKA 4CZZA 4LWSA 5LYJB 5BR8O 1AI4A 4ZI7B 4LF4B 3ASOC 1KBHA 3E2EA 3BRCA 3SYCA 1U96A 5AG2A 4I55B 4YXWG 2YI8A 1M1KW 4O4HB 4H0LB 1I5YA 1Q6UA 5DEDA 4ZOLB 1QU7A 1L1FA 2V4DA 1PKXA 1F23A 2QWQB 3M7MX 4O4IB 4O2BA 1FXKC 2ZE5A 4TV8B 1I7FA 1Y74B 4DR7B 3L75H 1S72V 2L6LA 4LH7A 3KCXA 1S5HC 4Q6GA 3ABKC 4E4EA 1VQ9V 1TUEB 5JQGB 3SYPA 1FXHA 2C2AA 4IIJA 3CEIA 1AJNA 1Q3EA 2QM7A 2QJ1A 2F95B 3AK1A 1FFXA 3JASB 1AJQA 1YF2A 1Q43A 2VQEB 1K8AW 1RPRA 4NYKA 1EZJA 3K03A 1R3LC 1FOUA 4FVMA 4PHZA 1H8HG 2QSAA 1MSDA 4JTDB 2Z5UA 3DXRA 5LA6A 3HKBA 3CC4V 1DTOA 2L35A 1VF6C 4UVCA 5E1AC 1QLEC 1FAFA 1KD1W 2WWWA 3UQ8A 3K0DA 1NU1H 1HDJA 3RYCA 4K3AA 4DV5B 3ZMUA 2EZPA 1NH2D 4PA6A 2QTSA 3N2KA 1H38A 2Z3YA 1CPYA 1Z5WA 3JAWB 3ZRWB 2QTOA 3H01A 3D36A 3JATB 1DF5A 1GN6A 1SC5B 3IC9A 2CH7B 1AILA 4HBNA 2JRIA 4J41A 3CJHA 2XTAA 4JI2B 4FMTA 1IBMB 2UUBB 1THZA 4FLTA 3ZIAG 4W4KA 1OCZB 3JARB 1XBLA 4GT1A 3RFRA 1I94O 3JAMN 2P90A 2Y4UA 3I5DA 1XNQB 2EJRA 1N4CA 1AR4A 2BSKA 1JOYA 3KDRA 4JI8B 3CYOA 5ITZA 4LF5O 3M8AA 4BIOA 1BQ0A 1Z2GA 3WG7B 3B8NA 3SYQA 4CH3A 2Q68A 4LP8A 4IL6Z 3G71V 5CA1A 1XMOO 4X88A 5IYBO 5J2UA 1XQ8A 4YY3O 4G27B 2BTQA 2ZT9B 1FYJA 2Q67A 4AQYB 2ARHA 4JI5O 5KLVH 1Q90D 4JYAB 2LP7A 1NTZH 4H13B 1L8DA 3ABTA 2HVJC 5A9GA 5KX5A 4DV3O 2P6JA 2XAJA 3JALA 2LO1A 1GN2A 4LWSB 2D2CB 4QGPA 1YTFD 1AP5A 3S3WA 3TJTA 1GM8A 1IXBA 1V55B 1QR8A 1BSMA 2QE7G 4TV9B 3CCVV 3L74H 4JAVA 1TVKA 5FPRA 3CP1A 5LHGA 5B1BB 2CK3G 3ETQA 3K58A 4O4LA 5FNVA 2XAQA 5CN0A 1VQOV 2BE3A 3OR7C 4KXRA 2EZOA 1EN6A 5HFMA 2LGWA 4KL1A 1IBLO 3ZMZA 2Q73A 1QCEA 1YCIA 2UU9O 4FLZA 3K06A 4JASA 1Z5VA 1S5LZ 3WB0A 3ZHVA 2ITDC 2WAMA 1NBMG 2QWOB 1FPOA 1AB3A 1R6KA 1YZBA 2P22C 3EXAA 4EKWA 4FM1A 4J80A 3B40A 3DSQA 3E89A 1U97A 3DXRB 3F7YC 3HKBB 4YJ2A 3I56V 1FKAO 3IFXA 3W7UA 4DR6O 1NR1A 1WA8A 1ZAUA 3BCCH 1XMQO 4DUYB 1XL4A 3L70H 1IURA 2N04A 3RYCB 4UV8A 1FXKA 4DK0A 3ZHTA 4TOIA 3BA9A 3NR7A 1G4YB 3N2KB 2Y0IA 2ETNA 3CE2A 4CH5A 4JI7O 2OWOA 1MNGA 4U3JA 3STZC 5L3BA 4DR4B 1MG1A 2KB1A 1S5JA 3L9DA 1N36O 2Y69B 4PDRA 2RMKB 3NXSA 4K0KO 4WFBV 2LQTA 5EC1C 3C3SA 3JYCA 5LMNO 2IW5A 3CJHB 3AG4B 5E79Z 4JTAB 4LF6O 5EIBC 4IHJA 2ZXWB 1GMGA 2QKSA 4EB6A 1SF9A 3C3TA 3K5NA 3HKCA 4AILC 2QEXV 2BSKB 4X62O 1P4RA 4B3SB 4X9QA 2W0XA 1T5EA 2Q9LA 2HLDG 4I4TA 5ITZB 5LXTB 1Y66A 5CMUA 1ZUQA 5K1PA 1K5SA 5J2UB 4FZ0A 2IH1C 1G6UA 2F43G
chains in the Genus database with same CATH topology
1EM1A 5AG2A 4YIPA 1JR9A 1ZLZA 4GUNA 2ADQB 4FFKA 1AR4A 3KDRA 1ZTEA 3KKYA 2AW9A 4C7UA 3MDSA 1WB8A 4YIOA 1GN4A 4JZ2A 4JYYA 1N0JA 1LUWA 1AVMA 1PM9A 1QNMA 1AP6A 4E4EA 3CEIA 2CE4A 2QKCA 1AR5A 3AK1A 1ZSPA 3EVKA 1LUVA 1WB7A 1N0NA 3AK3A 1I0HA 1EN4A 3K9SA 5A9GA 1EN5A 3DC6A 4BR6A 1MA1A 1GN2A 1MNGA 1MSDA 3OT7A 1XDCA 1JA8A 1XREA 1Y67A 1AP5A 3BFRA 3TJTA 1IX9A 1IXBA 3C3SA 1BSMA 1XUQA 2RCVA 3AK2A 1P7GA 1VEWA 1KKCA 4F6EA 3QVNA 2GDSA 3C3TA 1D5NA 1SZXA 2QKAA 3DC5A 2ADPA 4X9QA 1I08A 1GN3A 1VARA 1MMMA 3RN4A 2P4KA 1EN6A 3LSUA 1BS3A 4JZGA 2CDYA 1BT8A 1IDSA 1ZUQA 1PL4A 1GN6A 3IC9A 1XILA 1B06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EM1 A;  5AG2 A;  4YIP A;  1JR9 A;  1ZLZ A;  4GUN A;  2ADQ B;  4FFK A;  1AR4 A;  1ZTE A;  3KKY A;  2AW9 A;  4C7U A;  3MDS A;  1WB8 A;  4YIO A;  1GN4 A;  4JZ2 A;  4JYY A;  1N0J A;  1LUW A;  1AVM A;  1PM9 A;  1QNM A;  1AP6 A;  4E4E A;  3CEI A;  2CE4 A;  2QKC A;  1AR5 A;  3AK1 A;  1ZSP A;  3EVK A;  1LUV A;  1WB7 A;  1N0N A;  3AK3 A;  1I0H A;  1EN4 A;  3K9S A;  5A9G A;  1EN5 A;  3DC6 A;  4BR6 A;  1MA1 A;  1GN2 A;  1MNG A;  1MSD A;  3OT7 A;  1XDC A;  1JA8 A;  1XRE A;  1Y67 A;  1AP5 A;  3BFR A;  3TJT A;  1IX9 A;  1IXB A;  3C3S A;  1BSM A;  1XUQ A;  2RCV A;  3AK2 A;  1P7G A;  1VEW A;  1KKC A;  4F6E A;  3QVN A;  2GDS A;  3C3T A;  1D5N A;  1SZX A;  2QKA A;  3DC5 A;  2ADP A;  4X9Q A;  1I08 A;  1GN3 A;  1VAR A;  1MMM A;  3RN4 A;  2P4K A;  1EN6 A;  3LSU A;  1BS3 A;  4JZG A;  2CDY A;  1BT8 A;  1IDS A;  1ZUQ A;  1PL4 A;  1GN6 A;  3IC9 A;  1XIL A;  1B06 A; 
#chains in the Genus database with same CATH topology
 1BCC H;  2BTQ B;  2DOS A;  3OR6 C;  3Q4H B;  4DRX B;  1VF7 A;  1QVG U;  2WSS G;  3S3X A;  1K5Q A;  5LP6 A;  4DV2 B;  4GKJ O;  1TGO A;  2UXB O;  4ZKI A;  1S0V A;  2R9R B;  2F23 A;  4X65 B;  3CCU V;  4LR3 A;  2UXC B;  2E75 B;  2M7W A;  1IZ3 A;  4DV4 O;  3ABM C;  5IJ0 A;  3SR2 C;  2X0L A;  3JD3 A;  1SRY A;  3IC7 A;  2PTM A;  3SPG A;  1N0J A;  1OCR C;  2X7R B;  1A32 A;  5EYP B;  1M9N A;  2E3C A;  5JH7 A;  5J2T B;  3CCS V;  3OW2 U;  5HFL A;  3DTU B;  3OFN G;  2CUG A;  2MW2 B;  3ZJZ A;  4J9Y B;  4QE9 A;  1SKV A;  1WP8 A;  1KP2 A;  2A7W A;  4DYL A;  1HNW O;  4DXW A;  3K9S A;  2LFR A;  5B3S C;  3IGA C;  4LFC O;  3SPJ A;  1QLN A;  3EFF K;  3FB5 C;  2YEV A;  4I50 B;  3STL C;  3H1I H;  1IX9 A;  1NT2 B;  1RFY A;  2Y0P A;  2AZ0 A;  4DR2 B;  1NJI W;  1M5I A;  1Q86 W;  1QVF U;  1VEW A;  1RM1 C;  2WLL A;  1CP9 A;  4ZIB A;  5DN6 G;  3OE7 G;  3B2E E;  4HZ3 A;  2Z0A A;  3QO8 A;  2IJJ A;  3ASO B;  4GX2 A;  2JS3 A;  2E76 B;  2Q7G A;  3K59 A;  2KG7 A;  3JD0 A;  4W4L A;  4YJ2 B;  1M57 C;  2PF4 E;  2HG5 C;  3D3I A;  4IYI A;  3RYH B;  1HR0 O;  1OCO C;  1LR1 A;  3D36 C;  1WA8 B;  2JGD A;  1KB9 F;  2NN4 A;  1SA0 A;  1M93 A;  2H94 A;  3BAA A;  1HNZ B;  3OGC C;  4D7S A;  3T1H O;  2K9P A;  3K08 A;  4MTG A;  3CD6 V;  1FXK B;  3HKE B;  4CH6 A;  5KA6 A;  3ABL C;  3OEE G;  2ZIM A;  5F2V O;  3H1H H;  4LF7 O;  3QNE A;  3LUT B;  4LF9 O;  3T1Y B;  4HYO A;  3ZMS A;  1ZL8 A;  3ABK B;  4U3J B;  4GX0 A;  1GRJ A;  1HP8 A;  4JYC A;  3ETE A;  1R73 A;  3FAV A;  4BWA A;  5C93 A;  2YDE A;  3WB2 A;  4MTO A;  5LGU A;  1PM9 A;  1FXV A;  2IH3 C;  3OTF A;  1AP6 A;  5EBL C;  2QKC A;  3LDD A;  2HHH O;  4WFE A;  1YHQ V;  4EB6 B;  2GHY A;  5LGN A;  4GX1 A;  3JAK A;  4RQE A;  1OZ0 A;  1WB7 A;  4DR1 O;  4B7K A;  1IBK O;  2ZD9 A;  4JGS A;  4TWK A;  3A0B Z;  4I4T B;  4WBN B;  3FB7 C;  1AI5 A;  4CC5 A;  1QLE B;  5CA3 A;  3CHX A;  1L0L H;  4UXN A;  3H1K H;  4JAA A;  1JNB A;  2DYS C;  2XAH A;  1COW G;  3R65 A;  4BW5 A;  5J9P C;  1VQM V;  3T4D A;  2RCV A;  4JI6 B;  3CCE V;  4X66 O;  4X20 B;  1NVP B;  1YXB A;  2GTS A;  4TT3 G;  3CS5 A;  3MHS C;  3RGB A;  1SZX A;  4FJC C;  1QBZ A;  4MTX A;  4PI0 A;  1KYO F;  3H1J H;  2A3Q A;  3JD1 A;  3D3Q A;  5DEC A;  5IJ0 B;  1QR9 A;  3FKS G;  2DWE C;  2YIB D;  3CXC U;  1W2B U;  3J80 N;  4U7N A;  4H37 A;  3KG2 A;  1S76 D;  5GON A;  2BOC C;  4EEQ A;  2NLJ C;  1YJN V;  3RYI A;  4DV7 O;  3WFV A;  4MS2 A;  2YC0 A;  5L3E A;  2JDI G;  1XHX A;  4B7E A;  3IJ4 A;  4PA4 A;  1SER A;  4PDM A;  1ZTE A;  3KKY A;  4JTC B;  2H3O A;  4C7U A;  4QPK A;  1JJ2 U;  1WPB A;  2QWP B;  3RT3 C;  4LFA B;  4QPJ A;  4L87 A;  3CRC A;  3G67 A;  1DF4 A;  5B5E Z;  5FLX N;  3BY6 A;  5KHK A;  1KC8 W;  4I0X B;  2ZIO A;  2F4V O;  4B3M O;  2RQ6 A;  4X1I A;  5L3C A;  1SQX H;  4L8J A;  2FTK A;  3CC2 V;  2E5L O;  2DN9 A;  3EVK A;  2W6J G;  4P9P A;  1BGY H;  1N0N A;  4JAU A;  5BR8 B;  4GX5 A;  2ZM6 O;  2YI9 A;  3E35 A;  2KG7 B;  2EIJ C;  1ARO P;  1N32 O;  4PV1 B;  1GH6 A;  3ZED A;  2VQE O;  5IY5 C;  2JGD B;  2Q5Z A;  4X64 O;  4J42 A;  1SA0 B;  4PA9 A;  2EBO A;  1KQS U;  2OIG A;  3JSN A;  4DO2 A;  4B3T O;  2UXD O;  4N21 A;  4DUZ O;  1TA8 A;  2OTL V;  4DV0 O;  4GZR B;  5FPO A;  4RO2 A;  2QKA A;  2WLH A;  1ZL8 B;  1N34 O;  3RN4 A;  4UB8 Z;  3FAV B;  1BS3 A;  4PA7 A;  4P9O A;  3CMA V;  1BMF G;  4LBE C;  1PL4 A;  4FPP A;  2IJK A;  3P3N A;  3FYI B;  3LNM B;  3QO7 A;  1CXZ B;  2H8P C;  4YJ3 A;  1H2L A;  1GK9 A;  1N8R W;  5KMG B;  2Y48 A;  1K34 A;  4CH4 A;  2LFS A;  4CBC A;  2XHB A;  4R6Z A;  3JAK B;  2Q69 A;  4CC6 A;  1ROP A;  2ADQ B;  4UCT A;  4JI0 O;  5LP6 C;  1PP9 H;  5KA5 A;  3K04 A;  1SQB H;  5LMU O;  3M99 B;  1S3J A;  2HFE C;  5CBF A;  3ZHS A;  1W0K G;  1WB8 A;  2XAS A;  5BY1 A;  1XI1 A;  1K92 A;  1NVP D;  2WLJ A;  3QTC A;  1P7B A;  2OIE A;  3SJA C;  4BIZ A;  2PYJ A;  2GUZ A;  3K5M A;  4TUY B;  2A06 H;  4J10 A;  2UUA O;  2V1D A;  3X2Q C;  3OMI B;  4DV6 O;  4GYC B;  3K3W A;  2LGQ A;  1LNQ A;  1AI6 A;  2P67 A;  1XDC A;  4DR5 O;  1SZT A;  3BVO A;  4GKK O;  2QR4 A;  3UM7 A;  2EIL C;  4YHH O;  3JD2 A;  1YSC A;  5GON B;  3BHP A;  1YEW A;  2V7Q G;  2ZNJ A;  1P7G A;  4DK1 A;  5BMV A;  1I94 B;  1KKC A;  3RYI B;  3SPH A;  3ETG A;  5KHH A;  1VQ8 V;  1VIB A;  2DJV A;  4LF5 B;  2ADP A;  2DYR C;  3MHH C;  1H2K A;  1XMO B;  3GB7 C;  3LSS A;  5JCO C;  4YY3 B;  3ABU A;  1ENV A;  2YUA A;  1BT8 A;  4NXM O;  3EHB B;  3A0R A;  2BTO A;  4MVU A;  1Q7Y W;  4X1Y A;  3RVZ A;  4X1I B;  4MVM A;  3W7S A;  4NTY A;  1UPG A;  4DV3 B;  4H44 B;  3ABM B;  1JFF A;  2WA3 A;  4O2B B;  1P84 F;  2GSM B;  2YXY A;  1O9G A;  1OCR B;  4KUM A;  4O4J A;  1CEZ A;  1NQT A;  1MOF A;  1YIJ V;  3SGI A;  3FFQ A;  5BZB A;  1K7D A;  1XL6 A;  3BEH A;  4CS3 A;  4IIJ B;  2IU0 A;  3WB1 A;  3OUF A;  1P49 A;  4DW1 A;  2QA4 V;  1SQP H;  4ZBM A;  4Q20 A;  2CTQ A;  3PJS K;  1FFX B;  2JEX A;  3E8F A;  1WN7 A;  1WNS A;  5B3S B;  3B4S A;  3HKD A;  1G8M A;  2JIZ G;  3OGI B;  4R8C A;  3FB6 C;  2ZE6 A;  1IBL B;  1I0H A;  2AGA A;  2VQF O;  5LA6 B;  4BR6 A;  4LCU C;  2CTW A;  3F5W C;  2UU9 B;  3OTO O;  1NI8 A;  4NXN O;  1RM1 B;  5BXZ A;  1F4N A;  3VQY A;  4NKG B;  1H2G A;  1US6 A;  2IJI A;  1RSO A;  1XUQ A;  3SPI A;  4Z2W A;  4MVR A;  1XNR O;  4B3R O;  4MW3 A;  2WA4 A;  2ZR3 A;  3QF7 A;  1Y76 A;  1JMK C;  1Q6I A;  3LSQ A;  1JCH A;  2WLM A;  5JWP A;  1YI2 V;  3ZRV A;  1M57 B;  1JPX A;  4DV1 O;  2EIK C;  1OCO B;  4FM0 A;  1AJP A;  2XT9 A;  3T1C A;  3SJC C;  4DR6 B;  3K0G A;  3ASN C;  1IDS A;  4PD4 F;  4FK5 C;  1XMQ B;  3ABL B;  1PD3 A;  1OJH A;  3UO3 A;  4OPH A;  3SJB C;  4BW9 A;  3UCS C;  3F5T A;  1JR9 A;  4I7Z B;  4JI7 B;  2Q7E A;  5LHI A;  2HR3 A;  2RN9 A;  4XBF A;  2WLK A;  1N36 B;  1R1B A;  5CA1 B;  1KUQ A;  5LMN B;  3J7A U;  4PDV A;  1OCC C;  1XEQ A;  3OM3 B;  3G4S V;  1VQ5 V;  4WFA V;  1R3I C;  4D6T H;  4LF6 B;  1L0N H;  3VOU A;  1R3J C;  4LFB O;  1QNM A;  4FFB A;  4PI2 A;  1FD9 A;  1AR5 A;  4X62 B;  3TXQ A;  2AHZ A;  5KX5 B;  1B04 A;  2R9A A;  5L3D A;  3LDE A;  1KEC A;  1F7Y A;  3JAL B;  2DYS B;  2HJF C;  3J81 N;  5EZY A;  4TQD A;  3RVY A;  1VQP V;  2DWD C;  4MVS A;  4FZ1 A;  3KZI Z;  2B1I A;  1Y67 A;  4K8Z A;  1TVK B;  5LHH A;  2IM9 A;  3O65 A;  3ZHR A;  4GKJ B;  2OT5 A;  4O4L B;  5FNV B;  1PV0 A;  2UXB B;  2EX3 A;  3OUS A;  2EIM B;  3WU2 Z;  1NTM H;  4LF8 O;  1NKD A;  1JFF B;  1Q5O A;  2GDS A;  3THO A;  1H5W A;  4DV4 B;  3DC5 A;  1HNX O;  1GN3 A;  5A2Q N;  1EFR G;  4NVP A;  4KFM A;  1O9H A;  1PNK A;  4UV9 A;  4LNU A;  2R72 A;  1JJO A;  2CGO A;  2PY5 A;  3JSL A;  4KP4 A;  1XIL A;  4KHP O;  3BA8 A;  5FL7 G;  1H2N A;  1BZK A;  4U3F H;  5LBQ A;  4ZI7 A;  3W7T A;  3HKD B;  1I5X A;  3A2F A;  1IVS A;  1HNW B;  2PI4 A;  3DGE A;  4EFE A;  5JCO A;  1SQG A;  3TK1 A;  1EZV H;  4RUE A;  3E83 A;  2N05 A;  4LFC B;  1YDX A;  1ZLZ A;  4HNA A;  5B1O A;  3APQ A;  1BHA A;  4WCE V;  2ATK C;  2PI5 A;  1IXM A;  1VF5 B;  3L73 H;  4OX9 O;  2FB5 A;  3U0Z A;  3MDS A;  3ETD A;  1XHZ A;  3JD4 A;  1KP3 A;  4YIO A;  3RWR D;  5D5P A;  2UUC O;  2ZIN A;  2ZDI A;  3B8M A;  4QIW F;  4TV8 A;  3B09 A;  1AI7 A;  1Y76 B;  3K79 A;  3E86 A;  5IWA O;  3JCU Z;  4JI3 B;  5JQG A;  2EIJ B;  4AHC A;  1PL0 A;  5IY5 B;  1MA1 A;  2AHY A;  4FLU A;  3AG1 C;  2OCC C;  3B77 A;  4RUF A;  2A0L A;  1HR0 B;  1Y6X A;  4MSW C;  2FML A;  5B66 Z;  4DR3 O;  1GO3 F;  3T1H B;  5B1N A;  1EBO A;  4JI4 O;  4IHJ B;  1N33 O;  3A0H Z;  3LNN A;  5KHJ A;  1K4C C;  4XDL A;  3HKC B;  4E2L A;  3QVN A;  2A79 B;  4LF7 B;  3ZHU A;  4LF9 B;  2Q6A A;  1J5E O;  3AG2 C;  2JGU A;  4FLX A;  2O57 A;  1I08 A;  2BOB C;  2W6I G;  1HW7 A;  2EIN C;  3N2G A;  2CDY A;  1AR1 B;  2YXL A;  2XOK G;  4A5U B;  1FJG O;  1WLE A;  2UXX A;  3ZRW A;  4DW0 A;  1NH2 B;  2HHH B;  2G38 A;  1V54 C;  3P32 A;  4FFB B;  2AXT Z;  4MW8 A;  2GBO A;  4IT5 A;  5LP6 B;  4F6R A;  1SET A;  4DR1 B;  1IBK B;  1DK1 A;  2CH7 A;  4JV5 O;  2F66 C;  4IYH A;  1GAX A;  1GM9 A;  4FIP C;  2ILM A;  2EIM C;  2RJZ A;  4JF3 A;  4JI1 O;  3JAR A;  1K33 A;  1NS1 A;  5CBH A;  3SYA A;  5JH7 B;  4X66 B;  3U11 A;  1V9P A;  3X2Q B;  2D3O W;  1GN4 A;  1IJG A;  1AVM A;  3G80 A;  2K1E A;  2MK3 A;  2XAG A;  1VQK V;  4LF4 O;  1KMI Z;  4WFF A;  5TIS Z;  2HJD A;  2CTR A;  3AG3 C;  3W7X A;  2W0F C;  1PPJ H;  2EIL B;  2YEV B;  5H6Q A;  1TUB A;  4RAI A;  2DMX A;  3OMN B;  3MAQ A;  1VQN V;  1WP7 A;  1K97 A;  2DQ3 A;  1TAE A;  1M56 C;  3D8C A;  3G6E V;  2WLL B;  1J95 A;  2RDC A;  4MT8 A;  3CRQ A;  1VQ6 V;  4DV7 B;  3H9V A;  2DYR B;  1Q81 W;  4DR7 O;  2QGN A;  3R66 A;  3CRR A;  1B6Q A;  4TV9 A;  1BQZ A;  1YTF B;  4Z1M G;  3E22 A;  1K9M W;  1D5A A;  4HNA B;  1URF A;  1NTK H;  4H33 A;  3CCR V;  3JCZ A;  2CAZ C;  2EJ7 A;  2LW1 A;  3CCL V;  4OXS A;  1MSW D;  4UB6 Z;  3LSU A;  1FS0 G;  5DM6 V;  2QWN B;  2F4V B;  4B3M B;  1WJZ A;  5CA0 A;  3FX7 A;  2E5L B;  5KHG A;  3SDL A;  3TCU A;  2ZM6 B;  1W0J G;  1M4U A;  1Q82 W;  1F51 A;  5H6R A;  2FL4 A;  1N32 B;  1MZF A;  4GLX A;  1VQ4 V;  2LW7 A;  3HR0 A;  2BCC H;  4DV5 O;  5KHI A;  4X64 B;  4UUJ C;  1VP7 A;  4UCR A;  4FLY A;  4J7J A;  3CX5 F;  2WLI A;  4XDJ A;  4B3T B;  2UXD B;  4DUZ B;  1Q6H A;  3P3P A;  4DV0 B;  2PZS A;  4PEL A;  4ZHQ A;  2LJ2 A;  4K8X A;  3VQW A;  4I5S A;  1N34 B;  4JI2 O;  1IBM O;  2R70 A;  2UUB O;  2JEU A;  3VBB A;  2ITC C;  2FYU H;  4G2K A;  2JS5 A;  2QDO A;  3N2G B;  1XNQ O;  3IAY A;  4LC1 A;  3ZMV A;  5C8Y A;  3BFR A;  4JI8 O;  1PNM A;  3G6B A;  4FLV A;  2EIK B;  2Q4P A;  2ZQM A;  4F6R B;  4JI0 B;  3ICX A;  4U7O A;  2JJ1 G;  3ASN B;  5JJJ B;  5LMU B;  3I55 V;  5CBG A;  1HWY A;  4AQY O;  5IYD O;  1UJW B;  5GTI Z;  2PGG A;  2EUL A;  2YID A;  3FYE B;  3MD0 A;  4JYA O;  4X89 A;  2DE0 X;  4PJ0 Z;  3CCJ V;  4JZG A;  1RP3 B;  3TGU H;  3A8T A;  5KAF Z;  5LXT A;  4UVB A;  2UUA B;  4EFB A;  2VS0 A;  3E8H A;  4DV6 B;  4YIP A;  1KKD A;  1E79 G;  3UKM A;  4AI8 A;  1OCC B;  3Q4H A;  4UCU A;  4DRX A;  5B1A B;  5H5N A;  1E1R G;  4FM2 A;  3UT5 A;  4GUN A;  4DR5 B;  2Q0A A;  1TUB B;  1GTO A;  4FFK A;  4LH6 A;  4GKK B;  1YVW A;  4YHH B;  5JVD A;  4J11 A;  4JI5 B;  4NTX A;  2R9I A;  1QHT A;  4MVZ A;  2ODM A;  1LUW A;  1VQ7 V;  1R6N A;  2GV9 A;  2YXH A;  2ZDI C;  3AEI A;  5EYP A;  3E8B A;  5K1X A;  2KSD A;  3E22 B;  5J2T A;  3BAB A;  2YIB A;  1EN4 A;  4NXM B;  1EN5 A;  3KCY A;  3RBZ A;  2YS8 A;  4OGQ B;  2JVD A;  2KKW A;  5LOV A;  3CRA A;  2WLN A;  2JK5 C;  3ZBH A;  2DQ0 A;  3CWB H;  1SS3 A;  3K57 A;  4UCS A;  5IJ9 A;  2P5O A;  5CA0 B;  1W59 A;  3QO5 A;  3GWK C;  2B5U A;  4I9W A;  1G1X B;  4I50 A;  1M90 W;  1K73 W;  5EBW C;  2M6Y A;  3CXH F;  3HB3 B;  1MZE A;  5GW7 A;  1JVM A;  1RPO A;  4ASU G;  2ZNI A;  4DUY O;  2VWJ A;  2NR5 A;  5CB4 A;  2GTA A;  4PDL A;  1FFT B;  2VWK A;  1WAZ A;  4YJ3 B;  4GCZ A;  4TQF A;  1F4M A;  2FKX A;  3W7W A;  3UO2 A;  2WLI B;  4DR4 O;  3ML0 A;  3CB2 A;  1BL8 A;  1EM1 A;  3FD9 A;  4ZHQ B;  4WFG A;  3RYH A;  2VQF B;  4QNH B;  1OHH G;  3OTO B;  1WPX A;  4NXN B;  1PNL A;  2IBZ H;  3QG5 A;  5D5Q A;  3HKE A;  3CPW U;  1OCZ C;  4B3S O;  1XNR B;  5C8Y B;  2GUZ B;  4JPR A;  4JYB A;  4B3R B;  4R50 A;  3F7V C;  3ZHQ A;  1YJ9 V;  2YSU B;  3PN1 A;  4X1K A;  2IU3 A;  5L3G A;  1GKF A;  5IYC O;  4DV1 B;  3AG1 B;  2OCC B;  4ICG A;  2IJH A;  5EIB D;  3T4Z A;  3WG7 C;  1BHB A;  4ABM A;  3U10 A;  3LDC A;  4K0K B;  3SYO A;  3FB8 C;  4NB5 A;  1Q8I A;  4CS2 A;  5IYZ A;  2OTJ V;  5B1A C;  1UFI A;  4DV2 O;  4HAM A;  3CRM A;  1JA8 A;  1VF6 A;  4WFH A;  3RYF A;  3ZRS A;  4X65 O;  2CTP A;  4WBN A;  5BMV B;  2UXC O;  2Y4T A;  3VQX A;  2QM4 A;  1DLB A;  1YJW V;  5JJN B;  3AG2 B;  3AG7 A;  2ZR2 A;  2HKO A;  2EIN B;  1DGS A;  3SPC A;  2PUS A;  1D5N A;  1V55 C;  4X20 A;  3UT5 B;  1SQQ H;  3ZMT A;  1V54 B;  3K9A A;  2E74 B;  1VAR A;  5B1B C;  1MMM A;  3BPZ A;  4UFZ A;  1JQ0 A;  5JVD B;  2P4V A;  2X6C A;  4LFB B;  2Q0O C;  4O2A A;  4X1Y B;  2B9Z A;  1B06 A;  4P2Z A;  1ZWI C;  5EBM C;  2UXN A;  1NR7 A;  2AZ2 A;  1X4T A;  4X8A A;  2Q7H A;  4DR2 O;  1VQL V;  4O4J B;  5H9C A;  3TET A;  2PYL A;  1ZX3 A;  5EK0 A;  5KAI Z;  2OYQ A;  1S77 D;  5LOV B;  3E8G A;  2OCH A;  5KUK A;  3ZN0 A;  5LYJ A;  2XAF A;  5IJ9 B;  4JZ2 A;  4NR1 A;  4QJF B;  4J9Z B;  3AG3 B;  4LF8 B;  4MVO A;  2ZE7 A;  1JX9 A;  3OMA B;  4I55 A;  2ZCE A;  4TSF G;  3OAA G;  5L3F A;  3ZN1 A;  1HNX B;  3HPL C;  1KU9 A;  2RNB A;  4I0X A;  4O4H A;  3K5L A;  1HNZ O;  3N27 A;  1M56 B;  2P7T C;  3ZRX A;  3CME V;  2HVK C;  1H2S B;  1OV9 A;  4ZOL A;  5CB4 B;  4P30 A;  4RQF A;  2X6A A;  4F4L A;  3P30 A;  4QE7 A;  1ORQ C;  4PA3 A;  2ZE8 A;  1K3E A;  1Y4M A;  4B08 A;  2QWR B;  4KHP B;  1H8E G;  4Z1V A;  2WPD G;  1RSO B;  4IGG A;  4O4I A;  1XRE A;  4G28 B;  4JI3 O;  3T1Y O;  1Y74 A;  2XUM A;  3ZX6 A;  1D2D A;  2B1G A;  2DW4 A;  2F93 B;  3AK2 A;  3OEH G;  2VRZ A;  3CSX A;  4BIU A;  5H2F Z;  4F6E A;  2Y69 C;  1R6T A;  1XOU A;  3JAS A;  1SQF A;  4OX9 B;  2A9H A;  1B3Q A;  5IDJ A;  2Q8V A;  3AG4 C;  3C90 A;  2UUC B;  3H1L H;  2ZXW C;  3ZCC A;  3ZS8 C;  3O9O A;  5LL6 Y;  2HP8 A;  2YIC A;  4UCV A;  5EC2 C;  5IWA B;  5KUM A;  4FLW A;  4X1K B;  4R7C A;  4J7K A;  4OPA A;  3OD4 A;  4JI6 O;  3RW0 A;  5KMG A;  1SQV H;  2ZKO A;  4WF9 V;  2F1M A;  5IYZ B;  4DR3 B;  5JJE B;  2X6B A;  1YIT V;  3TXS A;  4JI4 B;  3JAW A;  4BAY A;  2AW9 A;  3RYF B;  1H2M A;  1N33 B;  4N23 A;  1SES A;  3K5O A;  2YIA A;  3JAT A;  4J7Z A;  4JYY A;  1K4D C;  4D7T A;  3CC7 V;  3T2M A;  2CE4 A;  1X59 A;  1J5E B;  5EZY B;  5IT9 N;  5LGT A;  1QQC A;  3GWO A;  2N74 A;  2P06 A;  1MAB G;  2NNU A;  1ZSP A;  1VMG A;  2HEP A;  1LUV A;  4TUY A;  3AK3 A;  3CCM V;  3DC6 A;  1FJG B;  3OT7 A;  2CGN A;  4MVQ A;  4MTF A;  4O2A B;  4UCO A;  4RWU A;  4CS4 A;  1R3K C;  2QM8 A;  4NTW A;  4I9Q A;  4JV5 B;  4K35 A;  3GVM A;  1NZ6 A;  4LFA O;  3APO A;  5GTH Z;  3SJQ C;  4JI1 B;  3L71 H;  3VQV A;  5IE9 A;  4UVA A;  2KQX A;  2JJ2 G;  1BE3 H;  3CCQ V;  4LNU B;  1E1Q G;  2XND G;  1GM7 A;  3L72 H;  2P4K A;  4XDK A;  4CZZ A;  4LWS A;  5LYJ B;  5BR8 O;  1AI4 A;  4ZI7 B;  4LF4 B;  3ASO C;  1KBH A;  3E2E A;  3BRC A;  3SYC A;  1U96 A;  5AG2 A;  4I55 B;  4YXW G;  2YI8 A;  1M1K W;  4O4H B;  4H0L B;  1I5Y A;  1Q6U A;  5DED A;  4ZOL B;  1QU7 A;  1L1F A;  2V4D A;  1PKX A;  1F23 A;  2QWQ B;  3M7M X;  4O4I B;  4O2B A;  1FXK C;  2ZE5 A;  4TV8 B;  1I7F A;  1Y74 B;  4DR7 B;  3L75 H;  1S72 V;  2L6L A;  4LH7 A;  3KCX A;  1S5H C;  4Q6G A;  3ABK C;  4E4E A;  1VQ9 V;  1TUE B;  5JQG B;  3SYP A;  1FXH A;  2C2A A;  4IIJ A;  3CEI A;  1AJN A;  1Q3E A;  2QM7 A;  2QJ1 A;  2F95 B;  3AK1 A;  1FFX A;  3JAS B;  1AJQ A;  1YF2 A;  1Q43 A;  2VQE B;  1K8A W;  1RPR A;  4NYK A;  1EZJ A;  3K03 A;  1R3L C;  1FOU A;  4FVM A;  4PHZ A;  1H8H G;  2QSA A;  1MSD A;  4JTD B;  2Z5U A;  3DXR A;  5LA6 A;  3HKB A;  3CC4 V;  1DTO A;  2L35 A;  1VF6 C;  4UVC A;  5E1A C;  1QLE C;  1FAF A;  1KD1 W;  2WWW A;  3UQ8 A;  3K0D A;  1NU1 H;  1HDJ A;  3RYC A;  4K3A A;  4DV5 B;  3ZMU A;  2EZP A;  1NH2 D;  4PA6 A;  2QTS A;  3N2K A;  1H38 A;  2Z3Y A;  1CPY A;  1Z5W A;  3JAW B;  3ZRW B;  2QTO A;  3H01 A;  3D36 A;  3JAT B;  1DF5 A;  1GN6 A;  1SC5 B;  3IC9 A;  2CH7 B;  1AIL A;  4HBN A;  2JRI A;  4J41 A;  3CJH A;  2XTA A;  4JI2 B;  4FMT A;  1IBM B;  2UUB B;  1THZ A;  4FLT A;  3ZIA G;  4W4K A;  1OCZ B;  3JAR B;  1XBL A;  4GT1 A;  3RFR A;  1I94 O;  3JAM N;  2P90 A;  2Y4U A;  3I5D A;  1XNQ B;  2EJR A;  1N4C A;  1AR4 A;  2BSK A;  1JOY A;  3KDR A;  4JI8 B;  3CYO A;  5ITZ A;  4LF5 O;  3M8A A;  4BIO A;  1BQ0 A;  1Z2G A;  3WG7 B;  3B8N A;  3SYQ A;  4CH3 A;  2Q68 A;  4LP8 A;  4IL6 Z;  3G71 V;  5CA1 A;  1XMO O;  4X88 A;  5IYB O;  5J2U A;  1XQ8 A;  4YY3 O;  4G27 B;  2BTQ A;  2ZT9 B;  1FYJ A;  2Q67 A;  4AQY B;  2ARH A;  4JI5 O;  5KLV H;  1Q90 D;  4JYA B;  2LP7 A;  1NTZ H;  4H13 B;  1L8D A;  3ABT A;  2HVJ C;  5A9G A;  5KX5 A;  4DV3 O;  2P6J A;  2XAJ A;  3JAL A;  2LO1 A;  1GN2 A;  4LWS B;  2D2C B;  4QGP A;  1YTF D;  1AP5 A;  3S3W A;  3TJT A;  1GM8 A;  1IXB A;  1V55 B;  1QR8 A;  1BSM A;  2QE7 G;  4TV9 B;  3CCV V;  3L74 H;  4JAV A;  1TVK A;  5FPR A;  3CP1 A;  5LHG A;  5B1B B;  2CK3 G;  3ETQ A;  3K58 A;  4O4L A;  5FNV A;  2XAQ A;  5CN0 A;  1VQO V;  2BE3 A;  3OR7 C;  4KXR A;  2EZO A;  1EN6 A;  5HFM A;  2LGW A;  4KL1 A;  1IBL O;  3ZMZ A;  2Q73 A;  1QCE A;  1YCI A;  2UU9 O;  4FLZ A;  3K06 A;  4JAS A;  1Z5V A;  1S5L Z;  3WB0 A;  3ZHV A;  2ITD C;  2WAM A;  1NBM G;  2QWO B;  1FPO A;  1AB3 A;  1R6K A;  1YZB A;  2P22 C;  3EXA A;  4EKW A;  4FM1 A;  4J80 A;  3B40 A;  3DSQ A;  3E89 A;  1U97 A;  3DXR B;  3F7Y C;  3HKB B;  4YJ2 A;  3I56 V;  1FKA O;  3IFX A;  3W7U A;  4DR6 O;  1NR1 A;  1WA8 A;  1ZAU A;  3BCC H;  1XMQ O;  4DUY B;  1XL4 A;  3L70 H;  1IUR A;  2N04 A;  3RYC B;  4UV8 A;  1FXK A;  4DK0 A;  3ZHT A;  4TOI A;  3BA9 A;  3NR7 A;  1G4Y B;  3N2K B;  2Y0I A;  2ETN A;  3CE2 A;  4CH5 A;  4JI7 O;  2OWO A;  1MNG A;  4U3J A;  3STZ C;  5L3B A;  4DR4 B;  1MG1 A;  2KB1 A;  1S5J A;  3L9D A;  1N36 O;  2Y69 B;  4PDR A;  2RMK B;  3NXS A;  4K0K O;  4WFB V;  2LQT A;  5EC1 C;  3C3S A;  3JYC A;  5LMN O;  2IW5 A;  3CJH B;  3AG4 B;  5E79 Z;  4JTA B;  4LF6 O;  5EIB C;  4IHJ A;  2ZXW B;  1GMG A;  2QKS A;  4EB6 A;  1SF9 A;  3C3T A;  3K5N A;  3HKC A;  4AIL C;  2QEX V;  2BSK B;  4X62 O;  1P4R A;  4B3S B;  4X9Q A;  2W0X A;  1T5E A;  2Q9L A;  2HLD G;  4I4T A;  5ITZ B;  5LXT B;  1Y66 A;  5CMU A;  1ZUQ A;  5K1P A;  1K5S A;  5J2U B;  4FZ0 A;  2IH1 C;  1G6U A;  2F43 G; 
#chains in the Genus database with same CATH homology
 1EM1 A;  5AG2 A;  4YIP A;  1JR9 A;  1ZLZ A;  4GUN A;  2ADQ B;  4FFK A;  1AR4 A;  3KDR A;  1ZTE A;  3KKY A;  2AW9 A;  4C7U A;  3MDS A;  1WB8 A;  4YIO A;  1GN4 A;  4JZ2 A;  4JYY A;  1N0J A;  1LUW A;  1AVM A;  1PM9 A;  1QNM A;  1AP6 A;  4E4E A;  3CEI A;  2CE4 A;  2QKC A;  1AR5 A;  3AK1 A;  1ZSP A;  3EVK A;  1LUV A;  1WB7 A;  1N0N A;  3AK3 A;  1I0H A;  1EN4 A;  3K9S A;  5A9G A;  1EN5 A;  3DC6 A;  4BR6 A;  1MA1 A;  1GN2 A;  1MNG A;  1MSD A;  3OT7 A;  1XDC A;  1JA8 A;  1XRE A;  1Y67 A;  1AP5 A;  3BFR A;  3TJT A;  1IX9 A;  1IXB A;  3C3S A;  1BSM A;  1XUQ A;  2RCV A;  3AK2 A;  1P7G A;  1VEW A;  1KKC A;  4F6E A;  3QVN A;  2GDS A;  3C3T A;  1D5N A;  1SZX A;  2QKA A;  3DC5 A;  2ADP A;  4X9Q A;  1I08 A;  1GN3 A;  1VAR A;  1MMM A;  3RN4 A;  2P4K A;  1EN6 A;  3LSU A;  1BS3 A;  4JZG A;  2CDY A;  1BT8 A;  1IDS A;  1ZUQ A;  1PL4 A;  1GN6 A;  3IC9 A;  1XIL A;  1B06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...