2RCVA

Crystal structure of the bacillus subtilis superoxide dismutase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
AYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVADLDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFAAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDYISAFWNVVNWDEVARLYSER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
publication title Structure of Bacillus subtilis superoxide dismutase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 69
structure length 200
sequence length 200
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2rcvA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2rcvA02
2AW9A 3EVKA 4YIOA 3IC9A 1B06A 1QNMA 3C3SA 1ZSPA 3QVNA 1N0NA 2ADQB 1KKCA 1WB8A 1EN4A 1P7GA 3CEIA 2QKCA 3MDSA 4GUNA 1GN3A 1IX9A 1GN4A 4C7UA 1XREA 2ADPA 1SZXA 3AK1A 1N0JA 1LUVA 1JA8A 1EM1A 1MSDA 1BSMA 3RN4A 1I0HA 1MA1A 2CE4A 4X9QA 4E4EA 1ZTEA 1MNGA 1PL4A 1PM9A 2CDYA 1ZUQA 1XILA 2QKAA 1D5NA 3BFRA 1I08A 3C3TA 1JR9A 3KKYA 1IDSA 1AR4A 1ZLZA 4JZ2A 4JZGA 1GN6A 2RCVA 5AG2A 1LUWA 1VARA 3K9SA 3TJTA 1AP6A 1AP5A 3DC5A 4JYYA 1EN5A 2P4KA 2GDSA 1BT8A 3DC6A 4BR6A 5A9GA 1AR5A 3LSUA 4F6EA 1WB7A 3AK3A 3OT7A 4FFKA 1EN6A 1AVMA 1XDCA 4YIPA 1MMMA 1BS3A 1VEWA 1GN2A 1Y67A 1XUQA 3AK2A 1IXBA
chains in the Genus database with same CATH superfamily
1F4MA 4YIOA 5IT9N 1Z5VA 2DW4A 2IH1C 4MVOA 3DXRB 1AROP 2DQ0A 5J2TB 2KKWA 2Q7EA 5IJ9A 4JI0O 3K58A 4GUNA 4DV5O 2DOSA 1FXKA 4TOIA 3ZX6A 2PUSA 3KG2A 4DV6O 4CH6A 3TXSA 2YS8A 1X4TA 3HKDA 2QWPB 3R66A 1Q82W 4NB5A 1Y6XA 3RN4A 3OGIB 1IBMO 2QWRB 4PI2A 1H2LA 1ZTEA 2ZR2A 3ABKC 4I5SA 5HFMA 1YJWV 3ZRWB 1ZUQA 2XAFA 1AR1B 4PI0A 1O9HA 5KAFZ 1BMFG 5LGUA 2EIKC 3GWKC 2N04A 1EZVH 5LHHA 1XNQO 4EB6B 2ZQMA 4QIWF 4TV9B 3L73H 3N2KB 2YC0A 3KZIZ 3QO7A 4DUYO 2ILMA 3L71H 2JIZG 4R8CA 4DV3B 2V4DA 3TETA 1XMQO 5FLXN 1K4DC 4JYAO 2CGNA 2EIMB 2DQ3A 4K35A 4D6TH 1K4CC 2RMKB 2IJHA 1MG1A 3AG1C 5KHGA 2BOCC 2JJ1G 1QHTA 4I0XA 1VIBA 2GSMB 2WLNA 5F2VO 3G6EV 2QE7G 4DRXB 2F4VO 5KUMA 4LF7O 4E2LA 4P2ZA 1U96A 4UV9A 2CTQA 2IJKA 1WB8A 1QR8A 3ZMSA 5KLVH 4RQEA 2XAGA 3U10A 3UO2A 1R3LC 1VQMV 1IX9A 2EIMC 3E86A 1HNZB 1V9PA 4UCRA 3STLC 5IY5B 3CCUV 4LF6O 1BSMA 4TUYB 4H44B 2Q7HA 3UKMA 4ZOLA 2UUCB 4WBNB 1KMIZ 1VF6C 2JEUA 1FS0G 1JCHA 3G80A 2F93B 4K3AA 2MW2B 1N36O 4JGSA 2QWNB 1V55C 5BMVB 3U0ZA 3A0RA 2Q6AA 3RYFB 1AJQA 4UCUA 4KFMA 3CD6V 3SJAC 2UXCB 2VS0A 2JGUA 3K06A 5JJNB 1FYJA 5IY5C 1WP7A 1IXMA 4EKWA 2B1IA 1ZX3A 5CB4B 1AP5A 4X1YA 3E22A 2NLJC 5L3GA 2H8PC 2NN4A 3RYCB 4KL1A 4JYCA 3UM7A 4X89A 5DECA 1L0NH 3RVYA 1I7FA 5IYZB 3OEHG 1N32B 4U3FH 3JASA 2RDCA 3DC6A 2F95B 1THZA 1SQXH 4XDKA 1SF9A 1CP9A 4FLYA 4F6EA 2VQFO 3CWBH 2ZM6B 4GCZA 4LFCB 4FK5C 3OFNG 1K5QA 3W7XA 2PTMA 1OHHG 1GMGA 2GHYA 3KCXA 1VQ8V 2HJFC 1R6KA 4OX9B 1XQ8A 3WB0A 2QJ1A 1N34O 1T5EA 4LR3A 1AJPA 2JS5A 3OUSA 3ZN0A 2IM9A 1PD3A 1EN4A 1FFTB 1Y76A 4DV2O 1P4RA 4LNUA 2VWKA 1SZTA 2EZOA 5BXZA 1TGOA 3WFVA 2RNBA 3CCRV 1KYOF 4WFAV 3T1HO 1Q90D 5D5QA 3B8NA 3TK1A 5K1PA 4AQYB 4YY3O 4BIZA 2JVDA 5LA6B 2Z0AA 5KAIZ 5LYJB 1ORQC 1DGSA 1DLBA 3JARB 3J80N 2EBOA 1Y74B 4UXNA 5EZYA 4TV8A 4FLUA 1OCRC 4DK0A 3FAVA 3S3WA 2UXBB 1JR9A 5LL6Y 4DR7B 2YEVB 2UUBO 3UT5A 5FNVA 4WFGA 2QA4V 1NTKH 2E75B 1YITV 1H5WA 3K5OA 2JEXA 5GONA 3AG2C 1LR1A 1HP8A 1J5EO 2KSDA 3LDEA 5B1AB 1TUBB 3DC5A 3HKBA 2Q0OC 3ETQA 5KHJA 4FZ1A 5CA3A 2JK5C 4O4LA 3ML0A 5CA0A 4DV5B 1F7YA 1WNSA 4DV6B 4YXWG 2NR5A 3LSSA 4FLVA 4NXMO 1COWG 3CB2A 3FD9A 4I7ZB 4BIUA 4Q6GA 2Y4TA 3K0GA 1WPBA 3CMEV 5JVDA 1Q6HA 2XHBA 2EJRA 2AZ0A 3OM3B 3OT7A 1L1FA 1VQLV 4D7TA 1IBMB 1S77D 2XAJA 1MMMA 2OIEA 3SPGA 4MTOA 1P49A 2EX3A 4PDVA 5B1AC 3STZC 1EFRG 3FB7C 2B1GA 2W0XA 2P90A 3L70H 1TVKB 1GTOA 2QM7A 1ZL8B 3BEHA 5IDJA 4O4JB 4MTXA 4EEQA 2DYSC 1XNQB 2ZINA 1EM1A 2Q0AA 2RN9A 3F7YC 4B3TO 2CE4A 4DO2A 5LXTB 3E83A 4X9QA 4HYOA 4FM1A 2IBZH 4PDMA 1PNMA 4GKKO 3FKSG 4DUYB 1NU1H 1WP8A 1CPYA 4UCTA 4U3JA 1XMQB 1Q7YW 4P30A 4JYAB 3C3TA 3ZCCA 2XASA 4KXRA 1NVPB 4LBEC 3ZRXA 2WA3A 2GBOA 2Z5UA 4B7KA 5B1BB 3B8MA 4HNAB 1ROPA 4ZHQB 3O9OA 2HHHO 1Q3EA 1QBZA 3H1LH 1X59A 2L6LA 3TJTA 3OEEG 2F4VB 4YJ2A 4LF7B 4IHJB 4NR1A 1L0LH 1YZBA 2ZDIA 2QTOA 3GB7C 5B5EZ 1H38A 1CEZA 3HKEB 1VQPV 3D3QA 5LP6C 3ZMUA 2DYRB 2R72A 5LHGA 4X62O 1YJNV 4LP8A 5B1BC 2DWDC 4LF6B 1OCCB 2R9IA 4LFBO 3T1CA 4LF8O 2D3OW 3FYEB 2XUMA 5EIBC 1NVPD 2XT9A 4B3RO 2WSSG 4O2BB 1PNKA 2UUCO 1NR1A 1H8HG 4LCUC 3IC9A 1QNMA 4J11A 3H1KH 3FFQA 2Y0IA 1RFYA 1JPXA 2RJZA 3JYCA 4IYIA 3CCMV 5EIBD 1RP3B 1YCIA 3BVOA 2GUZA 4WF9V 2ZD9A 2UXXA 3ZHVA 2PYJA 4J7KA 3SJBC 3MDSA 2A0LA 1GN3A 2UXCO 1SKVA 1NT2B 3ZMVA 4JI4O 1Z2GA 4X66O 1LUVA 4DW0A 4A5UB 2QDOA 3HKCA 4ZKIA 5JCOC 5CBGA 4P9PA 1XHXA 3TCUA 2VQFB 5CA1A 3NR7A 3BFRA 1I08A 4K0KO 4GX5A 4FLWA 2A7WA 5KHKA 5GTIZ 3JD3A 2C2AA 3K5LA 3ZMZA 1YDXA 4CH4A 4JI2O 2YDEA 2LGQA 1V54B 1R3KC 4DV0O 4G2KA 2ZCEA 3BA8A 4DV2B 2GDSA 1S5LZ 3SYQA 1HWYA 4GLXA 2EILB 4BR6A 3AG7A 3H9VA 4DR1O 3ETEA 5B1OA 3L72H 4TWKA 4YY3B 2ZNJA 4FFKA 4DR2O 1BQZA 4TQFA 1YSCA 4AQYO 4YJ3B 4FJCC 2O57A 3PN1A 4LWSA 3JCUZ 4JAUA 3JATA 1TA8A 1GO3F 2YXLA 5KHHA 4FM2A 2GV9A 1V54C 1JFFA 2X6BA 4Z1VA 5KX5B 1F23A 1Q43A 3SYAA 3HR0A 4FMTA 5C93A 4JYBA 5DEDA 5IE9A 5LP6A 2P67A 2EILC 2UXBO 2WLIA 1W2BU 3ETGA 4FLZA 4QJFB 5J9PC 2BSKA 1GN4A 2HKOA 2B9ZA 1H2GA 1JNBA 1J5EB 1N0JA 4N21A 1MSWD 5C8YA 4LFAB 5L3FA 4JTCB 1MA1A 2DJVA 3S3XA 4I4TA 4G28B 5LOVB 5IWAO 4JI5O 1URFA 3CJHA 1GM8A 4DV7O 1HNWB 1I94O 4LF4O 3RVZA 3LUTB 4NXMB 3ABMB 1RSOB 1JMKC 4TT3G 4U7NA 1K97A 2CK3G 1DF5A 1E1RG 1NKDA 2HP8A 2DE0X 3CMAV 2PI5A 4N23A 1LUWA 1Q6UA 1SQFA 5JH7A 2A06H 2ETNA 1Q81W 4YHHB 4J41A 2X6AA 1M9NA 3JASB 3IC7A 1E79G 1FD9A 1XMOO 4HAMA 1Y4MA 3EFFK 3ZHRA 4X20B 5H6QA 2OWOA 3ABMC 1BE3H 4PA3A 1R3JC 3WG7B 1QVGU 4ICGA 3M99B 1WAZA 3CCSV 2YIBD 3A0BZ 1SRYA 2DN9A 2IJJA 1WB7A 1IZ3A 3AK3A 2ZXWB 5H9CA 1L8DA 3ABLB 5ITZB 4B3TB 1XDCA 1R3IC 4PELA 3RBZA 1NTMH 1GN2A 1Y67A 2BTQA 4GKKB 4LNUB 1FFXA 4UVCA 3C3SA 4X1KA 1J95A 2HVKC 4JTDB 2YUAA 1VQ5V 3OMAB 4P9OA 4O4HA 1PV0A 1PP9H 5H6RA 5E1AC 3PJSK 2OTJV 4C7UA 2W6IG 3F5WC 2WLHA 2HHHB 1VQ6V 3ABLC 1H2SB 1XNRO 2XAQA 2E74B 4QE9A 3VQVA 3G4SV 3CSXA 2JGDB 1S5HC 3ZRSA 3JD1A 3JAKB 2ZE8A 5FNVB 1GH6A 1XILA 2QKAA 4X62B 2CTWA 3DSQA 5KMGB 3KKYA 4NXNO 5KA6A 3SYCA 4LFBB 2QWQB 4X1IA 1F51A 3I56V 4LF8B 4B3SO 4QGPA 4DV4O 3ZRVA 4I55B 4FFBB 4OGQB 4O4LB 4B3RB 1W0KG 2B5UA 2F66C 4LF5O 4CH3A 4BAYA 3LDCA 2H3OA 3RT3C 2XAHA 1SC5B 1VMGA 1QU7A 3W7TA 2HVJC 1G6UA 2KB1A 2AHYA 3ZMTA 4JI4B 3K57A 4X66B 1D5AA 1O9GA 3CCJV 4JASA 3ZS8C 1KBHA 4IGGA 5EK0A 1EN6A 2LFRA 3RGBA 4UB8Z 2JS3A 1P7BA 1R6TA 2YIDA 4MVRA 1BS3A 3DXRA 4RUEA 2P06A 4JI3O 3ETDA 3AK2A 5J2TA 5EBMC 3L75H 2JRIA 1AI4A 1YXBA 1K7DA 1PNLA 4K0KB 5IJ0B 3E2EA 3JD2A 4X65B 1FOUA 2EIJB 3JD0A 5FPOA 3CC7V 4PD4F 4RO2A 4UCSA 5B1NA 4MVMA 3EXAA 4O2AB 3AK1A 4I50B 4JI2B 3E8BA 1E1QG 2XNDG 4ZI7B 1WPXA 4IT5A 3JCZA 4DV0B 4J42A 4KP4A 1I0HA 5EYPA 4ABMA 3ZRWA 4EFBA 5EC2C 1D2DA 3P30A 1VF7A 2LGWA 1PL4A 1S5JA 3KDRA 4DR1B 4OPHA 5DM6V 2EIJC 4MVQA 3SPJA 4DR2B 3UO3A 2ZNIA 2QGNA 1Z5WA 3RYIB 1N8RW 2PY5A 1XI1A 4EB6A 2WA4A 4TV9A 5LMNO 3IFXA 2W0FC 3N2KA 2K1EA 2GTSA 3BPZA 1I5YA 3OAAG 3CXCU 3E35A 1H2MA 3M7MX 1VQKV 1JX9A 3IAYA 3E8HA 2EZPA 1EN5A 1OV9A 5LHIA 3WB1A 4DR4O 5LGNA 4QE7A 5D5PA 1RM1B 4R6ZA 3FB8C 5IWAB 4JI5B 1B04A 4DRXA 1VF6A 4DV7B 4LFAO 1I94B 4NKGB 4Z1MG 4LF4B 1BHAA 2R9RB 1EBOA 1IXBA 1HNWO 3W7UA 1JJOA 5L3BA 3D36C 4MVUA 1I5XA 4FPPA 3DGEA 3OW2U 3BAAA 2W6JG 2BE3A 2QSAA 2FKXA 3CRRA 1H2KA 4JI1O 3NXSA 4AILC 4DR6O 4TUYA 4KUMA 1US6A 4PV1B 1RM1C 5B66Z 1K9MW 1AI5A 2XOKG 4WBNA 3WB2A 4JV5O 3K59A 1XMOB 4YHHO 1M56B 1UPGA 2P22C 4W4KA 1XL4A 4UCVA 2AZ2A 1G8MA 4IL6Z 5BMVA 3H01A 3DTUB 2KQXA 3K04A 1MABG 4L8JA 2HFEC 4PDLA 4JI8O 4NYKA 1OCOB 1XEQA 3RYHB 3OMNB 4FLXA 4O4IA 3N2GB 2WWWA 3APQA 4DUZB 4PJ0Z 1CXZB 3L74H 3F7VC 1SA0B 2RCVA 1HDJA 4PA7A 5J2UB 3F5TA 1YJ9V 2P6JA 4ASUG 2FL4A 2Q67A 1M56C 3RYCA 3P3PA 4LH6A 3CCVV 1WA8B 1AJNA 1AP6A 3OR6C 3JAWB 5CN0A 2JJ2G 5EC1C 5IYZA 4JYYA 1YI2V 3SYPA 2EULA 4FZ0A 1SERA 2P4KA 3MHSC 1OCOC 4TQDA 2Y4UA 3ZEDA 4JI7O 1KP3A 5EBWC 4J80A 2X0LA 2N05A 1IVSA 4FVMA 4LC1A 2RQ6A 1H2NA 4CBCA 1FKAO 1XNRB 3K03A 1M4UA 1FXHA 2ZIOA 4WFHA 1KB9F 1XHZA 4GKJB 5BR8O 4QNHB 5JQGB 1KU9A 2WLIB 2Q7GA 3FB5C 1FAFA 1JQ0A 2YXHA 3SJCC 2BOBC 1VQ9V 1B06A 2CH7B 3O65A 4NXNB 3W7SA 3A8TA 4BWAA 3OTFA 2JDIG 4B3SB 4DV4B 2LJ2A 2OIGA 2BTOA 2YICA 4J9YB 5LA6A 4TSFG 4LF5B 5LYJA 5BY1A 3KCYA 4UUJC 3JARA 5IJ9B 4NTYA 4F4LA 2LFSA 2MK3A 1Y74A 1FXKB 3FB6C 3RW0A 3T4ZA 5FL7G 4J9ZB 2Q69A 3HKDB 1MOFA 1HW7A 2YEVA 2DYRC 1UFIA 2IJIA 2OYQA 5JH7B 4HBNA 1AI7A 4MS2A 1Q86W 4MTFA 5LGTA 1BGYH 1UJWB 1OCCC 2OCCB 3BABA 4RQFA 4NVPA 2HJDA 3H1HH 3EHBB 1TUBA 2Q9LA 3QTCA 4H33A 4QPJA 4JI3B 5CBHA 1FXKC 1KD1W 2GTAA 2X7RB 1ENVA 2DMXA 1G1XB 2E3CA 4MTGA 2Q73A 1NBMG 3G67A 5GTHZ 5A9GA 4X65O 3RFRA 1QCEA 2OCCC 4CS2A 1VF5B 3UQ8A 3LNNA 4FIPC 2L35A 3TGUH 4X1KB 1IBKO 1AVMA 4HZ3A 1VP7A 4YIPA 2D2CB 1TVKA 3G71V 3CCLV 5H5NA 3EVKA 1ZL8A 1M1KW 3HB3B 3QNEA 5H2FZ 1KQSU 1NZ6A 4GX0A 4O4JA 4I0XB 2YI8A 1Q8IA 2K9PA 3VBBA 3HPLC 3MD0A 1K34A 3APOA 3J7AU 5LMNB 5GW7A 2ZT9B 2UU9O 4DR3O 5KUKA 3N27A 1K5SA 2F43G 3ZIAG 3K5NA 4X1IB 1K73W 3BCCH 1YF2A 1N33O 2OTLV 4DR4B 4J10A 4GYCB 4ZOLB 3P32A 2M7WA 4XDLA 3CS5A 4HNAA 3LSQA 5IYDO 3LNMB 1KECA 2IU3A 4ZHQA 2E5LO 1RPRA 2NNUA 1JJ2U 4XBFA 4UV8A 1HR0O 4DV1O 4F6RA 1Y66A 2ZE7A 4IHJA 5IYBO 2YSUB 2AXTZ 4CC5A 1S0VA 5E79Z 1H8EG 3HKEA 4JPRA 2UUAO 2LW1A 4X64O 2WLMA 2QWOB 1K8AW 3IJ4A 3CRQA 3AG4B 4X8AA 4L87A 4JI1B 4DR6B 4X1YB 2V7QG 1OJHA 3E22B 5DN6G 3ABKB 1AR5A 4OXSA 1KUQA 4CH5A 4JV5B 1F4NA 5JCOA 4O2BA 1BQ0A 3BRCA 4H13B 2ZE6A 5HFLA 3H1IH 2HEPA 2YIAA 2EIKB 1SETA 2CAZC 2EJ7A 4GT1A 4GX1A 1VQ7V 1NH2B 4FM0A 4JI8B 3SR2C 4XDJA 3VQYA 3AG4C 1VQNV 1ZSPA 3QVNA 1QQCA 4IIJA 1KKCA 1DF4A 5EYPB 4DUZO 1VQ4V 1U97A 2QKCA 1SQBH 1XL6A 3CRCA 1NTZH 1SZXA 3BA9A 1Y76B 1M5IA 3QO8A 2V1DA 1S3JA 3BY6A 4BW5A 2PGGA 3OMIB 4B08A 2WLLA 3AG1B 2PZSA 3WG7C 4JI7B 3R65A 3ASNB 2LO1A 2ZIMA 2KG7A 1DK1A 4W4LA 3MHHC 2CTRA 1DTOA 1D5NA 2ITDC 2ZXWC 1NH2D 5EZYB 3Q4HA 3OTOO 2VQEO 4TV8B 2UXDO 4U7OA 3FAVB 5BR8B 4JI6B 3SPCA 3OUFA 4GKJO 4Z2WA 4B3MO 3CPWU 2FMLA 2Y48A 1G4YB 1GRJA 3UT5B 3ZHUA 1JVMA 5GONB 3CYOA 2R9AA 5IYCO 4NTXA 2A9HA 4RWUA 3ASNC 2N74A 1PPJH 3ZBHA 5FPRA 2Q68A 1SS3A 4J7JA 3HKBB 3JALA 3OE7G 3E8GA 2PYLA 4YJ3A 2HR3A 1QVFU 4CS3A 1V55B 5CA0B 3ICXA 4UFZA 1PKXA 5KX5A 1A32A 2ARHA 5JVDB 3IGAC 3J81N 3A2FA 3G6BA 5TISZ 3SDLA 3H1JH 4QPKA 1IJGA 4PA9A 3JD4A 5LOVA 1K33A 2YIBA 3GVMA 1AILA 3ZHQA 4O4IB 1RSOA 4MW8A 5L3DA 4MW3A 5KHIA 2FB5A 1R1BA 2IH3C 2CDYA 2EINB 4MSWC 5LMUO 3ZN1A 3I5DA 4MT8A 4H0LB 1R73A 1M90W 2CUGA 2ITCC 1AR4A 3CCEV 3W7WA 4JZ2A 1IBKB 3K08A 1GN6A 2F23A 1SESA 3B2EE 4U3JB 4UCOA 3CRMA 1VARA 4AI8A 1BHBA 2E76B 4X20A 4BW9A 1S72V 3T1YO 2OT5A 5K1XA 1IBLB 1EZJA 4JAAA 4DYLA 4KHPO 3OGCC 2QEXV 4JF3A 2EINC 4YJ2B 1BT8A 5ITZA 3QO5A 2Q4PA 4LF9O 4GZRB 1OCRB 3VQXA 3GWOA 4K8ZA 3SGIA 2UU9B 5JWPA 4DR3B 4PHZA 2H94A 1NR7A 5KA5A 4CZZA 1GKFA 1XOUA 4DW1A 1QLEB 4I9QA 1FJGO 1N33B 1SQQH 2BCCH 1YEWA 3AG2B 4PDRA 2AW9A 2M6YA 2Q8VA 3U11A 4DR5O 3A0HZ 3MAQA 2ADQB 4ZBMA 1B3QA 2E5LB 4X88A 2HLDG 3VOUA 2LQTA 1HR0B 4DV1B 1HNXO 2ZDIC 2ZKOA 1JOYA 2JGDA 1BL8A 5EBLC 2A3QA 5BZBA 3JAKA 5B3SB 3ABUA 2GUZB 4I9WA 1QLEC 1JA8A 4ZIBA 2UUAB 4EFEA 4X64B 3B4SA 1NQTA 1Q6IA 3T4DA 1SQVH 5KMGA 1K92A 1MNGA 3X2QB 5CMUA 2FTKA 3HKCB 2P7TC 2AGAA 1SQPH 4I55A 4FFBA 1QR9A 4J7ZA 4JI0B 4JZGA 3JSNA 3ASOB 3ZHSA 5CBFA 5A2QN 4DXWA 5B3SC 5CA1B 4CS4A 1K3EA 5L3EA 3D8CA 3K3WA 4UVBA 2DYSB 2ATKC 3RYFA 3CC2V 1YIJV 3X2QC 2QTSA 2Y69B 1BCCH 2P5OA 1FPOA 1B6QA 5CB4A 3THOA 1R6NA 5JJJB 3ASOC 3CP1A 2YI9A 4D7SA 4PA4A 2IW5A 4WFBV 1W0JG 3VQWA 1VEWA 1LNQA 4IYHA 5IJ0A 1QLNA 4WCEV 1KKDA 2LW7A 3P3NA 2CGOA 4LWSB 2Y69C 3JATB 3SPHA 1YVWA 4K8XA 3OD4A 1JFFB 3OTOB 2VQEB 4O2AA 2HG5C 4I50A 2UXDB 4PA6A 1FXVA 1P7GA 1TAEA 4ZI7A 4RUFA 2IU0A 2ODMA 3OR7C 1TUEB 1ZAUA 1WN7A 1XREA 2ADPA 3ZJZA 4B3MB 5LP6B 3UCSC 4DV3O 1Q5OA 4JI6O 3B77A 2BSKB 3AEIA 2QKSA 1SQGA 5C8YB 4F6RB 3ABTA 2OCHA 1W59A 2QR4A 1PM9A 4I4TB 4DK1A 5L3CA 3B40A 3CJHB 3RYIA 3K9AA 2DWEC 1BZKA 2PI4A 1YTFB 4H37A 5AG2A 2AHZA 3CCQV 3SYOA 1GM7A 2X6CA 3K9SA 3D36A 1HNZO 1NJIW 1KP2A 2R70A 1NI8A 3TXQA 2WAMA 3QF7A 3I55V 3K0DA 4R50A 1N36B 2CTPA 3FX7A 1VQOV 3CRAA 4UVAA 2Z3YA 3M8AA 1NS1A 3B09A 3D3IA 4IIJB 4UB6Z 3AG3B 1S76D 3CXHF 1M93A 4WFEA 1M57B 1PL0A 3JSLA 4CC6A 1YTFD 1OZ0A 4RAIA 3BHPA 1WLEA 2WLJA 5LMUB 2WLKA 3CC4V 1N0NA 1KC8W 2BTQB 5LBQA 1WJZA 1FFXB 3CEIA 3RWRD 2YXYA 1N32O 4GX2A 2WLLB 1RPOA 3SPIA 1YHQV 3FYIB 3LDDA 3K5MA 2QM8A 3T1YB 5JJEB 3AG3C 4O4HB 2KG7B 3L9DA 1M57C 1MSDA 1XBLA 4R7CA 4KHPB 2LP7A 2ZM6O 4LFCO 2UXNA 3RYHA 1IBLO 4E4EA 4OPAA 1GAXA 3Q4HB 4AHCA 1MZEA 3N2GA 4Q20A 4G27B 4JAVA 3T2MA 3WU2Z 3C90A 2P4VA 2Y0PA 1N34B 1SA0A 2F1MA 4LF9B 4OX9O 2A79B 4FLTA 5J2UA 1AI6A 1IDSA 1IURA 5LXTA 1OCZB 1GM9A 1ZLZA 3JAMN 3K79A 1WA8A 3JAWA 2VWJA 3T1HB 2ZE5A 1FJGB 3SJQC 3QG5A 2Q5ZA 3E89A 1P84F 3CHXA 2FYUH 3CX5F 3JALB 4DR5B 2ZR3A 4JTAB 4WFFA 3E8FA 2QM4A 2PF4E 4B7EA 1GK9A 1N4CA 1HNXB 4MVZA 1ZWIC 3ZHTA 4BIOA 2G38A 4NTWA 4LH7A 2WPDG 1OCZC 2VRZA 3LSUA 3CE2A 5JQGA 2UUBB 1AB3A 4DR7O 4MVSA 2CH7A 1MZFA 2XTAA 1XUQA
chains in the Genus database with same CATH topology
2AW9A 3EVKA 4YIOA 3IC9A 1B06A 1QNMA 3C3SA 1ZSPA 3QVNA 1N0NA 2ADQB 1KKCA 1WB8A 1EN4A 1P7GA 3CEIA 2QKCA 3MDSA 4GUNA 1GN3A 1IX9A 1GN4A 4C7UA 1XREA 2ADPA 1SZXA 3AK1A 1N0JA 1LUVA 1JA8A 1EM1A 1MSDA 1BSMA 3RN4A 1I0HA 1MA1A 2CE4A 4X9QA 4E4EA 1ZTEA 1MNGA 1PL4A 1PM9A 3KDRA 2CDYA 1ZUQA 1XILA 2QKAA 1D5NA 3BFRA 1I08A 3C3TA 1JR9A 3KKYA 1IDSA 1AR4A 1ZLZA 4JZ2A 4JZGA 1GN6A 2RCVA 5AG2A 1LUWA 1VARA 3K9SA 3TJTA 1AP6A 1AP5A 3DC5A 4JYYA 1EN5A 2P4KA 2GDSA 1BT8A 3DC6A 4BR6A 5A9GA 1AR5A 3LSUA 4F6EA 1WB7A 3AK3A 3OT7A 4FFKA 1EN6A 1AVMA 1XDCA 4YIPA 1MMMA 1BS3A 1VEWA 1GN2A 1Y67A 1XUQA 3AK2A 1IXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AW9 A;  3EVK A;  4YIO A;  3IC9 A;  1B06 A;  1QNM A;  3C3S A;  1ZSP A;  3QVN A;  1N0N A;  2ADQ B;  1KKC A;  1WB8 A;  1EN4 A;  1P7G A;  3CEI A;  2QKC A;  3MDS A;  4GUN A;  1GN3 A;  1IX9 A;  1GN4 A;  4C7U A;  1XRE A;  2ADP A;  1SZX A;  3AK1 A;  1N0J A;  1LUV A;  1JA8 A;  1EM1 A;  1MSD A;  1BSM A;  3RN4 A;  1I0H A;  1MA1 A;  2CE4 A;  4X9Q A;  4E4E A;  1ZTE A;  1MNG A;  1PL4 A;  1PM9 A;  2CDY A;  1ZUQ A;  1XIL A;  2QKA A;  1D5N A;  3BFR A;  1I08 A;  3C3T A;  1JR9 A;  3KKY A;  1IDS A;  1AR4 A;  1ZLZ A;  4JZ2 A;  4JZG A;  1GN6 A;  2RCV A;  5AG2 A;  1LUW A;  1VAR A;  3K9S A;  3TJT A;  1AP6 A;  1AP5 A;  3DC5 A;  4JYY A;  1EN5 A;  2P4K A;  2GDS A;  1BT8 A;  3DC6 A;  4BR6 A;  5A9G A;  1AR5 A;  3LSU A;  4F6E A;  1WB7 A;  3AK3 A;  3OT7 A;  4FFK A;  1EN6 A;  1AVM A;  1XDC A;  4YIP A;  1MMM A;  1BS3 A;  1VEW A;  1GN2 A;  1Y67 A;  1XUQ A;  3AK2 A;  1IXB A; 
#chains in the Genus database with same CATH topology
 1F4M A;  4YIO A;  5IT9 N;  1Z5V A;  2DW4 A;  2IH1 C;  4MVO A;  3DXR B;  1ARO P;  2DQ0 A;  5J2T B;  2KKW A;  2Q7E A;  5IJ9 A;  4JI0 O;  3K58 A;  4GUN A;  4DV5 O;  2DOS A;  1FXK A;  4TOI A;  3ZX6 A;  2PUS A;  3KG2 A;  4DV6 O;  4CH6 A;  3TXS A;  2YS8 A;  1X4T A;  3HKD A;  2QWP B;  3R66 A;  1Q82 W;  4NB5 A;  1Y6X A;  3RN4 A;  3OGI B;  1IBM O;  2QWR B;  4PI2 A;  1H2L A;  1ZTE A;  2ZR2 A;  3ABK C;  4I5S A;  5HFM A;  1YJW V;  3ZRW B;  1ZUQ A;  2XAF A;  1AR1 B;  4PI0 A;  1O9H A;  5KAF Z;  1BMF G;  5LGU A;  2EIK C;  3GWK C;  2N04 A;  1EZV H;  5LHH A;  1XNQ O;  4EB6 B;  2ZQM A;  4QIW F;  4TV9 B;  3L73 H;  3N2K B;  2YC0 A;  3KZI Z;  3QO7 A;  4DUY O;  2ILM A;  3L71 H;  2JIZ G;  4R8C A;  4DV3 B;  2V4D A;  3TET A;  1XMQ O;  5FLX N;  1K4D C;  4JYA O;  2CGN A;  2EIM B;  2DQ3 A;  4K35 A;  4D6T H;  1K4C C;  2RMK B;  2IJH A;  1MG1 A;  3AG1 C;  5KHG A;  2BOC C;  2JJ1 G;  1QHT A;  4I0X A;  1VIB A;  2GSM B;  2WLN A;  5F2V O;  3G6E V;  2QE7 G;  4DRX B;  2F4V O;  5KUM A;  4LF7 O;  4E2L A;  4P2Z A;  1U96 A;  4UV9 A;  2CTQ A;  2IJK A;  1WB8 A;  1QR8 A;  3ZMS A;  5KLV H;  4RQE A;  2XAG A;  3U10 A;  3UO2 A;  1R3L C;  1VQM V;  1IX9 A;  2EIM C;  3E86 A;  1HNZ B;  1V9P A;  4UCR A;  3STL C;  5IY5 B;  3CCU V;  4LF6 O;  1BSM A;  4TUY B;  4H44 B;  2Q7H A;  3UKM A;  4ZOL A;  2UUC B;  4WBN B;  1KMI Z;  1VF6 C;  2JEU A;  1FS0 G;  1JCH A;  3G80 A;  2F93 B;  4K3A A;  2MW2 B;  1N36 O;  4JGS A;  2QWN B;  1V55 C;  5BMV B;  3U0Z A;  3A0R A;  2Q6A A;  3RYF B;  1AJQ A;  4UCU A;  4KFM A;  3CD6 V;  3SJA C;  2UXC B;  2VS0 A;  2JGU A;  3K06 A;  5JJN B;  1FYJ A;  5IY5 C;  1WP7 A;  1IXM A;  4EKW A;  2B1I A;  1ZX3 A;  5CB4 B;  1AP5 A;  4X1Y A;  3E22 A;  2NLJ C;  5L3G A;  2H8P C;  2NN4 A;  3RYC B;  4KL1 A;  4JYC A;  3UM7 A;  4X89 A;  5DEC A;  1L0N H;  3RVY A;  1I7F A;  5IYZ B;  3OEH G;  1N32 B;  4U3F H;  3JAS A;  2RDC A;  3DC6 A;  2F95 B;  1THZ A;  1SQX H;  4XDK A;  1SF9 A;  1CP9 A;  4FLY A;  4F6E A;  2VQF O;  3CWB H;  2ZM6 B;  4GCZ A;  4LFC B;  4FK5 C;  3OFN G;  1K5Q A;  3W7X A;  2PTM A;  1OHH G;  1GMG A;  2GHY A;  3KCX A;  1VQ8 V;  2HJF C;  1R6K A;  4OX9 B;  1XQ8 A;  3WB0 A;  2QJ1 A;  1N34 O;  1T5E A;  4LR3 A;  1AJP A;  2JS5 A;  3OUS A;  3ZN0 A;  2IM9 A;  1PD3 A;  1EN4 A;  1FFT B;  1Y76 A;  4DV2 O;  1P4R A;  4LNU A;  2VWK A;  1SZT A;  2EZO A;  5BXZ A;  1TGO A;  3WFV A;  2RNB A;  3CCR V;  1KYO F;  4WFA V;  3T1H O;  1Q90 D;  5D5Q A;  3B8N A;  3TK1 A;  5K1P A;  4AQY B;  4YY3 O;  4BIZ A;  2JVD A;  5LA6 B;  2Z0A A;  5KAI Z;  5LYJ B;  1ORQ C;  1DGS A;  1DLB A;  3JAR B;  3J80 N;  2EBO A;  1Y74 B;  4UXN A;  5EZY A;  4TV8 A;  4FLU A;  1OCR C;  4DK0 A;  3FAV A;  3S3W A;  2UXB B;  1JR9 A;  5LL6 Y;  4DR7 B;  2YEV B;  2UUB O;  3UT5 A;  5FNV A;  4WFG A;  2QA4 V;  1NTK H;  2E75 B;  1YIT V;  1H5W A;  3K5O A;  2JEX A;  5GON A;  3AG2 C;  1LR1 A;  1HP8 A;  1J5E O;  2KSD A;  3LDE A;  5B1A B;  1TUB B;  3DC5 A;  3HKB A;  2Q0O C;  3ETQ A;  5KHJ A;  4FZ1 A;  5CA3 A;  2JK5 C;  4O4L A;  3ML0 A;  5CA0 A;  4DV5 B;  1F7Y A;  1WNS A;  4DV6 B;  4YXW G;  2NR5 A;  3LSS A;  4FLV A;  4NXM O;  1COW G;  3CB2 A;  3FD9 A;  4I7Z B;  4BIU A;  4Q6G A;  2Y4T A;  3K0G A;  1WPB A;  3CME V;  5JVD A;  1Q6H A;  2XHB A;  2EJR A;  2AZ0 A;  3OM3 B;  3OT7 A;  1L1F A;  1VQL V;  4D7T A;  1IBM B;  1S77 D;  2XAJ A;  1MMM A;  2OIE A;  3SPG A;  4MTO A;  1P49 A;  2EX3 A;  4PDV A;  5B1A C;  3STZ C;  1EFR G;  3FB7 C;  2B1G A;  2W0X A;  2P90 A;  3L70 H;  1TVK B;  1GTO A;  2QM7 A;  1ZL8 B;  3BEH A;  5IDJ A;  4O4J B;  4MTX A;  4EEQ A;  2DYS C;  1XNQ B;  2ZIN A;  1EM1 A;  2Q0A A;  2RN9 A;  3F7Y C;  4B3T O;  2CE4 A;  4DO2 A;  5LXT B;  3E83 A;  4X9Q A;  4HYO A;  4FM1 A;  2IBZ H;  4PDM A;  1PNM A;  4GKK O;  3FKS G;  4DUY B;  1NU1 H;  1WP8 A;  1CPY A;  4UCT A;  4U3J A;  1XMQ B;  1Q7Y W;  4P30 A;  4JYA B;  3C3T A;  3ZCC A;  2XAS A;  4KXR A;  1NVP B;  4LBE C;  3ZRX A;  2WA3 A;  2GBO A;  2Z5U A;  4B7K A;  5B1B B;  3B8M A;  4HNA B;  1ROP A;  4ZHQ B;  3O9O A;  2HHH O;  1Q3E A;  1QBZ A;  3H1L H;  1X59 A;  2L6L A;  3TJT A;  3OEE G;  2F4V B;  4YJ2 A;  4LF7 B;  4IHJ B;  4NR1 A;  1L0L H;  1YZB A;  2ZDI A;  2QTO A;  3GB7 C;  5B5E Z;  1H38 A;  1CEZ A;  3HKE B;  1VQP V;  3D3Q A;  5LP6 C;  3ZMU A;  2DYR B;  2R72 A;  5LHG A;  4X62 O;  1YJN V;  4LP8 A;  5B1B C;  2DWD C;  4LF6 B;  1OCC B;  2R9I A;  4LFB O;  3T1C A;  4LF8 O;  2D3O W;  3FYE B;  2XUM A;  5EIB C;  1NVP D;  2XT9 A;  4B3R O;  2WSS G;  4O2B B;  1PNK A;  2UUC O;  1NR1 A;  1H8H G;  4LCU C;  3IC9 A;  1QNM A;  4J11 A;  3H1K H;  3FFQ A;  2Y0I A;  1RFY A;  1JPX A;  2RJZ A;  3JYC A;  4IYI A;  3CCM V;  5EIB D;  1RP3 B;  1YCI A;  3BVO A;  2GUZ A;  4WF9 V;  2ZD9 A;  2UXX A;  3ZHV A;  2PYJ A;  4J7K A;  3SJB C;  3MDS A;  2A0L A;  1GN3 A;  2UXC O;  1SKV A;  1NT2 B;  3ZMV A;  4JI4 O;  1Z2G A;  4X66 O;  1LUV A;  4DW0 A;  4A5U B;  2QDO A;  3HKC A;  4ZKI A;  5JCO C;  5CBG A;  4P9P A;  1XHX A;  3TCU A;  2VQF B;  5CA1 A;  3NR7 A;  3BFR A;  1I08 A;  4K0K O;  4GX5 A;  4FLW A;  2A7W A;  5KHK A;  5GTI Z;  3JD3 A;  2C2A A;  3K5L A;  3ZMZ A;  1YDX A;  4CH4 A;  4JI2 O;  2YDE A;  2LGQ A;  1V54 B;  1R3K C;  4DV0 O;  4G2K A;  2ZCE A;  3BA8 A;  4DV2 B;  2GDS A;  1S5L Z;  3SYQ A;  1HWY A;  4GLX A;  2EIL B;  4BR6 A;  3AG7 A;  3H9V A;  4DR1 O;  3ETE A;  5B1O A;  3L72 H;  4TWK A;  4YY3 B;  2ZNJ A;  4FFK A;  4DR2 O;  1BQZ A;  4TQF A;  1YSC A;  4AQY O;  4YJ3 B;  4FJC C;  2O57 A;  3PN1 A;  4LWS A;  3JCU Z;  4JAU A;  3JAT A;  1TA8 A;  1GO3 F;  2YXL A;  5KHH A;  4FM2 A;  2GV9 A;  1V54 C;  1JFF A;  2X6B A;  4Z1V A;  5KX5 B;  1F23 A;  1Q43 A;  3SYA A;  3HR0 A;  4FMT A;  5C93 A;  4JYB A;  5DED A;  5IE9 A;  5LP6 A;  2P67 A;  2EIL C;  2UXB O;  2WLI A;  1W2B U;  3ETG A;  4FLZ A;  4QJF B;  5J9P C;  2BSK A;  1GN4 A;  2HKO A;  2B9Z A;  1H2G A;  1JNB A;  1J5E B;  1N0J A;  4N21 A;  1MSW D;  5C8Y A;  4LFA B;  5L3F A;  4JTC B;  1MA1 A;  2DJV A;  3S3X A;  4I4T A;  4G28 B;  5LOV B;  5IWA O;  4JI5 O;  1URF A;  3CJH A;  1GM8 A;  4DV7 O;  1HNW B;  1I94 O;  4LF4 O;  3RVZ A;  3LUT B;  4NXM B;  3ABM B;  1RSO B;  1JMK C;  4TT3 G;  4U7N A;  1K97 A;  2CK3 G;  1DF5 A;  1E1R G;  1NKD A;  2HP8 A;  2DE0 X;  3CMA V;  2PI5 A;  4N23 A;  1LUW A;  1Q6U A;  1SQF A;  5JH7 A;  2A06 H;  2ETN A;  1Q81 W;  4YHH B;  4J41 A;  2X6A A;  1M9N A;  3JAS B;  3IC7 A;  1E79 G;  1FD9 A;  1XMO O;  4HAM A;  1Y4M A;  3EFF K;  3ZHR A;  4X20 B;  5H6Q A;  2OWO A;  3ABM C;  1BE3 H;  4PA3 A;  1R3J C;  3WG7 B;  1QVG U;  4ICG A;  3M99 B;  1WAZ A;  3CCS V;  2YIB D;  3A0B Z;  1SRY A;  2DN9 A;  2IJJ A;  1WB7 A;  1IZ3 A;  3AK3 A;  2ZXW B;  5H9C A;  1L8D A;  3ABL B;  5ITZ B;  4B3T B;  1XDC A;  1R3I C;  4PEL A;  3RBZ A;  1NTM H;  1GN2 A;  1Y67 A;  2BTQ A;  4GKK B;  4LNU B;  1FFX A;  4UVC A;  3C3S A;  4X1K A;  1J95 A;  2HVK C;  4JTD B;  2YUA A;  1VQ5 V;  3OMA B;  4P9O A;  4O4H A;  1PV0 A;  1PP9 H;  5H6R A;  5E1A C;  3PJS K;  2OTJ V;  4C7U A;  2W6I G;  3F5W C;  2WLH A;  2HHH B;  1VQ6 V;  3ABL C;  1H2S B;  1XNR O;  2XAQ A;  2E74 B;  4QE9 A;  3VQV A;  3G4S V;  3CSX A;  2JGD B;  1S5H C;  3ZRS A;  3JD1 A;  3JAK B;  2ZE8 A;  5FNV B;  1GH6 A;  1XIL A;  2QKA A;  4X62 B;  2CTW A;  3DSQ A;  5KMG B;  3KKY A;  4NXN O;  5KA6 A;  3SYC A;  4LFB B;  2QWQ B;  4X1I A;  1F51 A;  3I56 V;  4LF8 B;  4B3S O;  4QGP A;  4DV4 O;  3ZRV A;  4I55 B;  4FFB B;  4OGQ B;  4O4L B;  4B3R B;  1W0K G;  2B5U A;  2F66 C;  4LF5 O;  4CH3 A;  4BAY A;  3LDC A;  2H3O A;  3RT3 C;  2XAH A;  1SC5 B;  1VMG A;  1QU7 A;  3W7T A;  2HVJ C;  1G6U A;  2KB1 A;  2AHY A;  3ZMT A;  4JI4 B;  3K57 A;  4X66 B;  1D5A A;  1O9G A;  3CCJ V;  4JAS A;  3ZS8 C;  1KBH A;  4IGG A;  5EK0 A;  1EN6 A;  2LFR A;  3RGB A;  4UB8 Z;  2JS3 A;  1P7B A;  1R6T A;  2YID A;  4MVR A;  1BS3 A;  3DXR A;  4RUE A;  2P06 A;  4JI3 O;  3ETD A;  3AK2 A;  5J2T A;  5EBM C;  3L75 H;  2JRI A;  1AI4 A;  1YXB A;  1K7D A;  1PNL A;  4K0K B;  5IJ0 B;  3E2E A;  3JD2 A;  4X65 B;  1FOU A;  2EIJ B;  3JD0 A;  5FPO A;  3CC7 V;  4PD4 F;  4RO2 A;  4UCS A;  5B1N A;  4MVM A;  3EXA A;  4O2A B;  3AK1 A;  4I50 B;  4JI2 B;  3E8B A;  1E1Q G;  2XND G;  4ZI7 B;  1WPX A;  4IT5 A;  3JCZ A;  4DV0 B;  4J42 A;  4KP4 A;  1I0H A;  5EYP A;  4ABM A;  3ZRW A;  4EFB A;  5EC2 C;  1D2D A;  3P30 A;  1VF7 A;  2LGW A;  1PL4 A;  1S5J A;  3KDR A;  4DR1 B;  4OPH A;  5DM6 V;  2EIJ C;  4MVQ A;  3SPJ A;  4DR2 B;  3UO3 A;  2ZNI A;  2QGN A;  1Z5W A;  3RYI B;  1N8R W;  2PY5 A;  1XI1 A;  4EB6 A;  2WA4 A;  4TV9 A;  5LMN O;  3IFX A;  2W0F C;  3N2K A;  2K1E A;  2GTS A;  3BPZ A;  1I5Y A;  3OAA G;  3CXC U;  3E35 A;  1H2M A;  3M7M X;  1VQK V;  1JX9 A;  3IAY A;  3E8H A;  2EZP A;  1EN5 A;  1OV9 A;  5LHI A;  3WB1 A;  4DR4 O;  5LGN A;  4QE7 A;  5D5P A;  1RM1 B;  4R6Z A;  3FB8 C;  5IWA B;  4JI5 B;  1B04 A;  4DRX A;  1VF6 A;  4DV7 B;  4LFA O;  1I94 B;  4NKG B;  4Z1M G;  4LF4 B;  1BHA A;  2R9R B;  1EBO A;  1IXB A;  1HNW O;  3W7U A;  1JJO A;  5L3B A;  3D36 C;  4MVU A;  1I5X A;  4FPP A;  3DGE A;  3OW2 U;  3BAA A;  2W6J G;  2BE3 A;  2QSA A;  2FKX A;  3CRR A;  1H2K A;  4JI1 O;  3NXS A;  4AIL C;  4DR6 O;  4TUY A;  4KUM A;  1US6 A;  4PV1 B;  1RM1 C;  5B66 Z;  1K9M W;  1AI5 A;  2XOK G;  4WBN A;  3WB2 A;  4JV5 O;  3K59 A;  1XMO B;  4YHH O;  1M56 B;  1UPG A;  2P22 C;  4W4K A;  1XL4 A;  4UCV A;  2AZ2 A;  1G8M A;  4IL6 Z;  5BMV A;  3H01 A;  3DTU B;  2KQX A;  3K04 A;  1MAB G;  4L8J A;  2HFE C;  4PDL A;  4JI8 O;  4NYK A;  1OCO B;  1XEQ A;  3RYH B;  3OMN B;  4FLX A;  4O4I A;  3N2G B;  2WWW A;  3APQ A;  4DUZ B;  4PJ0 Z;  1CXZ B;  3L74 H;  3F7V C;  1SA0 B;  2RCV A;  1HDJ A;  4PA7 A;  5J2U B;  3F5T A;  1YJ9 V;  2P6J A;  4ASU G;  2FL4 A;  2Q67 A;  1M56 C;  3RYC A;  3P3P A;  4LH6 A;  3CCV V;  1WA8 B;  1AJN A;  1AP6 A;  3OR6 C;  3JAW B;  5CN0 A;  2JJ2 G;  5EC1 C;  5IYZ A;  4JYY A;  1YI2 V;  3SYP A;  2EUL A;  4FZ0 A;  1SER A;  2P4K A;  3MHS C;  1OCO C;  4TQD A;  2Y4U A;  3ZED A;  4JI7 O;  1KP3 A;  5EBW C;  4J80 A;  2X0L A;  2N05 A;  1IVS A;  4FVM A;  4LC1 A;  2RQ6 A;  1H2N A;  4CBC A;  1FKA O;  1XNR B;  3K03 A;  1M4U A;  1FXH A;  2ZIO A;  4WFH A;  1KB9 F;  1XHZ A;  4GKJ B;  5BR8 O;  4QNH B;  5JQG B;  1KU9 A;  2WLI B;  2Q7G A;  3FB5 C;  1FAF A;  1JQ0 A;  2YXH A;  3SJC C;  2BOB C;  1VQ9 V;  1B06 A;  2CH7 B;  3O65 A;  4NXN B;  3W7S A;  3A8T A;  4BWA A;  3OTF A;  2JDI G;  4B3S B;  4DV4 B;  2LJ2 A;  2OIG A;  2BTO A;  2YIC A;  4J9Y B;  5LA6 A;  4TSF G;  4LF5 B;  5LYJ A;  5BY1 A;  3KCY A;  4UUJ C;  3JAR A;  5IJ9 B;  4NTY A;  4F4L A;  2LFS A;  2MK3 A;  1Y74 A;  1FXK B;  3FB6 C;  3RW0 A;  3T4Z A;  5FL7 G;  4J9Z B;  2Q69 A;  3HKD B;  1MOF A;  1HW7 A;  2YEV A;  2DYR C;  1UFI A;  2IJI A;  2OYQ A;  5JH7 B;  4HBN A;  1AI7 A;  4MS2 A;  1Q86 W;  4MTF A;  5LGT A;  1BGY H;  1UJW B;  1OCC C;  2OCC B;  3BAB A;  4RQF A;  4NVP A;  2HJD A;  3H1H H;  3EHB B;  1TUB A;  2Q9L A;  3QTC A;  4H33 A;  4QPJ A;  4JI3 B;  5CBH A;  1FXK C;  1KD1 W;  2GTA A;  2X7R B;  1ENV A;  2DMX A;  1G1X B;  2E3C A;  4MTG A;  2Q73 A;  1NBM G;  3G67 A;  5GTH Z;  5A9G A;  4X65 O;  3RFR A;  1QCE A;  2OCC C;  4CS2 A;  1VF5 B;  3UQ8 A;  3LNN A;  4FIP C;  2L35 A;  3TGU H;  4X1K B;  1IBK O;  1AVM A;  4HZ3 A;  1VP7 A;  4YIP A;  2D2C B;  1TVK A;  3G71 V;  3CCL V;  5H5N A;  3EVK A;  1ZL8 A;  1M1K W;  3HB3 B;  3QNE A;  5H2F Z;  1KQS U;  1NZ6 A;  4GX0 A;  4O4J A;  4I0X B;  2YI8 A;  1Q8I A;  2K9P A;  3VBB A;  3HPL C;  3MD0 A;  1K34 A;  3APO A;  3J7A U;  5LMN B;  5GW7 A;  2ZT9 B;  2UU9 O;  4DR3 O;  5KUK A;  3N27 A;  1K5S A;  2F43 G;  3ZIA G;  3K5N A;  4X1I B;  1K73 W;  3BCC H;  1YF2 A;  1N33 O;  2OTL V;  4DR4 B;  4J10 A;  4GYC B;  4ZOL B;  3P32 A;  2M7W A;  4XDL A;  3CS5 A;  4HNA A;  3LSQ A;  5IYD O;  3LNM B;  1KEC A;  2IU3 A;  4ZHQ A;  2E5L O;  1RPR A;  2NNU A;  1JJ2 U;  4XBF A;  4UV8 A;  1HR0 O;  4DV1 O;  4F6R A;  1Y66 A;  2ZE7 A;  4IHJ A;  5IYB O;  2YSU B;  2AXT Z;  4CC5 A;  1S0V A;  5E79 Z;  1H8E G;  3HKE A;  4JPR A;  2UUA O;  2LW1 A;  4X64 O;  2WLM A;  2QWO B;  1K8A W;  3IJ4 A;  3CRQ A;  3AG4 B;  4X8A A;  4L87 A;  4JI1 B;  4DR6 B;  4X1Y B;  2V7Q G;  1OJH A;  3E22 B;  5DN6 G;  3ABK B;  1AR5 A;  4OXS A;  1KUQ A;  4CH5 A;  4JV5 B;  1F4N A;  5JCO A;  4O2B A;  1BQ0 A;  3BRC A;  4H13 B;  2ZE6 A;  5HFL A;  3H1I H;  2HEP A;  2YIA A;  2EIK B;  1SET A;  2CAZ C;  2EJ7 A;  4GT1 A;  4GX1 A;  1VQ7 V;  1NH2 B;  4FM0 A;  4JI8 B;  3SR2 C;  4XDJ A;  3VQY A;  3AG4 C;  1VQN V;  1ZSP A;  3QVN A;  1QQC A;  4IIJ A;  1KKC A;  1DF4 A;  5EYP B;  4DUZ O;  1VQ4 V;  1U97 A;  2QKC A;  1SQB H;  1XL6 A;  3CRC A;  1NTZ H;  1SZX A;  3BA9 A;  1Y76 B;  1M5I A;  3QO8 A;  2V1D A;  1S3J A;  3BY6 A;  4BW5 A;  2PGG A;  3OMI B;  4B08 A;  2WLL A;  3AG1 B;  2PZS A;  3WG7 C;  4JI7 B;  3R65 A;  3ASN B;  2LO1 A;  2ZIM A;  2KG7 A;  1DK1 A;  4W4L A;  3MHH C;  2CTR A;  1DTO A;  1D5N A;  2ITD C;  2ZXW C;  1NH2 D;  5EZY B;  3Q4H A;  3OTO O;  2VQE O;  4TV8 B;  2UXD O;  4U7O A;  3FAV B;  5BR8 B;  4JI6 B;  3SPC A;  3OUF A;  4GKJ O;  4Z2W A;  4B3M O;  3CPW U;  2FML A;  2Y48 A;  1G4Y B;  1GRJ A;  3UT5 B;  3ZHU A;  1JVM A;  5GON B;  3CYO A;  2R9A A;  5IYC O;  4NTX A;  2A9H A;  4RWU A;  3ASN C;  2N74 A;  1PPJ H;  3ZBH A;  5FPR A;  2Q68 A;  1SS3 A;  4J7J A;  3HKB B;  3JAL A;  3OE7 G;  3E8G A;  2PYL A;  4YJ3 A;  2HR3 A;  1QVF U;  4CS3 A;  1V55 B;  5CA0 B;  3ICX A;  4UFZ A;  1PKX A;  5KX5 A;  1A32 A;  2ARH A;  5JVD B;  3IGA C;  3J81 N;  3A2F A;  3G6B A;  5TIS Z;  3SDL A;  3H1J H;  4QPK A;  1IJG A;  4PA9 A;  3JD4 A;  5LOV A;  1K33 A;  2YIB A;  3GVM A;  1AIL A;  3ZHQ A;  4O4I B;  1RSO A;  4MW8 A;  5L3D A;  4MW3 A;  5KHI A;  2FB5 A;  1R1B A;  2IH3 C;  2CDY A;  2EIN B;  4MSW C;  5LMU O;  3ZN1 A;  3I5D A;  4MT8 A;  4H0L B;  1R73 A;  1M90 W;  2CUG A;  2ITC C;  1AR4 A;  3CCE V;  3W7W A;  4JZ2 A;  1IBK B;  3K08 A;  1GN6 A;  2F23 A;  1SES A;  3B2E E;  4U3J B;  4UCO A;  3CRM A;  1VAR A;  4AI8 A;  1BHB A;  2E76 B;  4X20 A;  4BW9 A;  1S72 V;  3T1Y O;  2OT5 A;  5K1X A;  1IBL B;  1EZJ A;  4JAA A;  4DYL A;  4KHP O;  3OGC C;  2QEX V;  4JF3 A;  2EIN C;  4YJ2 B;  1BT8 A;  5ITZ A;  3QO5 A;  2Q4P A;  4LF9 O;  4GZR B;  1OCR B;  3VQX A;  3GWO A;  4K8Z A;  3SGI A;  2UU9 B;  5JWP A;  4DR3 B;  4PHZ A;  2H94 A;  1NR7 A;  5KA5 A;  4CZZ A;  1GKF A;  1XOU A;  4DW1 A;  1QLE B;  4I9Q A;  1FJG O;  1N33 B;  1SQQ H;  2BCC H;  1YEW A;  3AG2 B;  4PDR A;  2AW9 A;  2M6Y A;  2Q8V A;  3U11 A;  4DR5 O;  3A0H Z;  3MAQ A;  2ADQ B;  4ZBM A;  1B3Q A;  2E5L B;  4X88 A;  2HLD G;  3VOU A;  2LQT A;  1HR0 B;  4DV1 B;  1HNX O;  2ZDI C;  2ZKO A;  1JOY A;  2JGD A;  1BL8 A;  5EBL C;  2A3Q A;  5BZB A;  3JAK A;  5B3S B;  3ABU A;  2GUZ B;  4I9W A;  1QLE C;  1JA8 A;  4ZIB A;  2UUA B;  4EFE A;  4X64 B;  3B4S A;  1NQT A;  1Q6I A;  3T4D A;  1SQV H;  5KMG A;  1K92 A;  1MNG A;  3X2Q B;  5CMU A;  2FTK A;  3HKC B;  2P7T C;  2AGA A;  1SQP H;  4I55 A;  4FFB A;  1QR9 A;  4J7Z A;  4JI0 B;  4JZG A;  3JSN A;  3ASO B;  3ZHS A;  5CBF A;  5A2Q N;  4DXW A;  5B3S C;  5CA1 B;  4CS4 A;  1K3E A;  5L3E A;  3D8C A;  3K3W A;  4UVB A;  2DYS B;  2ATK C;  3RYF A;  3CC2 V;  1YIJ V;  3X2Q C;  2QTS A;  2Y69 B;  1BCC H;  2P5O A;  1FPO A;  1B6Q A;  5CB4 A;  3THO A;  1R6N A;  5JJJ B;  3ASO C;  3CP1 A;  2YI9 A;  4D7S A;  4PA4 A;  2IW5 A;  4WFB V;  1W0J G;  3VQW A;  1VEW A;  1LNQ A;  4IYH A;  5IJ0 A;  1QLN A;  4WCE V;  1KKD A;  2LW7 A;  3P3N A;  2CGO A;  4LWS B;  2Y69 C;  3JAT B;  3SPH A;  1YVW A;  4K8X A;  3OD4 A;  1JFF B;  3OTO B;  2VQE B;  4O2A A;  2HG5 C;  4I50 A;  2UXD B;  4PA6 A;  1FXV A;  1P7G A;  1TAE A;  4ZI7 A;  4RUF A;  2IU0 A;  2ODM A;  3OR7 C;  1TUE B;  1ZAU A;  1WN7 A;  1XRE A;  2ADP A;  3ZJZ A;  4B3M B;  5LP6 B;  3UCS C;  4DV3 O;  1Q5O A;  4JI6 O;  3B77 A;  2BSK B;  3AEI A;  2QKS A;  1SQG A;  5C8Y B;  4F6R B;  3ABT A;  2OCH A;  1W59 A;  2QR4 A;  1PM9 A;  4I4T B;  4DK1 A;  5L3C A;  3B40 A;  3CJH B;  3RYI A;  3K9A A;  2DWE C;  1BZK A;  2PI4 A;  1YTF B;  4H37 A;  5AG2 A;  2AHZ A;  3CCQ V;  3SYO A;  1GM7 A;  2X6C A;  3K9S A;  3D36 A;  1HNZ O;  1NJI W;  1KP2 A;  2R70 A;  1NI8 A;  3TXQ A;  2WAM A;  3QF7 A;  3I55 V;  3K0D A;  4R50 A;  1N36 B;  2CTP A;  3FX7 A;  1VQO V;  3CRA A;  4UVA A;  2Z3Y A;  3M8A A;  1NS1 A;  3B09 A;  3D3I A;  4IIJ B;  4UB6 Z;  3AG3 B;  1S76 D;  3CXH F;  1M93 A;  4WFE A;  1M57 B;  1PL0 A;  3JSL A;  4CC6 A;  1YTF D;  1OZ0 A;  4RAI A;  3BHP A;  1WLE A;  2WLJ A;  5LMU B;  2WLK A;  3CC4 V;  1N0N A;  1KC8 W;  2BTQ B;  5LBQ A;  1WJZ A;  1FFX B;  3CEI A;  3RWR D;  2YXY A;  1N32 O;  4GX2 A;  2WLL B;  1RPO A;  3SPI A;  1YHQ V;  3FYI B;  3LDD A;  3K5M A;  2QM8 A;  3T1Y B;  5JJE B;  3AG3 C;  4O4H B;  2KG7 B;  3L9D A;  1M57 C;  1MSD A;  1XBL A;  4R7C A;  4KHP B;  2LP7 A;  2ZM6 O;  4LFC O;  2UXN A;  3RYH A;  1IBL O;  4E4E A;  4OPA A;  1GAX A;  3Q4H B;  4AHC A;  1MZE A;  3N2G A;  4Q20 A;  4G27 B;  4JAV A;  3T2M A;  3WU2 Z;  3C90 A;  2P4V A;  2Y0P A;  1N34 B;  1SA0 A;  2F1M A;  4LF9 B;  4OX9 O;  2A79 B;  4FLT A;  5J2U A;  1AI6 A;  1IDS A;  1IUR A;  5LXT A;  1OCZ B;  1GM9 A;  1ZLZ A;  3JAM N;  3K79 A;  1WA8 A;  3JAW A;  2VWJ A;  3T1H B;  2ZE5 A;  1FJG B;  3SJQ C;  3QG5 A;  2Q5Z A;  3E89 A;  1P84 F;  3CHX A;  2FYU H;  3CX5 F;  3JAL B;  4DR5 B;  2ZR3 A;  4JTA B;  4WFF A;  3E8F A;  2QM4 A;  2PF4 E;  4B7E A;  1GK9 A;  1N4C A;  1HNX B;  4MVZ A;  1ZWI C;  3ZHT A;  4BIO A;  2G38 A;  4NTW A;  4LH7 A;  2WPD G;  1OCZ C;  2VRZ A;  3LSU A;  3CE2 A;  5JQG A;  2UUB B;  1AB3 A;  4DR7 O;  4MVS A;  2CH7 A;  1MZF A;  2XTA A;  1XUQ A; 
#chains in the Genus database with same CATH homology
 2AW9 A;  3EVK A;  4YIO A;  3IC9 A;  1B06 A;  1QNM A;  3C3S A;  1ZSP A;  3QVN A;  1N0N A;  2ADQ B;  1KKC A;  1WB8 A;  1EN4 A;  1P7G A;  3CEI A;  2QKC A;  3MDS A;  4GUN A;  1GN3 A;  1IX9 A;  1GN4 A;  4C7U A;  1XRE A;  2ADP A;  1SZX A;  3AK1 A;  1N0J A;  1LUV A;  1JA8 A;  1EM1 A;  1MSD A;  1BSM A;  3RN4 A;  1I0H A;  1MA1 A;  2CE4 A;  4X9Q A;  4E4E A;  1ZTE A;  1MNG A;  1PL4 A;  1PM9 A;  3KDR A;  2CDY A;  1ZUQ A;  1XIL A;  2QKA A;  1D5N A;  3BFR A;  1I08 A;  3C3T A;  1JR9 A;  3KKY A;  1IDS A;  1AR4 A;  1ZLZ A;  4JZ2 A;  4JZG A;  1GN6 A;  2RCV A;  5AG2 A;  1LUW A;  1VAR A;  3K9S A;  3TJT A;  1AP6 A;  1AP5 A;  3DC5 A;  4JYY A;  1EN5 A;  2P4K A;  2GDS A;  1BT8 A;  3DC6 A;  4BR6 A;  5A9G A;  1AR5 A;  3LSU A;  4F6E A;  1WB7 A;  3AK3 A;  3OT7 A;  4FFK A;  1EN6 A;  1AVM A;  1XDC A;  4YIP A;  1MMM A;  1BS3 A;  1VEW A;  1GN2 A;  1Y67 A;  1XUQ A;  3AK2 A;  1IXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...