2RCVA

Crystal structure of the bacillus subtilis superoxide dismutase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
AYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVADLDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFAAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDYISAFWNVVNWDEVARLYSER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bacillus subtilis superoxide dismutase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 69
structure length 200
sequence length 200
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2rcvA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2rcvA02
1XDCA 2P4KA 1AVMA 2CDYA 1D5NA 2RCVA 1EN5A 4C7UA 3EVKA 5AG2A 3OT7A 1XUQA 4JYYA 1KKCA 2AW9A 1N0NA 4GUNA 1IDSA 1GN3A 3TJTA 4BR6A 1AP5A 1PM9A 4YIOA 4JZGA 3CEIA 1PL4A 1BS3A 1AR5A 3K9SA 3DC6A 1JR9A 1EM1A 1VEWA 3BFRA 1IX9A 3AK2A 1JA8A 4F6EA 1EN4A 3AK3A 1BT8A 1GN2A 1AP6A 1SZXA 2ADPA 4JZ2A 1N0JA 1ZTEA 1B06A 1BSMA 1QNMA 2QKCA 3KKYA 2CE4A 1VARA 1EN6A 3DC5A 1MNGA 2QKAA 3C3SA 3C3TA 1WB7A 1LUVA 1LUWA 1ZLZA 2GDSA 1MSDA 1ZUQA 3AK1A 3IC9A 5A9GA 1GN6A 1ZSPA 1I08A 4FFKA 2ADQB 1IXBA 1Y67A 1MMMA 1P7GA 1I0HA 4YIPA 3LSUA 1XREA 1MA1A 1WB8A 3MDSA 1AR4A 1XILA 3RN4A 3QVNA 4X9QA 1GN4A 4E4EA
chains in the Genus database with same CATH superfamily
1FYJA 4RUFA 3P32A 4GYCB 2VQEB 1LNQA 1R6KA 4HYOA 2LW1A 3RYCB 2FB5A 3B8MA 3P30A 2Q5ZA 4JI4B 3UKMA 1BGYH 2UUAB 4O4IB 2GHYA 5B1BC 3S3XA 1GN3A 5L3FA 1GM7A 4FPPA 1S77D 2RMKB 1NTKH 3FB5C 1EFRG 2UUAO 2F23A 2CH7B 4JZGA 3CP1A 1GO3F 1TA8A 3CYOA 5EZYA 1M57B 4GCZA 5L3BA 1PNLA 3IC7A 5B1AB 3N2KA 3BRCA 1MABG 3BFRA 1Q82W 3RYIA 1HNZB 4IYIA 1BMFG 4F6EA 3SYPA 4PJ0Z 4MTFA 3OM3B 3OAAG 4PA6A 3E8BA 2IW5A 3I56V 5JCOA 2Q6AA 4PDMA 2CGNA 4ASUG 4LF7O 2UUCB 5C93A 1SQVH 2FTKA 1JFFA 2Y0IA 1QCEA 4JI7O 4LFCB 1VF6C 1E1RG 1Z2GA 4F6RB 4I55B 1SESA 4DR7B 5LYJA 1IBKO 4PDRA 4LF4O 1QLEB 5CBHA 2Z3YA 4UB6Z 4X62B 4DRXB 1WB8A 3HB3B 3K08A 2BTOA 2YXLA 3H1IH 1GN4A 3M8AA 4JGSA 1ROPA 2BTQB 4B7KA 5ITZB 3OMAB 3WG7B 1KUQA 3W7SA 1HNWO 5GTIZ 2UXCO 4I4TB 3AG4B 5E79Z 1K33A 2BOBC 1L1FA 3SPJA 1N33B 1XQ8A 3E2EA 3K03A 4LP8A 3SJAC 5D5QA 3RVZA 2PY5A 3OTFA 1M1KW 1AB3A 4X66B 1OHHG 2WLJA 1Z5WA 3ABMB 3E89A 4HNAA 1GMGA 2OT5A 3BA9A 4FM2A 2JJ1G 3ABKC 1AP5A 5LGTA 2DWDC 2A0LA 1Y66A 4QPJA 1VQLV 1JVMA 2XAQA 1FJGB 5K1XA 4K8ZA 4PDLA 4GKKO 2EULA 5ITZA 2ZR3A 3FAVB 4YJ2B 3IAYA 4PDVA 4MVSA 1EN4A 1JQ0A 4W4LA 4FMTA 3RWRD 4ZOLA 4JZ2A 1MOFA 3A0BZ 1S0VA 3RBZA 4NKGB 2QR4A 4CC6A 1YHQV 2NLJC 4WF9V 3HKCB 1XNRB 1GAXA 1KU9A 3CE2A 5J2UA 1O9HA 4B3TB 3LSQA 2H8PC 2Q69A 4JYCA 1EZJA 2GDSA 1MSDA 1YCIA 2YSUB 2EIKC 2Y0PA 4QE9A 2ZQMA 5K1PA 2WA4A 2PF4E 3K0GA 1SC5B 1WLEA 4J42A 5IJ0B 3TXSA 2BE3A 1N4CA 3ASOB 5JVDA 1FXHA 4CBCA 5C8YB 3STZC 5FPOA 3JAKB 2N04A 3RFRA 1MZEA 2RCVA 4Z1VA 5LBQA 1OV9A 2HJFC 1OCRC 2ETNA 2B1GA 3D36C 4RAIA 3J7AU 4DR6B 1S5JA 2YDEA 1R3LC 3OT7A 3E8GA 1G8MA 1BQZA 4CH5A 3SR2C 2EJ7A 4LF5O 4GUNA 4DV4B 3ML0A 3FB6C 4BAYA 2LJ2A 2YEVA 1OCZB 5B1NA 2UU9O 1DF4A 3ETQA 3ZMUA 5EBWC 4GKJB 2EZOA 2UXDB 4DR1B 3F5TA 4JI1O 1EM1A 2X7RB 2JJ2G 3OTOO 4YHHO 3AK2A 4JTDB 1HWYA 1NTMH 4DUYO 1FJGO 3S3WA 2EIJB 1BT8A 2XNDG 1AP6A 2VQFB 2JGDB 2RNBA 3JAWB 1IBKB 1FOUA 3EHBB 1B06A 3CJHA 2CUGA 3FB7C 3R65A 3CC7V 4BIZA 3OGIB 2YEVB 1VARA 4IIJB 2ZE7A 1EN6A 3C3SA 3PJSK 1VQ7V 1YEWA 1B6QA 2ZCEA 1WNSA 4O4JA 3IFXA 2R9AA 1I5XA 3T1CA 5A9GA 1S5HC 4B3TO 1CPYA 4OXSA 1T5EA 2P67A 1RSOA 4YJ3A 2Q7GA 3RYCA 4WFFA 4AILC 5JQGA 3N2GA 4CH6A 3LSUA 5BR8B 5J2TB 3MHHC 2R9IA 4ZHQA 2QEXV 3E22A 3RGBA 3K5MA 5B1OA 1COWG 5DEDA 3NR7A 2KKWA 4FZ0A 2CDYA 3KCXA 1D5NA 2PGGA 5GW7A 5BMVB 3CMEV 2UUBB 1KQSU 2HFEC 1FFXB 3ASNB 1WPBA 3HKEB 2X6CA 5LA6B 2QA4V 4DYLA 5EK0A 1RSOB 1N0NA 4P2ZA 1VQ9V 4LF7B 4BR6A 3JALB 1I94O 1OCOC 5CB4A 1R6TA 5B66Z 4NTYA 4A5UB 3LNMB 2UXBB 2RJZA 4OPHA 5FPRA 1WP7A 3ZJZA 3QO7A 3AEIA 1VEWA 4PD4F 1W59A 1VQPV 4FLTA 5GONB 5DECA 2WLLB 4DW1A 2E5LO 2AZ2A 4DW0A 4I4TA 1W0JG 4PELA 1PP9H 1SZXA 2Q0OC 4J41A 3B40A 3OEHG 3F5WC 2UUCO 3W7XA 3CX5F 3W7WA 4DV1B 1UPGA 4LNUA 1TUBA 1LR1A 4UXNA 3ZHUA 2EIMC 3GVMA 4U3JA 1QVFU 4ZHQB 4DR7O 2P7TC 1V9PA 2WA3A 4DR1O 4LC1A 1ZL8B 4DR4B 5JH7B 5IY5C 1IBMO 3AG1B 2P90A 4TV8A 2O57A 1XL4A 3VBBA 3DXRB 4X62O 3IJ4A 1NQTA 3HKCA 2JIZG 5CA3A 1JNBA 1YVWA 4DV2O 1WJZA 3E86A 4H37A 3ZMSA 4DV6O 3LDEA 3WU2Z 4D7TA 4JI8B 4WFEA 5EC2C 4D7SA 2WLLA 1KP2A 3Q4HB 5CBFA 1YIJV 1UFIA 4O2AA 4RWUA 2ZINA 1PL0A 1HNXO 2R70A 2HEPA 1VIBA 3JATB 4IHJA 1QQCA 4MTOA 5CA1B 3TCUA 1IDSA 2E74B 4MVMA 4JV5B 2A06H 3K5LA 1Y74A 1M56B 5LOVB 1NS1A 1URFA 1SQFA 1BS3A 1YDXA 2HJDA 3K9SA 4X64B 3ZMZA 4PA4A 5LHIA 2Q0AA 1KP3A 2WLNA 3L71H 3QF7A 1WN7A 1H8EG 3CHXA 4KHPB 2ATKC 2V4DA 3A0HZ 3AG3B 2F66C 3K5OA 4KL1A 1Q6IA 1YTFB 4UVBA 2NN4A 4NTXA 2G38A 4MT8A 4DUZB 3ZEDA 5LOVA 2WPDG 2X0LA 2ZKOA 4Q20A 1MNGA 5L3EA 2IU0A 1WA8B 4FM0A 1V55C 5C8YA 5IYZA 2PYLA 1SZTA 1KB9F 3H1HH 3ZS8C 2EJRA 3FKSG 3A0RA 1GN6A 5H2FZ 1KC8W 3CCJV 1ZWIC 4JI6B 2ADQB 2A7WA 3THOA 5LHGA 1Q86W 4I50A 3JATA 4RO2A 4YXWG 5EYPA 1K9MW 5CA1A 4WFBV 2BSKA 5DN6G 4IIJA 2DMXA 2KB1A 4WFGA 5LMNO 1WA8A 2RDCA 2DYRC 1HDJA 1BZKA 1TVKB 3MHSC 4GT1A 1PPJH 2YUAA 3SPHA 2HR3A 2F4VB 3CRRA 1XUQA 2ZD9A 1F23A 1NR1A 1KKCA 4O4HA 1SKVA 1K3EA 3L73H 4TV9A 2BOCC 5FL7G 3ZN1A 1IBLB 2PUSA 2DYSB 3AG2C 2IH1C 3H1LH 1BHBA 3ZHTA 1PM9A 4X1IB 2YI9A 5J2TA 3HKBB 5KHJA 1OCOB 3T1YB 2HG5C 4LH7A 4LWSA 3WB1A 5L3GA 3AG1C 3L75H 3JSLA 1IVSA 4NYKA 1V54C 3G6EV 1M9NA 5LA6A 4R7CA 1F4NA 3GWKC 3ICXA 2PI5A 1MG1A 3JD3A 2DQ3A 5H9CA 3RW0A 1Y6XA 3LDDA 2ITDC 3M7MX 4IGGA 5FNVA 3A2FA 2OCHA 2Q7EA 3ZRSA 3OR6C 4FK5C 3N2GB 4QE7A 3DC5A 2Y48A 5JJEB 3G71V 1D5AA 3RYIB 3FFQA 5JVDB 4J9ZB 3C3TA 4J10A 2F95B 4NTWA 3QO5A 4PV1B 3ZX6A 4BIUA 4DV3O 1GRJA 2M7WA 3CS5A 3D36A 3IC9A 1OZ0A 3BCCH 5KHKA 1I7FA 2XOKG 4PA9A 1PNMA 4GKKB 1ZX3A 1IXBA 3CPWU 1FXVA 2UXDO 1N34B 4KHPO 1HR0O 5KUKA 4D6TH 1H2NA 2OIGA 1K4CC 3UQ8A 1QR8A 2F1MA 4X66O 2XASA 2Z5UA 3J81N 3ASNC 2UUBO 2B5UA 2VQFO 1XI1A 4LWSB 5D5PA 1M5IA 5CA0B 1K97A 2ZE8A 3SDLA 1YJNV 1VQ5V 2RN9A 2EIMB 3FB8C 2PZSA 2GV9A 3OFNG 3LUTB 5AG2A 2L6LA 3IGAC 3K59A 3ZIAG 2AW9A 5GONA 3MAQA 2X6AA 2JEXA 1W0KG 5BZBA 4UB8Z 2YICA 3W7UA 5B5EZ 2W6IG 5EC1C 4I0XA 4FM1A 2DYSC 3AG2B 4UV8A 3SPGA 1YXBA 1SF9A 5KHGA 2ZDIA 4CS4A 3ZRXA 1VF5B 4WFHA 4DR4O 2E5LB 2HVJC 4LR3A 1NU1H 5BY1A 5IDJA 1JA8A 1H2LA 3T2MA 4DR3B 4LF8O 2B9ZA 1OCRB 1I94B 4JI5O 1Y74B 4F4LA 3OD4A 1K7DA 4GX1A 3JARB 1WPXA 3APOA 5HFLA 4TSFG 5KX5B 2XAGA 1AI4A 2B1IA 3HPLC 3P3PA 4O4LA 3DGEA 3RT3C 1P4RA 1XMQO 3SJQC 4PA3A 5LMUO 1WB7A 4G27B 1RM1C 1ZLZA 1S76D 5LMUB 3JCUZ 1US6A 5KMGA 3ZHQA 3SPIA 3O65A 4J7KA 2IJJA 1V54B 1MMMA 4J80A 2Q4PA 2IU3A 4TQDA 1GKFA 2VQEO 3OEEG 4YIPA 1QHTA 5J2UB 3CRMA 3G6BA 3L70H 1R3KC 4FVMA 3VQYA 1TAEA 1U97A 3I55V 3OUSA 2VWJA 2HKOA 4XDJA 4X88A 3FAVA 2ODMA 1RP3B 2LFSA 4I7ZB 4EEQA 4AQYB 1THZA 3G67A 1QR9A 4DR6O 3OTOB 3CCEV 2K1EA 3ASOC 3BHPA 4J9YB 2E3CA 1FAFA 1H2MA 5IJ0A 1JX9A 2IBZH 5JJNB 1HR0B 1JMKC 2BSKB 1K8AW 1M56C 2W0FC 2LGQA 1HNXB 1BHAA 2CTWA 4EFEA 1RPRA 2ILMA 3T4ZA 4UCVA 3AG4C 3AK3A 5L3CA 5IT9N 5TISZ 1DK1A 3R66A 1SQXH 4MVOA 5E1AC 1Z5VA 4TV8B 2UXXA 3OW2U 1N34O 4MW3A 2Q9LA 2CE4A 1HNWB 2IH3C 4JI5B 1P49A 1R3IC 1YF2A 3APQA 4UCRA 4IL6Z 1H5WA 1K92A 4J11A 3CCUV 3GB7C 1GK9A 2GBOA 4JV5O 1EBOA 4JAVA 4FJCC 2QWNB 4TT3G 4KXRA 1JJ2U 1R3JC 5KAFZ 2KSDA 4FLXA 2CGOA 2K9PA 2WWWA 3WB2A 2Y4TA 2QWPB 1J5EO 2Q8VA 2IJHA 1AR4A 2CH7A 2XUMA 3D3IA 1ZAUA 4O4JB 4LF6B 3B77A 1XOUA 1NI8A 1NZ6A 1YI2V 4B3SO 4JI2B 1Q6HA 4UFZA 4QIWF 3KZIZ 4FLYA 4C7UA 1SQPH 4GX2A 3L9DA 1XEQA 2Q68A 5LYJB 2HHHB 1ORQC 1BCCH 1RPOA 1Y4MA 2E75B 3J80N 4YJ3B 1MZFA 4FLZA 2L35A 5B1AC 4K0KO 3JASB 1P84F 5JQGB 2WLIA 1VP7A 3JAWA 5KHIA 1ENVA 4DRXA 4OPAA 3RVYA 4L87A 1SETA 5JWPA 3LNNA 4DV5O 1YJ9V 5F2VO 1VQNV 5KA6A 1Q8IA 1U96A 1KBHA 5IY5B 4X1YA 4UVCA 5L3DA 1VQKV 3VQXA 2CAZC 2GUZA 1XHXA 2OWOA 1NVPB 2QDOA 1S5LZ 1RM1B 3H1JH 4KFMA 2GSMB 4NB5A 3PN1A 5KUMA 3CC2V 2QSAA 3UO3A 1NBMG 2QM8A 2EZPA 2V1DA 3ZMTA 2WLIB 3N27A 3OGCC 5IYCO 2ZIMA 5LXTA 4WBNA 4QPKA 3B8NA 3QG5A 3K06A 5BMVA 3WG7C 1O9GA 3WFVA 2A79B 4B3RB 3E8FA 1WP8A 4UCSA 2AHYA 5GTHZ 4YJ2A 3KDRA 3X2QC 4XBFA 2DN9A 3JAMN 3BEHA 3CMAV 1G1XB 1NVPD 3H1KH 1P7GA 1SA0B 2JS3A 1XREA 1WAZA 4U3FH 5CB4B 2Z0AA 2P22C 5EIBC 4JYAO 4JI0O 3BAAA 2VWKA 2HLDG 1JFFB 4GX0A 5HFMA 2P4KA 4E2LA 4U3JB 4DR5O 1HP8A 1XMOB 2BCCH 1GTOA 2ZM6B 2EIJC 2R72A 1YSCA 4X65O 3N2KB 4P30A 5LHHA 1Q3EA 3SYOA 2KG7A 3CCMV 4GKJO 4DV0B 2ZM6O 3CRCA 4MS2A 2XTAA 3DSQA 4LFBB 4JI1B 4MVQA 4DV0O 4MTXA 3D3QA 2YIAA 3WB0A 3L72H 1NT2B 3JD2A 4NR1A 2JVDA 5FLXN 1IZ3A 1NTZH 2QE7G 2E76B 5KA5A 4X8AA 4J7JA 3RYFB 3L74H 4W4KA 3SJCC 1M57C 5IYBO 1XNQO 4DV7O 5KMGB 2ZDIC 2GTAA 3SGIA 2H3OA 1N0JA 2P4VA 2HHHO 3K0DA 2CK3G 4ICGA 3A8TA 1QU7A 2JRIA 1H8HG 3CCRV 1Q7YW 1IJGA 1R73A 2QKAA 3CC4V 2EILC 3K3WA 4JI3O 3K9AA 3D8CA 4BW5A 3UO2A 2M6YA 3AK1A 1ZSPA 4AQYO 2P6JA 2X6BA 2YIBD 4NXMO 4PHZA 3Q4HA 4CH4A 4LCUC 1PV0A 3SYCA 3RYHB 1AJQA 3BY6A 2KG7B 4UCUA 2XAJA 3FD9A 3NXSA 2HVKC 4PA7A 4QGPA 4E4EA 4K8XA 1K4DC 3CCLV 2YS8A 2YXHA 4MVRA 1AVMA 3VOUA 1R1BA 1YJWV 4K35A 4U7NA 1N36B 1YITV 5IYZB 2QTSA 1Q81W 1M93A 2OTLV 1EN5A 2XHBA 2IJIA 4JI0B 1SQQH 1X59A 3OMIB 3UT5A 2DYRB 4JYYA 2LW7A 1W2BU 4HBNA 4YY3B 2P5OA 1FPOA 4Z1MG 3K5NA 4DV6B 1P7BA 4ZOLB 2LGWA 3ABUA 4YY3O 5EBMC 1N33O 2ZE6A 4OX9O 2ZNJA 4B08A 2OIEA 4J7ZA 1L0LH 4G28B 4Z2WA 4FFBB 3FX7A 1NJIW 1RFYA 1AI6A 4B7EA 2PI4A 1NR7A 3HKEA 3HR0A 2F4VO 3JD1A 1V55B 4MSWC 4O4HB 4X1IA 1E1QG 1E79G 2D2CB 3EFFK 2P06A 4ZI7B 3ABTA 1AJNA 3AG3C 1FXKA 4MW8A 5JCOC 4HZ3A 1LUVA 4GLXA 1DGSA 2EX3A 3T1HO 2ZT9B 1M4UA 1UJWB 2LO1A 4FFKA 3ZBHA 1TVKA 3LSSA 3T1HB 4IYHA 4MTGA 4O4IA 5KX5A 1H2GA 2IM9A 2NR5A 1PNKA 2LP7A 5LXTB 1DF5A 4CS3A 1MA1A 2V7QG 4H0LB 3MDSA 3QTCA 2VRZA 4JASA 1VQ4V 3ABKB 4TV9B 4K3AA 3JSNA 4TUYB 2QM7A 4XDKA 2CTQA 4JPRA 1TGOA 4DV3B 4I55A 1PD3A 1NH2B 3C90A 4U7OA 1MSWD 3H01A 3CJHB 1Q90D 3F7YC 1SQBH 3B09A 1L8DA 1FS0G 2XAHA 5KHHA 4NXNO 3CXHF 3DC6A 4NVPA 4F6RA 4JI4O 1QLEC 1JPXA 3JD4A 1GM9A 4JI3B 4LF4B 4FZ1A 4DXWA 3DXRA 1SRYA 3ZHRA 4IHJB 3ABMC 1G6UA 3CSXA 3G4SV 3STLC 2DQ0A 5IE9A 3U10A 1ZTEA 2Q73A 3T1YO 2N74A 1XHZA 3KKYA 3B2EE 3ZRWB 1HNZO 3ABLB 4TUYA 1AROP 2JEUA 4GZRB 3DTUB 2NNUA 4X65B 4EFBA 3QNEA 1K5QA 2WAMA 4DV2B 1F51A 4JTCB 4WFAV 2JGUA 4I9WA 1XL6A 2H94A 3K79A 1I0HA 3TGUH 5LMNB 3JARA 4KUMA 4UCTA 1KD1W 2ARHA 1AILA 3RN4A 4RUEA 2DOSA 4O4LB 3K58A 4HNAB 3ZRWA 3JALA 1XDCA 2WSSG 3CWBH 1KYOF 3K57A 4Q6GA 1HW7A 4I0XB 5H5NA 1VF7A 1Y76A 1XNQB 4DV7B 5JH7A 4YHHB 4BW9A 5H6RA 2C2AA 4O2BB 2F93B 4X1YB 3F7VC 1I5YA 1CEZA 2FYUH 5IJ9B 4R8CA 4B3MO 4HAMA 1AJPA 3E35A 3O9OA 5LP6A 2DE0X 2WLHA 1IXMA 2PTMA 5BR8O 1JR9A 5DM6V 3JAKA 1FKAO 1ZL8A 1Y76B 4CC5A 1KKDA 2RQ6A 2GTSA 2EBOA 2UXBO 4N23A 2WLKA 1GH6A 4JI2O 1TUEB 3UT5B 4TQFA 4I50B 5B1BB 3CD6V 1BSMA 2MK3A 1QNMA 3TK1A 3HKDB 3ZHSA 4LFAO 3RYHA 1JOYA 3OR7C 2EINB 5LP6C 3HKBA 4RQEA 2W6JG 4QNHB 4JF3A 2QWRB 4FLUA 2GUZB 2MW2B 2WLMA 4LF6O 1ZUQA 4O2AB 4LF9O 4CS2A 1Q6UA 3U0ZA 4AI8A 4LF9B 4JAUA 1B04A 4DV4O 3MD0A 5LGNA 1OCZC 1K73W 1XILA 4UV9A 4CH3A 1KMIZ 4AHCA 1J5EB 1AI5A 4X9QA 1F7YA 1YZBA 1VQ8V 4ZBMA 2LQTA 2OTJV 2YI8A 3BABA 2FMLA 1SERA 4NXMB 3CRQA 4X1KA 3OE7G 4FLVA 1JCHA 4DV5B 4ABMA 1VQMV 1DLBA 4JI8O 4KP4A 3SYAA 5IYDO 3TJTA 1VQ6V 4JTAB 2ZXWC 1XMQB 1S72V 3W7TA 5JJJB 2BTQA 1VMGA 1N36O 4H44B 1CXZB 3CEIA 4DV1O 1OCCB 1IBLO 1PL4A 1AR5A 3BA8A 2AGAA 3X2QB 4I5SA 1OJHA 1VQOV 4B3MB 1IX9A 1YTFD 1FXKB 4BIOA 4LH6A 2EIKB 4JAAA 2R9RB 4P9OA 2DJVA 3ETEA 1JJOA 1H2SB 2UU9B 3KCYA 4DR2O 2Q7HA 4K0KB 1QBZA 4DO2A 4DR2B 2Y69B 2XAFA 2CTRA 3RYFA 5B3SB 3EXAA 4G2KA 4EB6B 3OUFA 2JS5A 4X1KB 3ZRVA 1IURA 1LUWA 4X89A 4LF5B 4LFCO 4LFAB 3E22B 3B4SA 1AI7A 1FFXA 3SJBC 2OYQA 3E8HA 1F4MA 1BE3H 3GWOA 3CB2A 4DR5B 2Y4UA 3UCSC 3TXQA 3BPZA 4ZIBA 3JD0A 3CCVV 1NKDA 4L8JA 5EZYB 4LFBO 4FLWA 2QGNA 4IT5A 4N21A 3SPCA 3BVOA 4EB6A 1BQ0A 1R6NA 4B3RO 1VF6A 5KAIZ 5IWAO 2FKXA 1SA0A 4WCEV 2UXCB 2QKSA 2F43G 1N8RW 5IWAB 2YIDA 2QWQB 3U11A 4JI6O 2IJKA 1S3JA 4YIOA 4I9QA 2D3OW 5EIBD 4WBNB 1FD9A 4B3SB 3I5DA 2YC0A 3VQVA 3TETA 4TOIA 2QWOB 5CA0A 1KECA 2Q67A 1XMOO 4PI0A 4EKWA 4UUJC 1EZVH 3VQWA 4O2BA 2ZR2A 4FIPC 4X20B 4NXNB 5LGUA 3H9VA 2N05A 1D2DA 2AHZA 1G4YB 5KLVH 1K5SA 4CZZA 3CRAA 1PKXA 3CCSV 4LBEC 4TWKA 2QTOA 1AR1B 3ZHVA 4DK0A 2FL4A 3ZMVA 1IBMB 1J95A 3T4DA 3K04A 4OX9B 5CN0A 1FXKC 1NH2D 1N32B 1FFTB 3ZN0A 1H38A 5LL6Y 4UVAA 1SS3A 1OCCC 2AZ0A 4JYBA 1BL8A 3KG2A 4JI7B 5LP6B 3LDCA 2ZXWB 2PYJA 2EINC 2JK5C 3E83A 2W0XA 1XBLA 2XT9A 3P3NA 4R50A 3JYCA 5B3SC 2Y69C 3EVKA 5BXZA 2ITCC 4MVUA 5H6QA 2KQXA 3ETGA 1SQGA 3HKDA 2YXYA 4BWAA 3CXCU 1GM8A 4MVZA 4X20A 4X64O 2DW4A 4RQFA 4OGQB 3OMNB 4LNUB 5EBLC 1Q43A 5J9PC 2OCCB 1QVGU 2YIBA 2EILB 2QJ1A 2VS0A 2JDIG 1GN2A 2A3QA 2ADPA 3SYQA 3CCQV 3M99B 4H33A 5EYPB 4DUZO 3G80A 4UCOA 5CMUA 2UXNA 3JCZA 4R6ZA 2QM4A 4GX5A 4DR3O 4LF8B 2QKCA 3UM7A 3ZCCA 4P9PA 5A2QN 3FYEB 1Q5OA 4FFBA 4H13B 5CBGA 1H2KA 2ZNIA 1L0NH 1B3QA 2DWEC 1K34A 1QLNA 2JGDA 3QO8A 4XDLA 1DTOA 3AG7A 2OCCC 2ZIOA 4DUYB 1I08A 4DK1A 4JYAB 1CP9A 1X4TA 3ETDA 1Y67A 4PI2A 4ZKIA 2A9HA 3JASA 1TUBB 3FYIB 1XNRO 1A32A 3ABLC 5FNVB 2AXTZ 1M90W 2LFRA 4QJFB 2CTPA 5IJ9A 2HP8A 4ZI7A 1N32O 3QVNA 2ZE5A
chains in the Genus database with same CATH topology
1XDCA 2P4KA 1AVMA 2CDYA 1D5NA 2RCVA 1EN5A 4C7UA 3EVKA 5AG2A 3OT7A 1XUQA 4JYYA 1KKCA 2AW9A 1N0NA 4GUNA 1IDSA 1GN3A 3TJTA 4BR6A 1AP5A 1PM9A 4YIOA 4JZGA 3CEIA 1PL4A 1BS3A 1AR5A 3K9SA 3DC6A 1JR9A 1EM1A 1VEWA 3BFRA 1IX9A 3AK2A 1JA8A 4F6EA 1EN4A 3AK3A 1BT8A 1GN2A 1AP6A 1SZXA 2ADPA 4JZ2A 1N0JA 1ZTEA 1B06A 1BSMA 1QNMA 2QKCA 3KKYA 2CE4A 1VARA 1EN6A 3DC5A 1MNGA 2QKAA 3C3SA 3C3TA 1WB7A 1LUVA 1LUWA 1ZLZA 2GDSA 1MSDA 1ZUQA 3AK1A 3IC9A 5A9GA 1GN6A 1ZSPA 3KDRA 1I08A 4FFKA 2ADQB 1IXBA 1Y67A 1MMMA 1P7GA 1I0HA 4YIPA 3LSUA 1XREA 1MA1A 1WB8A 3MDSA 1AR4A 1XILA 3RN4A 3QVNA 4X9QA 1GN4A 4E4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XDC A;  2P4K A;  1AVM A;  2CDY A;  1D5N A;  2RCV A;  1EN5 A;  4C7U A;  3EVK A;  5AG2 A;  3OT7 A;  1XUQ A;  4JYY A;  1KKC A;  2AW9 A;  1N0N A;  4GUN A;  1IDS A;  1GN3 A;  3TJT A;  4BR6 A;  1AP5 A;  1PM9 A;  4YIO A;  4JZG A;  3CEI A;  1PL4 A;  1BS3 A;  1AR5 A;  3K9S A;  3DC6 A;  1JR9 A;  1EM1 A;  1VEW A;  3BFR A;  1IX9 A;  3AK2 A;  1JA8 A;  4F6E A;  1EN4 A;  3AK3 A;  1BT8 A;  1GN2 A;  1AP6 A;  1SZX A;  2ADP A;  4JZ2 A;  1N0J A;  1ZTE A;  1B06 A;  1BSM A;  1QNM A;  2QKC A;  3KKY A;  2CE4 A;  1VAR A;  1EN6 A;  3DC5 A;  1MNG A;  2QKA A;  3C3S A;  3C3T A;  1WB7 A;  1LUV A;  1LUW A;  1ZLZ A;  2GDS A;  1MSD A;  1ZUQ A;  3AK1 A;  3IC9 A;  5A9G A;  1GN6 A;  1ZSP A;  1I08 A;  4FFK A;  2ADQ B;  1IXB A;  1Y67 A;  1MMM A;  1P7G A;  1I0H A;  4YIP A;  3LSU A;  1XRE A;  1MA1 A;  1WB8 A;  3MDS A;  1AR4 A;  1XIL A;  3RN4 A;  3QVN A;  4X9Q A;  1GN4 A;  4E4E A; 
#chains in the Genus database with same CATH topology
 1FYJ A;  4RUF A;  3P32 A;  4GYC B;  2VQE B;  1LNQ A;  1R6K A;  4HYO A;  2LW1 A;  3RYC B;  2FB5 A;  3B8M A;  3P30 A;  2Q5Z A;  4JI4 B;  3UKM A;  1BGY H;  2UUA B;  4O4I B;  2GHY A;  5B1B C;  3S3X A;  1GN3 A;  5L3F A;  1GM7 A;  4FPP A;  1S77 D;  2RMK B;  1NTK H;  3FB5 C;  1EFR G;  2UUA O;  2F23 A;  2CH7 B;  4JZG A;  3CP1 A;  1GO3 F;  1TA8 A;  3CYO A;  5EZY A;  1M57 B;  4GCZ A;  5L3B A;  1PNL A;  3IC7 A;  5B1A B;  3N2K A;  3BRC A;  1MAB G;  3BFR A;  1Q82 W;  3RYI A;  1HNZ B;  4IYI A;  1BMF G;  4F6E A;  3SYP A;  4PJ0 Z;  4MTF A;  3OM3 B;  3OAA G;  4PA6 A;  3E8B A;  2IW5 A;  3I56 V;  5JCO A;  2Q6A A;  4PDM A;  2CGN A;  4ASU G;  4LF7 O;  2UUC B;  5C93 A;  1SQV H;  2FTK A;  1JFF A;  2Y0I A;  1QCE A;  4JI7 O;  4LFC B;  1VF6 C;  1E1R G;  1Z2G A;  4F6R B;  4I55 B;  1SES A;  4DR7 B;  5LYJ A;  1IBK O;  4PDR A;  4LF4 O;  1QLE B;  5CBH A;  2Z3Y A;  4UB6 Z;  4X62 B;  4DRX B;  1WB8 A;  3HB3 B;  3K08 A;  2BTO A;  2YXL A;  3H1I H;  1GN4 A;  3M8A A;  4JGS A;  1ROP A;  2BTQ B;  4B7K A;  5ITZ B;  3OMA B;  3WG7 B;  1KUQ A;  3W7S A;  1HNW O;  5GTI Z;  2UXC O;  4I4T B;  3AG4 B;  5E79 Z;  1K33 A;  2BOB C;  1L1F A;  3SPJ A;  1N33 B;  1XQ8 A;  3E2E A;  3K03 A;  4LP8 A;  3SJA C;  5D5Q A;  3RVZ A;  2PY5 A;  3OTF A;  1M1K W;  1AB3 A;  4X66 B;  1OHH G;  2WLJ A;  1Z5W A;  3ABM B;  3E89 A;  4HNA A;  1GMG A;  2OT5 A;  3BA9 A;  4FM2 A;  2JJ1 G;  3ABK C;  1AP5 A;  5LGT A;  2DWD C;  2A0L A;  1Y66 A;  4QPJ A;  1VQL V;  1JVM A;  2XAQ A;  1FJG B;  5K1X A;  4K8Z A;  4PDL A;  4GKK O;  2EUL A;  5ITZ A;  2ZR3 A;  3FAV B;  4YJ2 B;  3IAY A;  4PDV A;  4MVS A;  1EN4 A;  1JQ0 A;  4W4L A;  4FMT A;  3RWR D;  4ZOL A;  4JZ2 A;  1MOF A;  3A0B Z;  1S0V A;  3RBZ A;  4NKG B;  2QR4 A;  4CC6 A;  1YHQ V;  2NLJ C;  4WF9 V;  3HKC B;  1XNR B;  1GAX A;  1KU9 A;  3CE2 A;  5J2U A;  1O9H A;  4B3T B;  3LSQ A;  2H8P C;  2Q69 A;  4JYC A;  1EZJ A;  2GDS A;  1MSD A;  1YCI A;  2YSU B;  2EIK C;  2Y0P A;  4QE9 A;  2ZQM A;  5K1P A;  2WA4 A;  2PF4 E;  3K0G A;  1SC5 B;  1WLE A;  4J42 A;  5IJ0 B;  3TXS A;  2BE3 A;  1N4C A;  3ASO B;  5JVD A;  1FXH A;  4CBC A;  5C8Y B;  3STZ C;  5FPO A;  3JAK B;  2N04 A;  3RFR A;  1MZE A;  2RCV A;  4Z1V A;  5LBQ A;  1OV9 A;  2HJF C;  1OCR C;  2ETN A;  2B1G A;  3D36 C;  4RAI A;  3J7A U;  4DR6 B;  1S5J A;  2YDE A;  1R3L C;  3OT7 A;  3E8G A;  1G8M A;  1BQZ A;  4CH5 A;  3SR2 C;  2EJ7 A;  4LF5 O;  4GUN A;  4DV4 B;  3ML0 A;  3FB6 C;  4BAY A;  2LJ2 A;  2YEV A;  1OCZ B;  5B1N A;  2UU9 O;  1DF4 A;  3ETQ A;  3ZMU A;  5EBW C;  4GKJ B;  2EZO A;  2UXD B;  4DR1 B;  3F5T A;  4JI1 O;  1EM1 A;  2X7R B;  2JJ2 G;  3OTO O;  4YHH O;  3AK2 A;  4JTD B;  1HWY A;  1NTM H;  4DUY O;  1FJG O;  3S3W A;  2EIJ B;  1BT8 A;  2XND G;  1AP6 A;  2VQF B;  2JGD B;  2RNB A;  3JAW B;  1IBK B;  1FOU A;  3EHB B;  1B06 A;  3CJH A;  2CUG A;  3FB7 C;  3R65 A;  3CC7 V;  4BIZ A;  3OGI B;  2YEV B;  1VAR A;  4IIJ B;  2ZE7 A;  1EN6 A;  3C3S A;  3PJS K;  1VQ7 V;  1YEW A;  1B6Q A;  2ZCE A;  1WNS A;  4O4J A;  3IFX A;  2R9A A;  1I5X A;  3T1C A;  5A9G A;  1S5H C;  4B3T O;  1CPY A;  4OXS A;  1T5E A;  2P67 A;  1RSO A;  4YJ3 A;  2Q7G A;  3RYC A;  4WFF A;  4AIL C;  5JQG A;  3N2G A;  4CH6 A;  3LSU A;  5BR8 B;  5J2T B;  3MHH C;  2R9I A;  4ZHQ A;  2QEX V;  3E22 A;  3RGB A;  3K5M A;  5B1O A;  1COW G;  5DED A;  3NR7 A;  2KKW A;  4FZ0 A;  2CDY A;  3KCX A;  1D5N A;  2PGG A;  5GW7 A;  5BMV B;  3CME V;  2UUB B;  1KQS U;  2HFE C;  1FFX B;  3ASN B;  1WPB A;  3HKE B;  2X6C A;  5LA6 B;  2QA4 V;  4DYL A;  5EK0 A;  1RSO B;  1N0N A;  4P2Z A;  1VQ9 V;  4LF7 B;  4BR6 A;  3JAL B;  1I94 O;  1OCO C;  5CB4 A;  1R6T A;  5B66 Z;  4NTY A;  4A5U B;  3LNM B;  2UXB B;  2RJZ A;  4OPH A;  5FPR A;  1WP7 A;  3ZJZ A;  3QO7 A;  3AEI A;  1VEW A;  4PD4 F;  1W59 A;  1VQP V;  4FLT A;  5GON B;  5DEC A;  2WLL B;  4DW1 A;  2E5L O;  2AZ2 A;  4DW0 A;  4I4T A;  1W0J G;  4PEL A;  1PP9 H;  1SZX A;  2Q0O C;  4J41 A;  3B40 A;  3OEH G;  3F5W C;  2UUC O;  3W7X A;  3CX5 F;  3W7W A;  4DV1 B;  1UPG A;  4LNU A;  1TUB A;  1LR1 A;  4UXN A;  3ZHU A;  2EIM C;  3GVM A;  4U3J A;  1QVF U;  4ZHQ B;  4DR7 O;  2P7T C;  1V9P A;  2WA3 A;  4DR1 O;  4LC1 A;  1ZL8 B;  4DR4 B;  5JH7 B;  5IY5 C;  1IBM O;  3AG1 B;  2P90 A;  4TV8 A;  2O57 A;  1XL4 A;  3VBB A;  3DXR B;  4X62 O;  3IJ4 A;  1NQT A;  3HKC A;  2JIZ G;  5CA3 A;  1JNB A;  1YVW A;  4DV2 O;  1WJZ A;  3E86 A;  4H37 A;  3ZMS A;  4DV6 O;  3LDE A;  3WU2 Z;  4D7T A;  4JI8 B;  4WFE A;  5EC2 C;  4D7S A;  2WLL A;  1KP2 A;  3Q4H B;  5CBF A;  1YIJ V;  1UFI A;  4O2A A;  4RWU A;  2ZIN A;  1PL0 A;  1HNX O;  2R70 A;  2HEP A;  1VIB A;  3JAT B;  4IHJ A;  1QQC A;  4MTO A;  5CA1 B;  3TCU A;  1IDS A;  2E74 B;  4MVM A;  4JV5 B;  2A06 H;  3K5L A;  1Y74 A;  1M56 B;  5LOV B;  1NS1 A;  1URF A;  1SQF A;  1BS3 A;  1YDX A;  2HJD A;  3K9S A;  4X64 B;  3ZMZ A;  4PA4 A;  5LHI A;  2Q0A A;  1KP3 A;  2WLN A;  3L71 H;  3QF7 A;  1WN7 A;  1H8E G;  3CHX A;  4KHP B;  2ATK C;  2V4D A;  3A0H Z;  3AG3 B;  2F66 C;  3K5O A;  4KL1 A;  1Q6I A;  1YTF B;  4UVB A;  2NN4 A;  4NTX A;  2G38 A;  4MT8 A;  4DUZ B;  3ZED A;  5LOV A;  2WPD G;  2X0L A;  2ZKO A;  4Q20 A;  1MNG A;  5L3E A;  2IU0 A;  1WA8 B;  4FM0 A;  1V55 C;  5C8Y A;  5IYZ A;  2PYL A;  1SZT A;  1KB9 F;  3H1H H;  3ZS8 C;  2EJR A;  3FKS G;  3A0R A;  1GN6 A;  5H2F Z;  1KC8 W;  3CCJ V;  1ZWI C;  4JI6 B;  2ADQ B;  2A7W A;  3THO A;  5LHG A;  1Q86 W;  4I50 A;  3JAT A;  4RO2 A;  4YXW G;  5EYP A;  1K9M W;  5CA1 A;  4WFB V;  2BSK A;  5DN6 G;  4IIJ A;  2DMX A;  2KB1 A;  4WFG A;  5LMN O;  1WA8 A;  2RDC A;  2DYR C;  1HDJ A;  1BZK A;  1TVK B;  3MHS C;  4GT1 A;  1PPJ H;  2YUA A;  3SPH A;  2HR3 A;  2F4V B;  3CRR A;  1XUQ A;  2ZD9 A;  1F23 A;  1NR1 A;  1KKC A;  4O4H A;  1SKV A;  1K3E A;  3L73 H;  4TV9 A;  2BOC C;  5FL7 G;  3ZN1 A;  1IBL B;  2PUS A;  2DYS B;  3AG2 C;  2IH1 C;  3H1L H;  1BHB A;  3ZHT A;  1PM9 A;  4X1I B;  2YI9 A;  5J2T A;  3HKB B;  5KHJ A;  1OCO B;  3T1Y B;  2HG5 C;  4LH7 A;  4LWS A;  3WB1 A;  5L3G A;  3AG1 C;  3L75 H;  3JSL A;  1IVS A;  4NYK A;  1V54 C;  3G6E V;  1M9N A;  5LA6 A;  4R7C A;  1F4N A;  3GWK C;  3ICX A;  2PI5 A;  1MG1 A;  3JD3 A;  2DQ3 A;  5H9C A;  3RW0 A;  1Y6X A;  3LDD A;  2ITD C;  3M7M X;  4IGG A;  5FNV A;  3A2F A;  2OCH A;  2Q7E A;  3ZRS A;  3OR6 C;  4FK5 C;  3N2G B;  4QE7 A;  3DC5 A;  2Y48 A;  5JJE B;  3G71 V;  1D5A A;  3RYI B;  3FFQ A;  5JVD B;  4J9Z B;  3C3T A;  4J10 A;  2F95 B;  4NTW A;  3QO5 A;  4PV1 B;  3ZX6 A;  4BIU A;  4DV3 O;  1GRJ A;  2M7W A;  3CS5 A;  3D36 A;  3IC9 A;  1OZ0 A;  3BCC H;  5KHK A;  1I7F A;  2XOK G;  4PA9 A;  1PNM A;  4GKK B;  1ZX3 A;  1IXB A;  3CPW U;  1FXV A;  2UXD O;  1N34 B;  4KHP O;  1HR0 O;  5KUK A;  4D6T H;  1H2N A;  2OIG A;  1K4C C;  3UQ8 A;  1QR8 A;  2F1M A;  4X66 O;  2XAS A;  2Z5U A;  3J81 N;  3ASN C;  2UUB O;  2B5U A;  2VQF O;  1XI1 A;  4LWS B;  5D5P A;  1M5I A;  5CA0 B;  1K97 A;  2ZE8 A;  3SDL A;  1YJN V;  1VQ5 V;  2RN9 A;  2EIM B;  3FB8 C;  2PZS A;  2GV9 A;  3OFN G;  3LUT B;  5AG2 A;  2L6L A;  3IGA C;  3K59 A;  3ZIA G;  2AW9 A;  5GON A;  3MAQ A;  2X6A A;  2JEX A;  1W0K G;  5BZB A;  4UB8 Z;  2YIC A;  3W7U A;  5B5E Z;  2W6I G;  5EC1 C;  4I0X A;  4FM1 A;  2DYS C;  3AG2 B;  4UV8 A;  3SPG A;  1YXB A;  1SF9 A;  5KHG A;  2ZDI A;  4CS4 A;  3ZRX A;  1VF5 B;  4WFH A;  4DR4 O;  2E5L B;  2HVJ C;  4LR3 A;  1NU1 H;  5BY1 A;  5IDJ A;  1JA8 A;  1H2L A;  3T2M A;  4DR3 B;  4LF8 O;  2B9Z A;  1OCR B;  1I94 B;  4JI5 O;  1Y74 B;  4F4L A;  3OD4 A;  1K7D A;  4GX1 A;  3JAR B;  1WPX A;  3APO A;  5HFL A;  4TSF G;  5KX5 B;  2XAG A;  1AI4 A;  2B1I A;  3HPL C;  3P3P A;  4O4L A;  3DGE A;  3RT3 C;  1P4R A;  1XMQ O;  3SJQ C;  4PA3 A;  5LMU O;  1WB7 A;  4G27 B;  1RM1 C;  1ZLZ A;  1S76 D;  5LMU B;  3JCU Z;  1US6 A;  5KMG A;  3ZHQ A;  3SPI A;  3O65 A;  4J7K A;  2IJJ A;  1V54 B;  1MMM A;  4J80 A;  2Q4P A;  2IU3 A;  4TQD A;  1GKF A;  2VQE O;  3OEE G;  4YIP A;  1QHT A;  5J2U B;  3CRM A;  3G6B A;  3L70 H;  1R3K C;  4FVM A;  3VQY A;  1TAE A;  1U97 A;  3I55 V;  3OUS A;  2VWJ A;  2HKO A;  4XDJ A;  4X88 A;  3FAV A;  2ODM A;  1RP3 B;  2LFS A;  4I7Z B;  4EEQ A;  4AQY B;  1THZ A;  3G67 A;  1QR9 A;  4DR6 O;  3OTO B;  3CCE V;  2K1E A;  3ASO C;  3BHP A;  4J9Y B;  2E3C A;  1FAF A;  1H2M A;  5IJ0 A;  1JX9 A;  2IBZ H;  5JJN B;  1HR0 B;  1JMK C;  2BSK B;  1K8A W;  1M56 C;  2W0F C;  2LGQ A;  1HNX B;  1BHA A;  2CTW A;  4EFE A;  1RPR A;  2ILM A;  3T4Z A;  4UCV A;  3AG4 C;  3AK3 A;  5L3C A;  5IT9 N;  5TIS Z;  1DK1 A;  3R66 A;  1SQX H;  4MVO A;  5E1A C;  1Z5V A;  4TV8 B;  2UXX A;  3OW2 U;  1N34 O;  4MW3 A;  2Q9L A;  2CE4 A;  1HNW B;  2IH3 C;  4JI5 B;  1P49 A;  1R3I C;  1YF2 A;  3APQ A;  4UCR A;  4IL6 Z;  1H5W A;  1K92 A;  4J11 A;  3CCU V;  3GB7 C;  1GK9 A;  2GBO A;  4JV5 O;  1EBO A;  4JAV A;  4FJC C;  2QWN B;  4TT3 G;  4KXR A;  1JJ2 U;  1R3J C;  5KAF Z;  2KSD A;  4FLX A;  2CGO A;  2K9P A;  2WWW A;  3WB2 A;  2Y4T A;  2QWP B;  1J5E O;  2Q8V A;  2IJH A;  1AR4 A;  2CH7 A;  2XUM A;  3D3I A;  1ZAU A;  4O4J B;  4LF6 B;  3B77 A;  1XOU A;  1NI8 A;  1NZ6 A;  1YI2 V;  4B3S O;  4JI2 B;  1Q6H A;  4UFZ A;  4QIW F;  3KZI Z;  4FLY A;  4C7U A;  1SQP H;  4GX2 A;  3L9D A;  1XEQ A;  2Q68 A;  5LYJ B;  2HHH B;  1ORQ C;  1BCC H;  1RPO A;  1Y4M A;  2E75 B;  3J80 N;  4YJ3 B;  1MZF A;  4FLZ A;  2L35 A;  5B1A C;  4K0K O;  3JAS B;  1P84 F;  5JQG B;  2WLI A;  1VP7 A;  3JAW A;  5KHI A;  1ENV A;  4DRX A;  4OPA A;  3RVY A;  4L87 A;  1SET A;  5JWP A;  3LNN A;  4DV5 O;  1YJ9 V;  5F2V O;  1VQN V;  5KA6 A;  1Q8I A;  1U96 A;  1KBH A;  5IY5 B;  4X1Y A;  4UVC A;  5L3D A;  1VQK V;  3VQX A;  2CAZ C;  2GUZ A;  1XHX A;  2OWO A;  1NVP B;  2QDO A;  1S5L Z;  1RM1 B;  3H1J H;  4KFM A;  2GSM B;  4NB5 A;  3PN1 A;  5KUM A;  3CC2 V;  2QSA A;  3UO3 A;  1NBM G;  2QM8 A;  2EZP A;  2V1D A;  3ZMT A;  2WLI B;  3N27 A;  3OGC C;  5IYC O;  2ZIM A;  5LXT A;  4WBN A;  4QPK A;  3B8N A;  3QG5 A;  3K06 A;  5BMV A;  3WG7 C;  1O9G A;  3WFV A;  2A79 B;  4B3R B;  3E8F A;  1WP8 A;  4UCS A;  2AHY A;  5GTH Z;  4YJ2 A;  3KDR A;  3X2Q C;  4XBF A;  2DN9 A;  3JAM N;  3BEH A;  3CMA V;  1G1X B;  1NVP D;  3H1K H;  1P7G A;  1SA0 B;  2JS3 A;  1XRE A;  1WAZ A;  4U3F H;  5CB4 B;  2Z0A A;  2P22 C;  5EIB C;  4JYA O;  4JI0 O;  3BAA A;  2VWK A;  2HLD G;  1JFF B;  4GX0 A;  5HFM A;  2P4K A;  4E2L A;  4U3J B;  4DR5 O;  1HP8 A;  1XMO B;  2BCC H;  1GTO A;  2ZM6 B;  2EIJ C;  2R72 A;  1YSC A;  4X65 O;  3N2K B;  4P30 A;  5LHH A;  1Q3E A;  3SYO A;  2KG7 A;  3CCM V;  4GKJ O;  4DV0 B;  2ZM6 O;  3CRC A;  4MS2 A;  2XTA A;  3DSQ A;  4LFB B;  4JI1 B;  4MVQ A;  4DV0 O;  4MTX A;  3D3Q A;  2YIA A;  3WB0 A;  3L72 H;  1NT2 B;  3JD2 A;  4NR1 A;  2JVD A;  5FLX N;  1IZ3 A;  1NTZ H;  2QE7 G;  2E76 B;  5KA5 A;  4X8A A;  4J7J A;  3RYF B;  3L74 H;  4W4K A;  3SJC C;  1M57 C;  5IYB O;  1XNQ O;  4DV7 O;  5KMG B;  2ZDI C;  2GTA A;  3SGI A;  2H3O A;  1N0J A;  2P4V A;  2HHH O;  3K0D A;  2CK3 G;  4ICG A;  3A8T A;  1QU7 A;  2JRI A;  1H8H G;  3CCR V;  1Q7Y W;  1IJG A;  1R73 A;  2QKA A;  3CC4 V;  2EIL C;  3K3W A;  4JI3 O;  3K9A A;  3D8C A;  4BW5 A;  3UO2 A;  2M6Y A;  3AK1 A;  1ZSP A;  4AQY O;  2P6J A;  2X6B A;  2YIB D;  4NXM O;  4PHZ A;  3Q4H A;  4CH4 A;  4LCU C;  1PV0 A;  3SYC A;  3RYH B;  1AJQ A;  3BY6 A;  2KG7 B;  4UCU A;  2XAJ A;  3FD9 A;  3NXS A;  2HVK C;  4PA7 A;  4QGP A;  4E4E A;  4K8X A;  1K4D C;  3CCL V;  2YS8 A;  2YXH A;  4MVR A;  1AVM A;  3VOU A;  1R1B A;  1YJW V;  4K35 A;  4U7N A;  1N36 B;  1YIT V;  5IYZ B;  2QTS A;  1Q81 W;  1M93 A;  2OTL V;  1EN5 A;  2XHB A;  2IJI A;  4JI0 B;  1SQQ H;  1X59 A;  3OMI B;  3UT5 A;  2DYR B;  4JYY A;  2LW7 A;  1W2B U;  4HBN A;  4YY3 B;  2P5O A;  1FPO A;  4Z1M G;  3K5N A;  4DV6 B;  1P7B A;  4ZOL B;  2LGW A;  3ABU A;  4YY3 O;  5EBM C;  1N33 O;  2ZE6 A;  4OX9 O;  2ZNJ A;  4B08 A;  2OIE A;  4J7Z A;  1L0L H;  4G28 B;  4Z2W A;  4FFB B;  3FX7 A;  1NJI W;  1RFY A;  1AI6 A;  4B7E A;  2PI4 A;  1NR7 A;  3HKE A;  3HR0 A;  2F4V O;  3JD1 A;  1V55 B;  4MSW C;  4O4H B;  4X1I A;  1E1Q G;  1E79 G;  2D2C B;  3EFF K;  2P06 A;  4ZI7 B;  3ABT A;  1AJN A;  3AG3 C;  1FXK A;  4MW8 A;  5JCO C;  4HZ3 A;  1LUV A;  4GLX A;  1DGS A;  2EX3 A;  3T1H O;  2ZT9 B;  1M4U A;  1UJW B;  2LO1 A;  4FFK A;  3ZBH A;  1TVK A;  3LSS A;  3T1H B;  4IYH A;  4MTG A;  4O4I A;  5KX5 A;  1H2G A;  2IM9 A;  2NR5 A;  1PNK A;  2LP7 A;  5LXT B;  1DF5 A;  4CS3 A;  1MA1 A;  2V7Q G;  4H0L B;  3MDS A;  3QTC A;  2VRZ A;  4JAS A;  1VQ4 V;  3ABK B;  4TV9 B;  4K3A A;  3JSN A;  4TUY B;  2QM7 A;  4XDK A;  2CTQ A;  4JPR A;  1TGO A;  4DV3 B;  4I55 A;  1PD3 A;  1NH2 B;  3C90 A;  4U7O A;  1MSW D;  3H01 A;  3CJH B;  1Q90 D;  3F7Y C;  1SQB H;  3B09 A;  1L8D A;  1FS0 G;  2XAH A;  5KHH A;  4NXN O;  3CXH F;  3DC6 A;  4NVP A;  4F6R A;  4JI4 O;  1QLE C;  1JPX A;  3JD4 A;  1GM9 A;  4JI3 B;  4LF4 B;  4FZ1 A;  4DXW A;  3DXR A;  1SRY A;  3ZHR A;  4IHJ B;  3ABM C;  1G6U A;  3CSX A;  3G4S V;  3STL C;  2DQ0 A;  5IE9 A;  3U10 A;  1ZTE A;  2Q73 A;  3T1Y O;  2N74 A;  1XHZ A;  3KKY A;  3B2E E;  3ZRW B;  1HNZ O;  3ABL B;  4TUY A;  1ARO P;  2JEU A;  4GZR B;  3DTU B;  2NNU A;  4X65 B;  4EFB A;  3QNE A;  1K5Q A;  2WAM A;  4DV2 B;  1F51 A;  4JTC B;  4WFA V;  2JGU A;  4I9W A;  1XL6 A;  2H94 A;  3K79 A;  1I0H A;  3TGU H;  5LMN B;  3JAR A;  4KUM A;  4UCT A;  1KD1 W;  2ARH A;  1AIL A;  3RN4 A;  4RUE A;  2DOS A;  4O4L B;  3K58 A;  4HNA B;  3ZRW A;  3JAL A;  1XDC A;  2WSS G;  3CWB H;  1KYO F;  3K57 A;  4Q6G A;  1HW7 A;  4I0X B;  5H5N A;  1VF7 A;  1Y76 A;  1XNQ B;  4DV7 B;  5JH7 A;  4YHH B;  4BW9 A;  5H6R A;  2C2A A;  4O2B B;  2F93 B;  4X1Y B;  3F7V C;  1I5Y A;  1CEZ A;  2FYU H;  5IJ9 B;  4R8C A;  4B3M O;  4HAM A;  1AJP A;  3E35 A;  3O9O A;  5LP6 A;  2DE0 X;  2WLH A;  1IXM A;  2PTM A;  5BR8 O;  1JR9 A;  5DM6 V;  3JAK A;  1FKA O;  1ZL8 A;  1Y76 B;  4CC5 A;  1KKD A;  2RQ6 A;  2GTS A;  2EBO A;  2UXB O;  4N23 A;  2WLK A;  1GH6 A;  4JI2 O;  1TUE B;  3UT5 B;  4TQF A;  4I50 B;  5B1B B;  3CD6 V;  1BSM A;  2MK3 A;  1QNM A;  3TK1 A;  3HKD B;  3ZHS A;  4LFA O;  3RYH A;  1JOY A;  3OR7 C;  2EIN B;  5LP6 C;  3HKB A;  4RQE A;  2W6J G;  4QNH B;  4JF3 A;  2QWR B;  4FLU A;  2GUZ B;  2MW2 B;  2WLM A;  4LF6 O;  1ZUQ A;  4O2A B;  4LF9 O;  4CS2 A;  1Q6U A;  3U0Z A;  4AI8 A;  4LF9 B;  4JAU A;  1B04 A;  4DV4 O;  3MD0 A;  5LGN A;  1OCZ C;  1K73 W;  1XIL A;  4UV9 A;  4CH3 A;  1KMI Z;  4AHC A;  1J5E B;  1AI5 A;  4X9Q A;  1F7Y A;  1YZB A;  1VQ8 V;  4ZBM A;  2LQT A;  2OTJ V;  2YI8 A;  3BAB A;  2FML A;  1SER A;  4NXM B;  3CRQ A;  4X1K A;  3OE7 G;  4FLV A;  1JCH A;  4DV5 B;  4ABM A;  1VQM V;  1DLB A;  4JI8 O;  4KP4 A;  3SYA A;  5IYD O;  3TJT A;  1VQ6 V;  4JTA B;  2ZXW C;  1XMQ B;  1S72 V;  3W7T A;  5JJJ B;  2BTQ A;  1VMG A;  1N36 O;  4H44 B;  1CXZ B;  3CEI A;  4DV1 O;  1OCC B;  1IBL O;  1PL4 A;  1AR5 A;  3BA8 A;  2AGA A;  3X2Q B;  4I5S A;  1OJH A;  1VQO V;  4B3M B;  1IX9 A;  1YTF D;  1FXK B;  4BIO A;  4LH6 A;  2EIK B;  4JAA A;  2R9R B;  4P9O A;  2DJV A;  3ETE A;  1JJO A;  1H2S B;  2UU9 B;  3KCY A;  4DR2 O;  2Q7H A;  4K0K B;  1QBZ A;  4DO2 A;  4DR2 B;  2Y69 B;  2XAF A;  2CTR A;  3RYF A;  5B3S B;  3EXA A;  4G2K A;  4EB6 B;  3OUF A;  2JS5 A;  4X1K B;  3ZRV A;  1IUR A;  1LUW A;  4X89 A;  4LF5 B;  4LFC O;  4LFA B;  3E22 B;  3B4S A;  1AI7 A;  1FFX A;  3SJB C;  2OYQ A;  3E8H A;  1F4M A;  1BE3 H;  3GWO A;  3CB2 A;  4DR5 B;  2Y4U A;  3UCS C;  3TXQ A;  3BPZ A;  4ZIB A;  3JD0 A;  3CCV V;  1NKD A;  4L8J A;  5EZY B;  4LFB O;  4FLW A;  2QGN A;  4IT5 A;  4N21 A;  3SPC A;  3BVO A;  4EB6 A;  1BQ0 A;  1R6N A;  4B3R O;  1VF6 A;  5KAI Z;  5IWA O;  2FKX A;  1SA0 A;  4WCE V;  2UXC B;  2QKS A;  2F43 G;  1N8R W;  5IWA B;  2YID A;  2QWQ B;  3U11 A;  4JI6 O;  2IJK A;  1S3J A;  4YIO A;  4I9Q A;  2D3O W;  5EIB D;  4WBN B;  1FD9 A;  4B3S B;  3I5D A;  2YC0 A;  3VQV A;  3TET A;  4TOI A;  2QWO B;  5CA0 A;  1KEC A;  2Q67 A;  1XMO O;  4PI0 A;  4EKW A;  4UUJ C;  1EZV H;  3VQW A;  4O2B A;  2ZR2 A;  4FIP C;  4X20 B;  4NXN B;  5LGU A;  3H9V A;  2N05 A;  1D2D A;  2AHZ A;  1G4Y B;  5KLV H;  1K5S A;  4CZZ A;  3CRA A;  1PKX A;  3CCS V;  4LBE C;  4TWK A;  2QTO A;  1AR1 B;  3ZHV A;  4DK0 A;  2FL4 A;  3ZMV A;  1IBM B;  1J95 A;  3T4D A;  3K04 A;  4OX9 B;  5CN0 A;  1FXK C;  1NH2 D;  1N32 B;  1FFT B;  3ZN0 A;  1H38 A;  5LL6 Y;  4UVA A;  1SS3 A;  1OCC C;  2AZ0 A;  4JYB A;  1BL8 A;  3KG2 A;  4JI7 B;  5LP6 B;  3LDC A;  2ZXW B;  2PYJ A;  2EIN C;  2JK5 C;  3E83 A;  2W0X A;  1XBL A;  2XT9 A;  3P3N A;  4R50 A;  3JYC A;  5B3S C;  2Y69 C;  3EVK A;  5BXZ A;  2ITC C;  4MVU A;  5H6Q A;  2KQX A;  3ETG A;  1SQG A;  3HKD A;  2YXY A;  4BWA A;  3CXC U;  1GM8 A;  4MVZ A;  4X20 A;  4X64 O;  2DW4 A;  4RQF A;  4OGQ B;  3OMN B;  4LNU B;  5EBL C;  1Q43 A;  5J9P C;  2OCC B;  1QVG U;  2YIB A;  2EIL B;  2QJ1 A;  2VS0 A;  2JDI G;  1GN2 A;  2A3Q A;  2ADP A;  3SYQ A;  3CCQ V;  3M99 B;  4H33 A;  5EYP B;  4DUZ O;  3G80 A;  4UCO A;  5CMU A;  2UXN A;  3JCZ A;  4R6Z A;  2QM4 A;  4GX5 A;  4DR3 O;  4LF8 B;  2QKC A;  3UM7 A;  3ZCC A;  4P9P A;  5A2Q N;  3FYE B;  1Q5O A;  4FFB A;  4H13 B;  5CBG A;  1H2K A;  2ZNI A;  1L0N H;  1B3Q A;  2DWE C;  1K34 A;  1QLN A;  2JGD A;  3QO8 A;  4XDL A;  1DTO A;  3AG7 A;  2OCC C;  2ZIO A;  4DUY B;  1I08 A;  4DK1 A;  4JYA B;  1CP9 A;  1X4T A;  3ETD A;  1Y67 A;  4PI2 A;  4ZKI A;  2A9H A;  3JAS A;  1TUB B;  3FYI B;  1XNR O;  1A32 A;  3ABL C;  5FNV B;  2AXT Z;  1M90 W;  2LFR A;  4QJF B;  2CTP A;  5IJ9 A;  2HP8 A;  4ZI7 A;  1N32 O;  3QVN A;  2ZE5 A; 
#chains in the Genus database with same CATH homology
 1XDC A;  2P4K A;  1AVM A;  2CDY A;  1D5N A;  2RCV A;  1EN5 A;  4C7U A;  3EVK A;  5AG2 A;  3OT7 A;  1XUQ A;  4JYY A;  1KKC A;  2AW9 A;  1N0N A;  4GUN A;  1IDS A;  1GN3 A;  3TJT A;  4BR6 A;  1AP5 A;  1PM9 A;  4YIO A;  4JZG A;  3CEI A;  1PL4 A;  1BS3 A;  1AR5 A;  3K9S A;  3DC6 A;  1JR9 A;  1EM1 A;  1VEW A;  3BFR A;  1IX9 A;  3AK2 A;  1JA8 A;  4F6E A;  1EN4 A;  3AK3 A;  1BT8 A;  1GN2 A;  1AP6 A;  1SZX A;  2ADP A;  4JZ2 A;  1N0J A;  1ZTE A;  1B06 A;  1BSM A;  1QNM A;  2QKC A;  3KKY A;  2CE4 A;  1VAR A;  1EN6 A;  3DC5 A;  1MNG A;  2QKA A;  3C3S A;  3C3T A;  1WB7 A;  1LUV A;  1LUW A;  1ZLZ A;  2GDS A;  1MSD A;  1ZUQ A;  3AK1 A;  3IC9 A;  5A9G A;  1GN6 A;  1ZSP A;  3KDR A;  1I08 A;  4FFK A;  2ADQ B;  1IXB A;  1Y67 A;  1MMM A;  1P7G A;  1I0H A;  4YIP A;  3LSU A;  1XRE A;  1MA1 A;  1WB8 A;  3MDS A;  1AR4 A;  1XIL A;  3RN4 A;  3QVN A;  4X9Q A;  1GN4 A;  4E4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...