2RCVA

Crystal structure of the bacillus subtilis superoxide dismutase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
AYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVADLDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFAAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDYISAFWNVVNWDEVARLYSER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Structure of Bacillus subtilis superoxide dismutase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 69
structure length 200
sequence length 200
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2rcvA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2rcvA02
1AR4A 1BS3A 1MMMA 1XDCA 4YIPA 3EVKA 2P4KA 4BR6A 1GN4A 3TJTA 4JZ2A 1LUVA 2ADQB 3AK1A 1D5NA 1Y67A 1IXBA 1I08A 1ZSPA 3DC5A 1N0JA 4X9QA 1XILA 1WB8A 1MSDA 1MA1A 1I0HA 1MNGA 1EM1A 1GN6A 3K9SA 3MDSA 1XREA 1IX9A 4JYYA 1XUQA 3QVNA 1BT8A 4GUNA 2GDSA 3C3TA 1EN6A 5AG2A 1BSMA 3KKYA 1VARA 4F6EA 1AP5A 4JZGA 1ZUQA 2CDYA 1ZLZA 3LSUA 4YIOA 3OT7A 3CEIA 1AVMA 2AW9A 3RN4A 2RCVA 1WB7A 3AK3A 1ZTEA 1AP6A 3BFRA 1B06A 3DC6A 1PM9A 1EN5A 5A9GA 4C7UA 2QKAA 3AK2A 1JR9A 1EN4A 1SZXA 3IC9A 2ADPA 3C3SA 1KKCA 1LUWA 4E4EA 1AR5A 2CE4A 1JA8A 1GN3A 1N0NA 1GN2A 1PL4A 4FFKA 1P7GA 1VEWA 1QNMA 1IDSA 2QKCA
chains in the Genus database with same CATH superfamily
1R3LC 2OIEA 2VQFO 1IBKB 1KP3A 4LF4B 4JZ2A 4OPAA 1HW7A 4DR3B 1LUVA 2XAJA 4TUYB 1Q5OA 4J41A 4JI4B 4B3SO 5ITZA 1YZBA 1IXBA 3RGBA 4J7KA 2VQEB 4DV6B 1TA8A 4MTGA 1F7YA 5KHGA 2EIMC 2UXDO 4X9QA 4XDJA 3GB7C 4K3AA 1MG1A 5FPOA 5GONB 2Y69C 2YIBA 4JYAB 3E83A 2DOSA 3KZIZ 1SC5B 1VQ9V 1PV0A 1RPOA 1UJWB 4B08A 3ZRWA 2D3OW 2L6LA 3W7TA 2XNDG 4DUYO 3C3TA 3L75H 1HNWB 4CH3A 1ZL8A 2Q0AA 5H9CA 5AG2A 2UXDB 1P4RA 2Z3YA 4DV1O 1SQFA 2B1IA 5E79Z 5LGNA 4DV7O 1VARA 3S3WA 2Q7HA 2WA3A 2WLIA 4X1YA 3RYCB 5KX5B 3LSUA 4GLXA 3R65A 4UCOA 1XOUA 5IYDO 2NLJC 1ZTEA 4JGSA 3BFRA 3D3IA 3C3SA 3OAAG 3TK1A 2E76B 4DV7B 3K04A 1NI8A 2ZCEA 1F51A 5JH7A 1MMMA 2AXTZ 5C8YA 1SESA 2P7TC 3JAWB 4LBEC 4W4KA 4NXMO 1YF2A 2UUBO 4B7KA 4JI5B 2HLDG 1V55B 1I08A 1VF6A 1IXMA 3E22A 2QM7A 5EIBC 1THZA 4K0KB 4JPRA 1SA0A 1M90W 4OX9O 2F93B 5JJJB 5LOVB 3ABLB 4HYOA 4UCRA 1KBHA 1NTMH 2Q7EA 2OTJV 4NXMB 4OGQB 2UUBB 1HNXO 4FJCC 4YXWG 4GZRB 1ROPA 2Z0AA 5LL6Y 3F5TA 4UVCA 4I9QA 2CUGA 1KU9A 3JD0A 4FFBB 4O2BB 1QLEC 3X2QB 1KYOF 4UV9A 1Y76A 4P30A 4TV8A 3CS5A 2V7QG 4OX9B 3CXHF 1J5EO 1NJIW 1K97A 3RYIA 1K73W 1AJPA 2JK5C 1JJ2U 5L3CA 5H6QA 2ZKOA 2YIBD 3OR7C 1U96A 2R72A 1AVMA 3E89A 4L8JA 3RN4A 5LHIA 2LP7A 1HNXB 2AHYA 2LQTA 1OZ0A 2QSAA 5KA6A 1U97A 1GN2A 1J5EB 3FB6C 2EZOA 1YDXA 3L71H 3B8MA 4OXSA 5L3GA 3BA8A 2DWEC 2GSMB 1AR4A 4DV5B 1R6KA 3EVKA 2HVKC 5J2UB 3TJTA 2WLJA 1TAEA 3CRRA 4DXWA 4JTCB 2N05A 1DF4A 2DE0X 3OMNB 1IZ3A 1R3IC 2P06A 4F4LA 4DR4B 4YJ3B 1HNZO 1W0KG 5BY1A 4HZ3A 4CBCA 1AI4A 2NN4A 1MZFA 2R9RB 2FMLA 4TT3G 2E5LO 4CH6A 3CWBH 2Q69A 3UO3A 1NH2D 4O2AA 5BMVB 3M99B 1F23A 1N34O 2OCCC 5GONA 2IH3C 3JD1A 1XUQA 2DYRB 4PI0A 3M7MX 4FPPA 2GDSA 3SPJA 2EILC 4X1KB 1HNZB 2XAGA 4I0XA 1Q6HA 2QTOA 3KKYA 2JS3A 3UT5A 1G6UA 2KSDA 2E5LB 3HKBA 1I94O 3ZS8C 1FXVA 1ZLZA 3OMAB 1OCCC 4DR1O 1SRYA 3B2EE 3OE7G 4I55A 2CAZC 3KCXA 5GTIZ 3SJBC 3L72H 4ZHQA 3M8AA 5CBHA 4WBNA 1XMQO 3CMEV 3JALA 4MW8A 5KHHA 5KLVH 1I7FA 3JYCA 2IU3A 3JSLA 2WLHA 3K59A 4FLZA 5LGTA 2YXLA 4U3JA 2XT9A 4RUEA 5JQGB 5KHJA 5EBLC 4BR6A 3UM7A 3FYIB 3ZHQA 4JAUA 1RSOA 2YXHA 4CZZA 3JARB 4IYIA 4MS2A 5KAIZ 2F95B 3I5DA 4BIUA 1IBLO 1XMQB 2EIJB 2ZE7A 1H8HG 4WFFA 3JATB 3L74H 2HVJC 4JASA 1K5QA 3E8FA 2Q9LA 3K0GA 4I50A 2P6JA 1VQ7V 5IE9A 3QG5A 2EINB 3T4DA 3CJHB 4MSWC 3VQVA 3B09A 1XNQO 1OCOB 1OCRB 2ZNJA 3QVNA 1XHXA 2CGNA 1IBLB 2GUZB 4JI7O 1H2NA 1QR9A 2ATKC 4LFAO 3K5OA 2YEVB 2ZR2A 4QJFB 4DRXB 5DM6V 2HG5C 5EC1C 4RQFA 4XDLA 1GRJA 3L70H 1IBMO 1XEQA 3AG3B 2K1EA 1WP7A 1X4TA 4E2LA 2QWOB 5LMUO 3CC2V 1XNQB 1WPBA 1H2SB 3AK3A 3ZHVA 3MHSC 3VOUA 1KP2A 4JI7B 2XAHA 1TUBA 3RYHB 4W4LA 2Q68A 3AG4B 5DN6G 4LFAB 1EZVH 2ZE5A 1VQKV 4I7ZB 2DYSC 2QE7G 2E75B 4DW0A 1YVWA 1SQXH 1B6QA 4J7JA 1SETA 1S5JA 1P7GA 1IBMB 1EZJA 3S3XA 3EHBB 4P2ZA 3OGCC 1OHHG 5B1BB 4O4IB 1VMGA 5L3EA 3P3PA 2OT5A 4NR1A 2WLNA 1K4CC 1NTZH 3ZMUA 4ABMA 5KMGB 4RQEA 1E79G 3QTCA 1O9HA 3ZHTA 4KXRA 5B1OA 3BA9A 1HR0O 1K3EA 5JVDB 1L1FA 1JX9A 3D3QA 4H13B 4B3MO 1V55C 1LNQA 4CS4A 4YY3O 3K5LA 1WB8A 3I56V 3ZMZA 3BY6A 1KECA 3ZMTA 5TISZ 1J95A 3F5WC 4KFMA 3ABLC 1ZAUA 3CCLV 2W0FC 3W7SA 2ETNA 1AJNA 3N27A 3OR6C 3OGIB 3P3NA 4MT8A 4WFBV 1R6TA 5IJ9B 2LGQA 3ZHUA 3IGAC 5H6RA 3KCYA 4AQYO 5LXTB 1FD9A 4YY3B 1JFFB 1XNRO 1AI5A 4JTDB 3LDEA 5GTHZ 4GT1A 3K58A 5KUKA 2VWKA 3ZMSA 3SJAC 3SPIA 5L3FA 1NTKH 4EFEA 1Y4MA 5IYBO 2CTWA 4JAAA 5LYJB 1EFRG 4WF9V 1NQTA 3SJCC 2QKAA 2DN9A 2QWQB 3D8CA 2LW7A 1LUWA 1AR5A 5CA3A 4AQYB 5IY5C 2ZM6O 1GM7A 2BTQA 1DK1A 1XNRB 3CSXA 5IYZA 4PDLA 3ASNB 1I5YA 3UKMA 3JASA 2P4KA 3ABKB 5HFMA 1Y74B 5JQGA 2M7WA 3E86A 3G6BA 1P49A 1FPOA 4CS3A 3JARA 1JOYA 5H5NA 4IGGA 4MVRA 4CC5A 2BSKB 3GVMA 4IT5A 3ETDA 5B3SB 2ZM6B 3ZMVA 1Q6IA 2AZ2A 1WP8A 1R6NA 2ZINA 2X7RB 2GTSA 4G27B 2QM8A 3P30A 1ZX3A 1RM1B 4LF9O 1BHAA 2IH1C 4IIJB 1K4DC 2ZQMA 3K9SA 1AROP 1V9PA 3JCZA 3LDDA 1Y6XA 3SYAA 1QVFU 3CJHA 3VQXA 4ZI7A 1S76D 4IL6Z 3HKDB 4MVMA 3FB8C 5CA1B 4X20B 4EKWA 4ICGA 2X0LA 5KA5A 4NVPA 4X65B 2WWWA 4LR3A 2QM4A 2ILMA 5EBWC 4H33A 1B3QA 2LFSA 5B1AB 4L87A 1PD3A 2PYLA 2YEVA 3AG1B 3K06A 4LF9B 1F4MA 2VQFB 2CDYA 1IVSA 3APQA 4GX2A 1N4CA 2ZXWB 4B3SB 3TCUA 2AW9A 2X6BA 1ENVA 1W59A 3OUFA 3SPGA 4O4HA 4CS2A 4UFZA 2JGUA 4P9OA 2YC0A 5IT9N 5CA0A 1H2KA 2WAMA 2CTQA 3CRMA 1KMIZ 2W6IG 2B5UA 3I55V 3AG7A 5CN0A 2Y4UA 4ZOLB 3QO8A 4JI0O 2JRIA 2OYQA 2LGWA 3KG2A 4TV9B 2RQ6A 2UXCO 3HKEB 1KC8W 2FTKA 4FLYA 3STLC 1E1QG 2RNBA 1ORQC 4DUYB 4X64O 4UCSA 4U3FH 5JJNB 4DV1B 4LWSA 2XAQA 5CMUA 4JI6O 2LJ2A 5HFLA 4DK1A 4R8CA 4JI0B 1M57C 4PDVA 2UXCB 3K08A 2ITDC 1TVKB 1NZ6A 1M4UA 2ITCC 2EINC 4I4TB 1NR7A 1Q6UA 2IJIA 1G1XB 2Q67A 2EX3A 4X64B 2QWRB 4FK5C 4J80A 2KG7B 4BW5A 1QR8A 4GUNA 2XUMA 1NT2B 3PN1A 4JI8O 1R3JC 3UCSC 4JI6B 1FFXB 5B66Z 1GO3F 1JCHA 1MZEA 4ASUG 1SQQH 1R1BA 5LBQA 1YITV 1JFFA 5C93A 4Z2WA 1WA8A 5J2TA 1N33O 3SGIA 1JVMA 4LC1A 3AG3C 3BVOA 1FXKB 3N2KB 2Y0PA 3B77A 3ZHRA 5LP6B 3OUSA 4UB8Z 5IJ0B 4IYHA 4CH4A 3JAMN 4QPJA 2YUAA 2H3OA 2H94A 1PM9A 3K5NA 3AK2A 4O4LB 1EBOA 3ABTA 4HNAA 4PDMA 4F6RB 3B4SA 3AG4C 3FD9A 4UCTA 4WFHA 4PA3A 4RO2A 4FLVA 3JAKB 2Y48A 1WLEA 3RWRD 3H1HH 1Y66A 1YEWA 4Z1VA 1N33B 1BQZA 4LNUB 5B1BC 3CD6V 2WLLB 3ICXA 3FKSG 5GW7A 2PZSA 4TOIA 4LF8O 3FFQA 4QNHB 1D5NA 4FLWA 1Q8IA 1YJWV 2DWDC 1T5EA 2HR3A 2JEXA 4LF5O 1M56C 4QE7A 1FAFA 3CCMV 1Q7YW 3KDRA 4MVOA 4GKKO 2F4VO 1MSDA 2UXBO 5LMNO 3N2GB 4LP8A 2EBOA 2VRZA 1SQVH 2ZR3A 4X1IB 3CPWU 3MDSA 1S72V 3O9OA 4LH7A 3TXQA 4TUYA 2OTLV 5IYCO 3ABMC 4ZIBA 3HKCB 2ODMA 3FB5C 2YXYA 1QLNA 1CPYA 3ZIAG 4DYLA 1GTOA 1WPXA 4D7TA 3ZN0A 2BOCC 2LW1A 3CB2A 4LF5B 2R9AA 1F4NA 4YJ2B 4GKKB 1H5WA 1YTFB 5LMNB 3VQWA 4UVAA 5JJEB 1ZUQA 3CC7V 2FL4A 3GWKC 4LFBO 4UV8A 3HR0A 2YI9A 4WFAV 2ZNIA 1K92A 2RCVA 5CB4B 5B5EZ 1Q82W 1FKAO 4EEQA 5LGUA 4DUZO 2UUCO 4E4EA 3DXRB 3QNEA 2W6JG 4JI3O 4AI8A 1Z5VA 4Q20A 3W7WA 1SZTA 3J81N 4RWUA 1Q43A 3RYCA 4FLUA 5KX5A 1N34B 3DSQA 5KHIA 2AHZA 2EULA 4YIPA 2Y69B 2B9ZA 3ASNC 3U11A 1BGYH 4LF7O 2PY5A 3FAVB 4DR5O 3Q4HB 3SJQC 1HDJA 1P7BA 2YICA 3IAYA 4BW9A 3ZHSA 3OEEG 1A32A 3P32A 4DUZB 4JYCA 1NVPB 1I94B 4UCUA 2ZDIC 2XAFA 4X66O 4DR1B 3SYPA 1I0HA 4KHPO 2CH7B 3OFNG 1X59A 5L3DA 1GK9A 1GN6A 3OTOO 4H0LB 1COWG 3JAWA 4LF7B 1NS1A 3CP1A 4NTYA 5EZYB 2XTAA 1IX9A 2AZ0A 2H8PC 2VWJA 4I4TA 1XQ8A 2GHYA 5FPRA 3TGUH 5LA6B 2JGDB 2PF4E 2P4VA 4FIPC 2KG7A 4EB6B 3MHHC 4GKJO 1EN6A 4WFEA 1PNMA 2GTAA 5LHHA 2X6AA 5LOVA 4X66B 2YIDA 4B3TO 3ZRXA 3CCRV 2P5OA 1BL8A 3OTOB 1BHBA 5IDJA 1D5AA 3NR7A 3U0ZA 2P67A 3J7AU 1DF5A 2ZXWC 3IJ4A 1QCEA 2KKWA 2CTPA 4B3RO 4FFBA 4O2BA 1K5SA 5ITZB 4N21A 2HJDA 1JR9A 4OPHA 5EBMC 1FYJA 2ADPA 2EJ7A 2XOKG 2EZPA 4B3TB 3WB0A 4F6RA 3FYEB 3OM3B 1N32O 5KAFZ 2P22C 3WU2Z 3JAKA 2IM9A 5LHGA 3H01A 3T2MA 4FLTA 2HP8A 3WG7B 3K3WA 2WLLA 1VF7A 4ZBMA 3ZRWB 4B3RB 1CEZA 1ZSPA 2WSSG 5DECA 4JI2O 4QE9A 3BAAA 2Y4TA 2Q5ZA 5LMUB 2WLIB 4PHZA 5J2UA 1YJ9V 3A0RA 4J9ZB 4X1IA 2OCHA 3SYQA 4JYYA 1S5LZ 2Q4PA 4J7ZA 1PP9H 2ZE6A 3ETEA 4YJ3A 1WJZA 2IBZH 3STZC 1YJNV 4JTAB 2IJKA 1AILA 1TGOA 1JJOA 1KQSU 1OCZB 2AGAA 4JZGA 2QWNB 1URFA 4LF6O 5BMVA 4LFCO 3JD3A 1V54B 3CRQA 5JH7B 2HEPA 4U7NA 2PYJA 3BCCH 3E8HA 3RW0A 5C8YB 3OW2U 3A0HZ 3K79A 1HR0B 2UU9O 3DGEA 3ZN1A 4FZ1A 2N74A 1FXKC 3RFRA 3RVZA 5LP6C 4X1KA 3J80N 4B3MB 3K57A 3X2QC 4C7UA 1EN4A 3IC9A 4DR2O 2F23A 3L73H 3UQ8A 3E22B 3CMAV 1G8MA 4NKGB 1N0NA 1L8DA 1SA0B 3RYFB 4J10A 2HKOA 1H8EG 4UXNA 3W7XA 1VEWA 1QNMA 4PELA 1GM9A 5BR8O 2BTOA 3ASOB 4RUFA 1N36O 1S5HC 5FL7G 4DV4O 1VQ5V 3LUTB 3K9AA 2ADQB 2UU9B 2LO1A 3FAVA 4LH6A 4BWAA 1VQ8V 2Q6AA 4R6ZA 1AI6A 5KHKA 3R66A 1MSWD 2FB5A 1R3KC 5EYPB 4DR2B 4HAMA 3DTUB 1BCCH 3F7VC 2OIGA 4TV8B 2UXXA 2ZE8A 1KUQA 2V1DA 2JJ2G 4TWKA 5IWAO 4GCZA 3RYIB 4MVZA 5BXZA 2JEUA 5FNVB 4FMTA 1G4YB 4DV3O 4DV4B 3A2FA 4NTWA 4LF4O 2FYUH 2RN9A 3BABA 4DR3O 3SYOA 1DGSA 1BE3H 3JATA 4JI4O 3AEIA 2RMKB 3CX5F 4EB6A 3AG2B 3RVYA 3CCVV 1YCIA 4DV6O 1K7DA 2PI5A 3QO7A 1IJGA 2WPDG 4PA6A 4TQFA 5IWAB 1Z5WA 3JD2A 3OEHG 2ZT9B 4B7EA 2Y0IA 4DW1A 3H9VA 2QWPB 4DV3B 4FVMA 3BHPA 3WB2A 4X89A 2QKSA 3WFVA 2DYRC 4JYAO 3T4ZA 2GUZA 3U10A 4MW3A 1EN5A 3E8GA 3BRCA 3RT3C 1PL0A 4DRXA 3VQYA 1VIBA 4X8AA 1GN3A 1HNWO 3ZCCA 1YTFD 1H2MA 2ZD9A 4NYKA 2BCCH 4JF3A 4CH5A 1VF5B 1FS0G 4DR7O 1HWYA 2GBOA 1JMKC 3RBZA 4O2AB 2QTSA 1M93A 1WAZA 2R9IA 2Q8VA 2BOBC 5FLXN 5DEDA 4FM1A 5KUMA 4CC6A 1XHZA 2QA4V 2JDIG 4UB6Z 3AK1A 4J42A 4R50A 3RYHA 1PNKA 2F66C 3ZEDA 3VBBA 5D5PA 4I0XB 4PA4A 4BAYA 4O4IA 3UT5B 1I5XA 3K0DA 3HKBB 4DR7B 1EM1A 1OV9A 2HHHO 2FKXA 1BQ0A 5KMGA 3QO5A 3OTFA 3E2EA 4BIZA 3CE2A 4I55B 4LCUC 2GV9A 4PA7A 3LSQA 5JVDA 2EIJC 2QR4A 4ZHQB 2JJ1G 1LR1A 4WBNB 1NVPD 3JALB 4JI5O 2DYSB 2Q7GA 2C2AA 1AI7A 3OMIB 2E3CA 3CCSV 4K0KO 5JWPA 3K5MA 5H2FZ 1H38A 2HHHB 4YIOA 1KD1W 4U3JB 2EIKB 3OT7A 1BZKA 4I5SA 1JNBA 4A5UB 1W2BU 4DV0O 1OCOC 1OCRC 1RSOB 1IURA 2KQXA 2RJZA 3IC7A 3ETQA 5IJ9A 4DO2A 1UFIA 2LFRA 3QF7A 1KKCA 5LXTA 3T1HO 4G2KA 2CE4A 2PUSA 1JA8A 3HPLC 3SYCA 1W0JG 1D2DA 4FFKA 3G67A 4GX1A 3RYFA 4I50B 1Q81W 1VQMV 4K35A 1TUEB 3ABUA 4DV0B 3SDLA 3LSSA 3CRCA 4JI8B 1FJGO 2B1GA 5LYJA 1M9NA 3WG7C 3CXCU 2X6CA 3ZBHA 4D6TH 2G38A 3E35A 4KL1A 3T1HB 5EYPA 3CCQV 1KB9F 5EIBD 4U7OA 3EFFK 1K9MW 1SQGA 2BE3A 4RAIA 3ZRSA 5F2VO 4HBNA 4G28B 2ARHA 1HP8A 2JVDA 3CRAA 4UCVA 2CK3G 1VQLV 1MNGA 1H2LA 2IU0A 4J11A 5EK0A 1Y74A 1CXZB 4QPKA 5FNVA 3CCEV 2KB1A 3H1KH 2A06H 2WLKA 4DV5O 3LDCA 5K1PA 1FJGB 1US6A 2MW2B 1BT8A 3PJSK 2BSKA 4AILC 2ZDIA 4JI1O 2E74B 1TUBB 4X62O 4JYBA 1XI1A 4DR4O 5IY5B 5JCOA 2IW5A 1L0NH 2HFEC 1KKDA 4IIJA 1OCZC 1RFYA 1E1RG 5K1XA 4K8ZA 4LF8B 4DR6O 4Q6GA 2NR5A 1NU1H 4GX0A 3HKDA 2VS0A 1AR1B 2QGNA 3ETGA 1V54C 5CA1A 4X20A 3ZX6A 2K9PA 4R7CA 1B04A 3B40A 2Q73A 3APOA 4JI1B 2Q0OC 4AHCA 3L9DA 4XDKA 4YHHO 1SZXA 4J9YB 2F4VB 2EJRA 4X62B 2OWOA 2UXBB 2XASA 4H37A 1XL6A 3ML0A 4NXNO 5CBGA 2A79B 1XBLA 1VF6C 4TQDA 2DMXA 3LNMB 3C90A 2DQ0A 1BS3A 1FXHA 5D5QA 4DR6B 4UVBA 1QBZA 3ZRVA 3ASOC 1QVGU 1NR1A 2IJJA 4K8XA 1NBMG 1OJHA 2CTRA 1L0LH 2EIMB 4GX5A 4YHHB 3D36A 3JD4A 1ZWIC 4O4JB 4NXNB 3CC4V 1H2GA 2Z5UA 4ZOLA 4LFBB 3SPCA 1MA1A 1Z2GA 2ZIMA 4TV9A 3HKEA 3CYOA 5B1NA 1XL4A 4FLXA 3BPZA 3ABKC 1XREA 1P84F 3UO2A 1K34A 2WA4A 5CBFA 2UUCB 1JQ0A 2F1MA 4JI3B 2QJ1A 1S0VA 3G4SV 4H44B 4IHJB 5B3SC 3MD0A 4GYCB 1VQNV 3H1JH 4MTOA 1VQ4V 4F6EA 5JCOC 2BTQB 3MAQA 3AG2C 4JAVA 1RM1C 1TVKA 3FB7C 4ZKIA 5IYZB 4DR5B 1CP9A 3CHXA 3W7UA 2YIAA 1S77D 3JASB 2YDEA 1Q3EA 4KUMA 4PV1B 3G80A 1DLBA 1VP7A 1QU7A 2YI8A 2UXNA 1YIJV 1B06A 3DC6A 3T1CA 1FFXA 1FOUA 1GM8A 2IJHA 2V4DA 2R70A 4KHPB 3HB3B 5B1AC 1M5IA 1PL4A 3EXAA 2JS5A 3AG1C 1S3JA 1RPRA 3BEHA 1FFTB 1K8AW 4D7SA 1M57B 1UPGA 4FM2A 1FXKA 1YXBA 4MTXA 3N2KA 5LP6A 5EC2C 1QHTA 3T1YO 5IJ0A 4ZI7B 4GKJB 3SPHA 2CGOA 2DW4A 4O4LA 2L35A 4MVQA 3CCUV 3DC5A 3D36C 1N0JA 3CCJV 4DK0A 3JCUZ 4QGPA 1VQOV 2A7WA 4BIOA 1GAXA 5E1AC 3FX7A 4WCEV 4LNUA 1PNLA 4Z1MG 1Q90D 3T1YB 4TSFG 2A0LA 3H1IH 4JV5O 1QLEB 4XBFA 2XHBA 3TETA 4PI2A 1ZL8B 4PD4F 2UUAO 4O4HB 1GKFA 1SQBH 5CA0B 2DJVA 1N32B 4P9PA 4X1YB 3N2GA 1AP5A 3WB1A 1WNSA 2F43G 1YI2V 3JSNA 1BMFG 2A3QA 4NTXA 3HKCA 3F7YC 4UUJC 2EIKC 1WB7A 4JV5B 5BZBA 2ZIOA 3TXSA 1AP6A 4JI2B 1M1KW 1RP3B 1Q86W 4NB5A 4WFGA 2UUAB 2RDCA 2O57A 4MVUA 1K33A 3G71V 1AJQA 1SS3A 4YJ2A 1M56B 4LWSB 2M6YA 3ZJZA 3NXSA 1N8RW 1GMGA 2NNUA 1VQPV 1NH2B 2QKCA 5J9PC 1XDCA 1SF9A 1YSCA 1GN4A 5CB4A 1DTOA 3ABMB 4N23A 4FM0A 4MVSA 1WN7A 4QIWF 1R73A 2DQ3A 1XMOO 2JIZG 3OD4A 1Y67A 2YSUB 5A2QN 2QDOA 1MABG 3DXRA 4LF6B 4LFCB 1QQCA 3THOA 2MK3A 1GH6A 4O4JA 1XILA 2OCCB 4EFBA 2P90A 1WA8B 1AB3A 4KP4A 1MOFA 3Q4HA 4DV2O 5J2TB 1SQPH 2EILB 4FZ0A 4I9WA 4PDRA 3LNNA 4MTFA 2YS8A 1XMOB 1JPXA 1Y76B 3IFXA 4IHJA 2PTMA 1BSMA 4HNAB 5BR8B 2N04A 1OCCB 1SERA 2A9HA 3SR2C 2CH7A 2PI4A 1N36B 5EZYA 3CEIA 1PKXA 3O65A 1PPJH 2PGGA 4DV2B 1IBKO 5LA6A 2JGDA 3B8NA 2QEXV 1NKDA 2WLMA 1YHQV 4PA9A 5A9GA 3E8BA 4X88A 2VQEO 1VQ6V 1SKVA 2W0XA 3A8TA 3H1LH 2D2CB 1O9GA 4X65O 4PJ0Z 5L3BA 3GWOA 3A0BZ 2HJFC 3K03A 3G6EV 1IDSA
chains in the Genus database with same CATH topology
1AR4A 1BS3A 1MMMA 1XDCA 4YIPA 3EVKA 2P4KA 4BR6A 1GN4A 3TJTA 4JZ2A 1LUVA 2ADQB 3AK1A 1D5NA 1Y67A 1IXBA 1I08A 1ZSPA 3DC5A 1N0JA 3KDRA 4X9QA 1XILA 1WB8A 1MSDA 1MA1A 1I0HA 1MNGA 1EM1A 1GN6A 3K9SA 3MDSA 1XREA 1IX9A 4JYYA 1XUQA 3QVNA 1BT8A 4GUNA 2GDSA 3C3TA 1EN6A 5AG2A 1BSMA 3KKYA 1VARA 4F6EA 1AP5A 4JZGA 1ZUQA 2CDYA 1ZLZA 3LSUA 4YIOA 3OT7A 3CEIA 1AVMA 2AW9A 3RN4A 2RCVA 1WB7A 3AK3A 1ZTEA 1AP6A 3BFRA 1B06A 3DC6A 1PM9A 1EN5A 5A9GA 4C7UA 2QKAA 3AK2A 1JR9A 1EN4A 1SZXA 3IC9A 2ADPA 3C3SA 1KKCA 1LUWA 4E4EA 1AR5A 2CE4A 1JA8A 1GN3A 1N0NA 1GN2A 1PL4A 4FFKA 1P7GA 1VEWA 1QNMA 1IDSA 2QKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR4 A;  1BS3 A;  1MMM A;  1XDC A;  4YIP A;  3EVK A;  2P4K A;  4BR6 A;  1GN4 A;  3TJT A;  4JZ2 A;  1LUV A;  2ADQ B;  3AK1 A;  1D5N A;  1Y67 A;  1IXB A;  1I08 A;  1ZSP A;  3DC5 A;  1N0J A;  4X9Q A;  1XIL A;  1WB8 A;  1MSD A;  1MA1 A;  1I0H A;  1MNG A;  1EM1 A;  1GN6 A;  3K9S A;  3MDS A;  1XRE A;  1IX9 A;  4JYY A;  1XUQ A;  3QVN A;  1BT8 A;  4GUN A;  2GDS A;  3C3T A;  1EN6 A;  5AG2 A;  1BSM A;  3KKY A;  1VAR A;  4F6E A;  1AP5 A;  4JZG A;  1ZUQ A;  2CDY A;  1ZLZ A;  3LSU A;  4YIO A;  3OT7 A;  3CEI A;  1AVM A;  2AW9 A;  3RN4 A;  2RCV A;  1WB7 A;  3AK3 A;  1ZTE A;  1AP6 A;  3BFR A;  1B06 A;  3DC6 A;  1PM9 A;  1EN5 A;  5A9G A;  4C7U A;  2QKA A;  3AK2 A;  1JR9 A;  1EN4 A;  1SZX A;  3IC9 A;  2ADP A;  3C3S A;  1KKC A;  1LUW A;  4E4E A;  1AR5 A;  2CE4 A;  1JA8 A;  1GN3 A;  1N0N A;  1GN2 A;  1PL4 A;  4FFK A;  1P7G A;  1VEW A;  1QNM A;  1IDS A;  2QKC A; 
#chains in the Genus database with same CATH topology
 1R3L C;  2OIE A;  2VQF O;  1IBK B;  1KP3 A;  4LF4 B;  4JZ2 A;  4OPA A;  1HW7 A;  4DR3 B;  1LUV A;  2XAJ A;  4TUY B;  1Q5O A;  4J41 A;  4JI4 B;  4B3S O;  5ITZ A;  1YZB A;  1IXB A;  3RGB A;  4J7K A;  2VQE B;  4DV6 B;  1TA8 A;  4MTG A;  1F7Y A;  5KHG A;  2EIM C;  2UXD O;  4X9Q A;  4XDJ A;  3GB7 C;  4K3A A;  1MG1 A;  5FPO A;  5GON B;  2Y69 C;  2YIB A;  4JYA B;  3E83 A;  2DOS A;  3KZI Z;  1SC5 B;  1VQ9 V;  1PV0 A;  1RPO A;  1UJW B;  4B08 A;  3ZRW A;  2D3O W;  2L6L A;  3W7T A;  2XND G;  4DUY O;  3C3T A;  3L75 H;  1HNW B;  4CH3 A;  1ZL8 A;  2Q0A A;  5H9C A;  5AG2 A;  2UXD B;  1P4R A;  2Z3Y A;  4DV1 O;  1SQF A;  2B1I A;  5E79 Z;  5LGN A;  4DV7 O;  1VAR A;  3S3W A;  2Q7H A;  2WA3 A;  2WLI A;  4X1Y A;  3RYC B;  5KX5 B;  3LSU A;  4GLX A;  3R65 A;  4UCO A;  1XOU A;  5IYD O;  2NLJ C;  1ZTE A;  4JGS A;  3BFR A;  3D3I A;  3C3S A;  3OAA G;  3TK1 A;  2E76 B;  4DV7 B;  3K04 A;  1NI8 A;  2ZCE A;  1F51 A;  5JH7 A;  1MMM A;  2AXT Z;  5C8Y A;  1SES A;  2P7T C;  3JAW B;  4LBE C;  4W4K A;  4NXM O;  1YF2 A;  2UUB O;  4B7K A;  4JI5 B;  2HLD G;  1V55 B;  1I08 A;  1VF6 A;  1IXM A;  3E22 A;  2QM7 A;  5EIB C;  1THZ A;  4K0K B;  4JPR A;  1SA0 A;  1M90 W;  4OX9 O;  2F93 B;  5JJJ B;  5LOV B;  3ABL B;  4HYO A;  4UCR A;  1KBH A;  1NTM H;  2Q7E A;  2OTJ V;  4NXM B;  4OGQ B;  2UUB B;  1HNX O;  4FJC C;  4YXW G;  4GZR B;  1ROP A;  2Z0A A;  5LL6 Y;  3F5T A;  4UVC A;  4I9Q A;  2CUG A;  1KU9 A;  3JD0 A;  4FFB B;  4O2B B;  1QLE C;  3X2Q B;  1KYO F;  4UV9 A;  1Y76 A;  4P30 A;  4TV8 A;  3CS5 A;  2V7Q G;  4OX9 B;  3CXH F;  1J5E O;  1NJI W;  1K97 A;  3RYI A;  1K73 W;  1AJP A;  2JK5 C;  1JJ2 U;  5L3C A;  5H6Q A;  2ZKO A;  2YIB D;  3OR7 C;  1U96 A;  2R72 A;  1AVM A;  3E89 A;  4L8J A;  3RN4 A;  5LHI A;  2LP7 A;  1HNX B;  2AHY A;  2LQT A;  1OZ0 A;  2QSA A;  5KA6 A;  1U97 A;  1GN2 A;  1J5E B;  3FB6 C;  2EZO A;  1YDX A;  3L71 H;  3B8M A;  4OXS A;  5L3G A;  3BA8 A;  2DWE C;  2GSM B;  1AR4 A;  4DV5 B;  1R6K A;  3EVK A;  2HVK C;  5J2U B;  3TJT A;  2WLJ A;  1TAE A;  3CRR A;  4DXW A;  4JTC B;  2N05 A;  1DF4 A;  2DE0 X;  3OMN B;  1IZ3 A;  1R3I C;  2P06 A;  4F4L A;  4DR4 B;  4YJ3 B;  1HNZ O;  1W0K G;  5BY1 A;  4HZ3 A;  4CBC A;  1AI4 A;  2NN4 A;  1MZF A;  2R9R B;  2FML A;  4TT3 G;  2E5L O;  4CH6 A;  3CWB H;  2Q69 A;  3UO3 A;  1NH2 D;  4O2A A;  5BMV B;  3M99 B;  1F23 A;  1N34 O;  2OCC C;  5GON A;  2IH3 C;  3JD1 A;  1XUQ A;  2DYR B;  4PI0 A;  3M7M X;  4FPP A;  2GDS A;  3SPJ A;  2EIL C;  4X1K B;  1HNZ B;  2XAG A;  4I0X A;  1Q6H A;  2QTO A;  3KKY A;  2JS3 A;  3UT5 A;  1G6U A;  2KSD A;  2E5L B;  3HKB A;  1I94 O;  3ZS8 C;  1FXV A;  1ZLZ A;  3OMA B;  1OCC C;  4DR1 O;  1SRY A;  3B2E E;  3OE7 G;  4I55 A;  2CAZ C;  3KCX A;  5GTI Z;  3SJB C;  3L72 H;  4ZHQ A;  3M8A A;  5CBH A;  4WBN A;  1XMQ O;  3CME V;  3JAL A;  4MW8 A;  5KHH A;  5KLV H;  1I7F A;  3JYC A;  2IU3 A;  3JSL A;  2WLH A;  3K59 A;  4FLZ A;  5LGT A;  2YXL A;  4U3J A;  2XT9 A;  4RUE A;  5JQG B;  5KHJ A;  5EBL C;  4BR6 A;  3UM7 A;  3FYI B;  3ZHQ A;  4JAU A;  1RSO A;  2YXH A;  4CZZ A;  3JAR B;  4IYI A;  4MS2 A;  5KAI Z;  2F95 B;  3I5D A;  4BIU A;  1IBL O;  1XMQ B;  2EIJ B;  2ZE7 A;  1H8H G;  4WFF A;  3JAT B;  3L74 H;  2HVJ C;  4JAS A;  1K5Q A;  3E8F A;  2Q9L A;  3K0G A;  4I50 A;  2P6J A;  1VQ7 V;  5IE9 A;  3QG5 A;  2EIN B;  3T4D A;  3CJH B;  4MSW C;  3VQV A;  3B09 A;  1XNQ O;  1OCO B;  1OCR B;  2ZNJ A;  3QVN A;  1XHX A;  2CGN A;  1IBL B;  2GUZ B;  4JI7 O;  1H2N A;  1QR9 A;  2ATK C;  4LFA O;  3K5O A;  2YEV B;  2ZR2 A;  4QJF B;  4DRX B;  5DM6 V;  2HG5 C;  5EC1 C;  4RQF A;  4XDL A;  1GRJ A;  3L70 H;  1IBM O;  1XEQ A;  3AG3 B;  2K1E A;  1WP7 A;  1X4T A;  4E2L A;  2QWO B;  5LMU O;  3CC2 V;  1XNQ B;  1WPB A;  1H2S B;  3AK3 A;  3ZHV A;  3MHS C;  3VOU A;  1KP2 A;  4JI7 B;  2XAH A;  1TUB A;  3RYH B;  4W4L A;  2Q68 A;  3AG4 B;  5DN6 G;  4LFA B;  1EZV H;  2ZE5 A;  1VQK V;  4I7Z B;  2DYS C;  2QE7 G;  2E75 B;  4DW0 A;  1YVW A;  1SQX H;  1B6Q A;  4J7J A;  1SET A;  1S5J A;  1P7G A;  1IBM B;  1EZJ A;  3S3X A;  3EHB B;  4P2Z A;  3OGC C;  1OHH G;  5B1B B;  4O4I B;  1VMG A;  5L3E A;  3P3P A;  2OT5 A;  4NR1 A;  2WLN A;  1K4C C;  1NTZ H;  3ZMU A;  4ABM A;  5KMG B;  4RQE A;  1E79 G;  3QTC A;  1O9H A;  3ZHT A;  4KXR A;  5B1O A;  3BA9 A;  1HR0 O;  1K3E A;  5JVD B;  1L1F A;  1JX9 A;  3D3Q A;  4H13 B;  4B3M O;  1V55 C;  1LNQ A;  4CS4 A;  4YY3 O;  3K5L A;  1WB8 A;  3I56 V;  3ZMZ A;  3BY6 A;  1KEC A;  3ZMT A;  5TIS Z;  1J95 A;  3F5W C;  4KFM A;  3ABL C;  1ZAU A;  3CCL V;  2W0F C;  3W7S A;  2ETN A;  1AJN A;  3N27 A;  3OR6 C;  3OGI B;  3P3N A;  4MT8 A;  4WFB V;  1R6T A;  5IJ9 B;  2LGQ A;  3ZHU A;  3IGA C;  5H6R A;  3KCY A;  4AQY O;  5LXT B;  1FD9 A;  4YY3 B;  1JFF B;  1XNR O;  1AI5 A;  4JTD B;  3LDE A;  5GTH Z;  4GT1 A;  3K58 A;  5KUK A;  2VWK A;  3ZMS A;  3SJA C;  3SPI A;  5L3F A;  1NTK H;  4EFE A;  1Y4M A;  5IYB O;  2CTW A;  4JAA A;  5LYJ B;  1EFR G;  4WF9 V;  1NQT A;  3SJC C;  2QKA A;  2DN9 A;  2QWQ B;  3D8C A;  2LW7 A;  1LUW A;  1AR5 A;  5CA3 A;  4AQY B;  5IY5 C;  2ZM6 O;  1GM7 A;  2BTQ A;  1DK1 A;  1XNR B;  3CSX A;  5IYZ A;  4PDL A;  3ASN B;  1I5Y A;  3UKM A;  3JAS A;  2P4K A;  3ABK B;  5HFM A;  1Y74 B;  5JQG A;  2M7W A;  3E86 A;  3G6B A;  1P49 A;  1FPO A;  4CS3 A;  3JAR A;  1JOY A;  5H5N A;  4IGG A;  4MVR A;  4CC5 A;  2BSK B;  3GVM A;  4IT5 A;  3ETD A;  5B3S B;  2ZM6 B;  3ZMV A;  1Q6I A;  2AZ2 A;  1WP8 A;  1R6N A;  2ZIN A;  2X7R B;  2GTS A;  4G27 B;  2QM8 A;  3P30 A;  1ZX3 A;  1RM1 B;  4LF9 O;  1BHA A;  2IH1 C;  4IIJ B;  1K4D C;  2ZQM A;  3K9S A;  1ARO P;  1V9P A;  3JCZ A;  3LDD A;  1Y6X A;  3SYA A;  1QVF U;  3CJH A;  3VQX A;  4ZI7 A;  1S76 D;  4IL6 Z;  3HKD B;  4MVM A;  3FB8 C;  5CA1 B;  4X20 B;  4EKW A;  4ICG A;  2X0L A;  5KA5 A;  4NVP A;  4X65 B;  2WWW A;  4LR3 A;  2QM4 A;  2ILM A;  5EBW C;  4H33 A;  1B3Q A;  2LFS A;  5B1A B;  4L87 A;  1PD3 A;  2PYL A;  2YEV A;  3AG1 B;  3K06 A;  4LF9 B;  1F4M A;  2VQF B;  2CDY A;  1IVS A;  3APQ A;  4GX2 A;  1N4C A;  2ZXW B;  4B3S B;  3TCU A;  2AW9 A;  2X6B A;  1ENV A;  1W59 A;  3OUF A;  3SPG A;  4O4H A;  4CS2 A;  4UFZ A;  2JGU A;  4P9O A;  2YC0 A;  5IT9 N;  5CA0 A;  1H2K A;  2WAM A;  2CTQ A;  3CRM A;  1KMI Z;  2W6I G;  2B5U A;  3I55 V;  3AG7 A;  5CN0 A;  2Y4U A;  4ZOL B;  3QO8 A;  4JI0 O;  2JRI A;  2OYQ A;  2LGW A;  3KG2 A;  4TV9 B;  2RQ6 A;  2UXC O;  3HKE B;  1KC8 W;  2FTK A;  4FLY A;  3STL C;  1E1Q G;  2RNB A;  1ORQ C;  4DUY B;  4X64 O;  4UCS A;  4U3F H;  5JJN B;  4DV1 B;  4LWS A;  2XAQ A;  5CMU A;  4JI6 O;  2LJ2 A;  5HFL A;  4DK1 A;  4R8C A;  4JI0 B;  1M57 C;  4PDV A;  2UXC B;  3K08 A;  2ITD C;  1TVK B;  1NZ6 A;  1M4U A;  2ITC C;  2EIN C;  4I4T B;  1NR7 A;  1Q6U A;  2IJI A;  1G1X B;  2Q67 A;  2EX3 A;  4X64 B;  2QWR B;  4FK5 C;  4J80 A;  2KG7 B;  4BW5 A;  1QR8 A;  4GUN A;  2XUM A;  1NT2 B;  3PN1 A;  4JI8 O;  1R3J C;  3UCS C;  4JI6 B;  1FFX B;  5B66 Z;  1GO3 F;  1JCH A;  1MZE A;  4ASU G;  1SQQ H;  1R1B A;  5LBQ A;  1YIT V;  1JFF A;  5C93 A;  4Z2W A;  1WA8 A;  5J2T A;  1N33 O;  3SGI A;  1JVM A;  4LC1 A;  3AG3 C;  3BVO A;  1FXK B;  3N2K B;  2Y0P A;  3B77 A;  3ZHR A;  5LP6 B;  3OUS A;  4UB8 Z;  5IJ0 B;  4IYH A;  4CH4 A;  3JAM N;  4QPJ A;  2YUA A;  2H3O A;  2H94 A;  1PM9 A;  3K5N A;  3AK2 A;  4O4L B;  1EBO A;  3ABT A;  4HNA A;  4PDM A;  4F6R B;  3B4S A;  3AG4 C;  3FD9 A;  4UCT A;  4WFH A;  4PA3 A;  4RO2 A;  4FLV A;  3JAK B;  2Y48 A;  1WLE A;  3RWR D;  3H1H H;  1Y66 A;  1YEW A;  4Z1V A;  1N33 B;  1BQZ A;  4LNU B;  5B1B C;  3CD6 V;  2WLL B;  3ICX A;  3FKS G;  5GW7 A;  2PZS A;  4TOI A;  4LF8 O;  3FFQ A;  4QNH B;  1D5N A;  4FLW A;  1Q8I A;  1YJW V;  2DWD C;  1T5E A;  2HR3 A;  2JEX A;  4LF5 O;  1M56 C;  4QE7 A;  1FAF A;  3CCM V;  1Q7Y W;  3KDR A;  4MVO A;  4GKK O;  2F4V O;  1MSD A;  2UXB O;  5LMN O;  3N2G B;  4LP8 A;  2EBO A;  2VRZ A;  1SQV H;  2ZR3 A;  4X1I B;  3CPW U;  3MDS A;  1S72 V;  3O9O A;  4LH7 A;  3TXQ A;  4TUY A;  2OTL V;  5IYC O;  3ABM C;  4ZIB A;  3HKC B;  2ODM A;  3FB5 C;  2YXY A;  1QLN A;  1CPY A;  3ZIA G;  4DYL A;  1GTO A;  1WPX A;  4D7T A;  3ZN0 A;  2BOC C;  2LW1 A;  3CB2 A;  4LF5 B;  2R9A A;  1F4N A;  4YJ2 B;  4GKK B;  1H5W A;  1YTF B;  5LMN B;  3VQW A;  4UVA A;  5JJE B;  1ZUQ A;  3CC7 V;  2FL4 A;  3GWK C;  4LFB O;  4UV8 A;  3HR0 A;  2YI9 A;  4WFA V;  2ZNI A;  1K92 A;  2RCV A;  5CB4 B;  5B5E Z;  1Q82 W;  1FKA O;  4EEQ A;  5LGU A;  4DUZ O;  2UUC O;  4E4E A;  3DXR B;  3QNE A;  2W6J G;  4JI3 O;  4AI8 A;  1Z5V A;  4Q20 A;  3W7W A;  1SZT A;  3J81 N;  4RWU A;  1Q43 A;  3RYC A;  4FLU A;  5KX5 A;  1N34 B;  3DSQ A;  5KHI A;  2AHZ A;  2EUL A;  4YIP A;  2Y69 B;  2B9Z A;  3ASN C;  3U11 A;  1BGY H;  4LF7 O;  2PY5 A;  3FAV B;  4DR5 O;  3Q4H B;  3SJQ C;  1HDJ A;  1P7B A;  2YIC A;  3IAY A;  4BW9 A;  3ZHS A;  3OEE G;  1A32 A;  3P32 A;  4DUZ B;  4JYC A;  1NVP B;  1I94 B;  4UCU A;  2ZDI C;  2XAF A;  4X66 O;  4DR1 B;  3SYP A;  1I0H A;  4KHP O;  2CH7 B;  3OFN G;  1X59 A;  5L3D A;  1GK9 A;  1GN6 A;  3OTO O;  4H0L B;  1COW G;  3JAW A;  4LF7 B;  1NS1 A;  3CP1 A;  4NTY A;  5EZY B;  2XTA A;  1IX9 A;  2AZ0 A;  2H8P C;  2VWJ A;  4I4T A;  1XQ8 A;  2GHY A;  5FPR A;  3TGU H;  5LA6 B;  2JGD B;  2PF4 E;  2P4V A;  4FIP C;  2KG7 A;  4EB6 B;  3MHH C;  4GKJ O;  1EN6 A;  4WFE A;  1PNM A;  2GTA A;  5LHH A;  2X6A A;  5LOV A;  4X66 B;  2YID A;  4B3T O;  3ZRX A;  3CCR V;  2P5O A;  1BL8 A;  3OTO B;  1BHB A;  5IDJ A;  1D5A A;  3NR7 A;  3U0Z A;  2P67 A;  3J7A U;  1DF5 A;  2ZXW C;  3IJ4 A;  1QCE A;  2KKW A;  2CTP A;  4B3R O;  4FFB A;  4O2B A;  1K5S A;  5ITZ B;  4N21 A;  2HJD A;  1JR9 A;  4OPH A;  5EBM C;  1FYJ A;  2ADP A;  2EJ7 A;  2XOK G;  2EZP A;  4B3T B;  3WB0 A;  4F6R A;  3FYE B;  3OM3 B;  1N32 O;  5KAF Z;  2P22 C;  3WU2 Z;  3JAK A;  2IM9 A;  5LHG A;  3H01 A;  3T2M A;  4FLT A;  2HP8 A;  3WG7 B;  3K3W A;  2WLL A;  1VF7 A;  4ZBM A;  3ZRW B;  4B3R B;  1CEZ A;  1ZSP A;  2WSS G;  5DEC A;  4JI2 O;  4QE9 A;  3BAA A;  2Y4T A;  2Q5Z A;  5LMU B;  2WLI B;  4PHZ A;  5J2U A;  1YJ9 V;  3A0R A;  4J9Z B;  4X1I A;  2OCH A;  3SYQ A;  4JYY A;  1S5L Z;  2Q4P A;  4J7Z A;  1PP9 H;  2ZE6 A;  3ETE A;  4YJ3 A;  1WJZ A;  2IBZ H;  3STZ C;  1YJN V;  4JTA B;  2IJK A;  1AIL A;  1TGO A;  1JJO A;  1KQS U;  1OCZ B;  2AGA A;  4JZG A;  2QWN B;  1URF A;  4LF6 O;  5BMV A;  4LFC O;  3JD3 A;  1V54 B;  3CRQ A;  5JH7 B;  2HEP A;  4U7N A;  2PYJ A;  3BCC H;  3E8H A;  3RW0 A;  5C8Y B;  3OW2 U;  3A0H Z;  3K79 A;  1HR0 B;  2UU9 O;  3DGE A;  3ZN1 A;  4FZ1 A;  2N74 A;  1FXK C;  3RFR A;  3RVZ A;  5LP6 C;  4X1K A;  3J80 N;  4B3M B;  3K57 A;  3X2Q C;  4C7U A;  1EN4 A;  3IC9 A;  4DR2 O;  2F23 A;  3L73 H;  3UQ8 A;  3E22 B;  3CMA V;  1G8M A;  4NKG B;  1N0N A;  1L8D A;  1SA0 B;  3RYF B;  4J10 A;  2HKO A;  1H8E G;  4UXN A;  3W7X A;  1VEW A;  1QNM A;  4PEL A;  1GM9 A;  5BR8 O;  2BTO A;  3ASO B;  4RUF A;  1N36 O;  1S5H C;  5FL7 G;  4DV4 O;  1VQ5 V;  3LUT B;  3K9A A;  2ADQ B;  2UU9 B;  2LO1 A;  3FAV A;  4LH6 A;  4BWA A;  1VQ8 V;  2Q6A A;  4R6Z A;  1AI6 A;  5KHK A;  3R66 A;  1MSW D;  2FB5 A;  1R3K C;  5EYP B;  4DR2 B;  4HAM A;  3DTU B;  1BCC H;  3F7V C;  2OIG A;  4TV8 B;  2UXX A;  2ZE8 A;  1KUQ A;  2V1D A;  2JJ2 G;  4TWK A;  5IWA O;  4GCZ A;  3RYI B;  4MVZ A;  5BXZ A;  2JEU A;  5FNV B;  4FMT A;  1G4Y B;  4DV3 O;  4DV4 B;  3A2F A;  4NTW A;  4LF4 O;  2FYU H;  2RN9 A;  3BAB A;  4DR3 O;  3SYO A;  1DGS A;  1BE3 H;  3JAT A;  4JI4 O;  3AEI A;  2RMK B;  3CX5 F;  4EB6 A;  3AG2 B;  3RVY A;  3CCV V;  1YCI A;  4DV6 O;  1K7D A;  2PI5 A;  3QO7 A;  1IJG A;  2WPD G;  4PA6 A;  4TQF A;  5IWA B;  1Z5W A;  3JD2 A;  3OEH G;  2ZT9 B;  4B7E A;  2Y0I A;  4DW1 A;  3H9V A;  2QWP B;  4DV3 B;  4FVM A;  3BHP A;  3WB2 A;  4X89 A;  2QKS A;  3WFV A;  2DYR C;  4JYA O;  3T4Z A;  2GUZ A;  3U10 A;  4MW3 A;  1EN5 A;  3E8G A;  3BRC A;  3RT3 C;  1PL0 A;  4DRX A;  3VQY A;  1VIB A;  4X8A A;  1GN3 A;  1HNW O;  3ZCC A;  1YTF D;  1H2M A;  2ZD9 A;  4NYK A;  2BCC H;  4JF3 A;  4CH5 A;  1VF5 B;  1FS0 G;  4DR7 O;  1HWY A;  2GBO A;  1JMK C;  3RBZ A;  4O2A B;  2QTS A;  1M93 A;  1WAZ A;  2R9I A;  2Q8V A;  2BOB C;  5FLX N;  5DED A;  4FM1 A;  5KUM A;  4CC6 A;  1XHZ A;  2QA4 V;  2JDI G;  4UB6 Z;  3AK1 A;  4J42 A;  4R50 A;  3RYH A;  1PNK A;  2F66 C;  3ZED A;  3VBB A;  5D5P A;  4I0X B;  4PA4 A;  4BAY A;  4O4I A;  3UT5 B;  1I5X A;  3K0D A;  3HKB B;  4DR7 B;  1EM1 A;  1OV9 A;  2HHH O;  2FKX A;  1BQ0 A;  5KMG A;  3QO5 A;  3OTF A;  3E2E A;  4BIZ A;  3CE2 A;  4I55 B;  4LCU C;  2GV9 A;  4PA7 A;  3LSQ A;  5JVD A;  2EIJ C;  2QR4 A;  4ZHQ B;  2JJ1 G;  1LR1 A;  4WBN B;  1NVP D;  3JAL B;  4JI5 O;  2DYS B;  2Q7G A;  2C2A A;  1AI7 A;  3OMI B;  2E3C A;  3CCS V;  4K0K O;  5JWP A;  3K5M A;  5H2F Z;  1H38 A;  2HHH B;  4YIO A;  1KD1 W;  4U3J B;  2EIK B;  3OT7 A;  1BZK A;  4I5S A;  1JNB A;  4A5U B;  1W2B U;  4DV0 O;  1OCO C;  1OCR C;  1RSO B;  1IUR A;  2KQX A;  2RJZ A;  3IC7 A;  3ETQ A;  5IJ9 A;  4DO2 A;  1UFI A;  2LFR A;  3QF7 A;  1KKC A;  5LXT A;  3T1H O;  4G2K A;  2CE4 A;  2PUS A;  1JA8 A;  3HPL C;  3SYC A;  1W0J G;  1D2D A;  4FFK A;  3G67 A;  4GX1 A;  3RYF A;  4I50 B;  1Q81 W;  1VQM V;  4K35 A;  1TUE B;  3ABU A;  4DV0 B;  3SDL A;  3LSS A;  3CRC A;  4JI8 B;  1FJG O;  2B1G A;  5LYJ A;  1M9N A;  3WG7 C;  3CXC U;  2X6C A;  3ZBH A;  4D6T H;  2G38 A;  3E35 A;  4KL1 A;  3T1H B;  5EYP A;  3CCQ V;  1KB9 F;  5EIB D;  4U7O A;  3EFF K;  1K9M W;  1SQG A;  2BE3 A;  4RAI A;  3ZRS A;  5F2V O;  4HBN A;  4G28 B;  2ARH A;  1HP8 A;  2JVD A;  3CRA A;  4UCV A;  2CK3 G;  1VQL V;  1MNG A;  1H2L A;  2IU0 A;  4J11 A;  5EK0 A;  1Y74 A;  1CXZ B;  4QPK A;  5FNV A;  3CCE V;  2KB1 A;  3H1K H;  2A06 H;  2WLK A;  4DV5 O;  3LDC A;  5K1P A;  1FJG B;  1US6 A;  2MW2 B;  1BT8 A;  3PJS K;  2BSK A;  4AIL C;  2ZDI A;  4JI1 O;  2E74 B;  1TUB B;  4X62 O;  4JYB A;  1XI1 A;  4DR4 O;  5IY5 B;  5JCO A;  2IW5 A;  1L0N H;  2HFE C;  1KKD A;  4IIJ A;  1OCZ C;  1RFY A;  1E1R G;  5K1X A;  4K8Z A;  4LF8 B;  4DR6 O;  4Q6G A;  2NR5 A;  1NU1 H;  4GX0 A;  3HKD A;  2VS0 A;  1AR1 B;  2QGN A;  3ETG A;  1V54 C;  5CA1 A;  4X20 A;  3ZX6 A;  2K9P A;  4R7C A;  1B04 A;  3B40 A;  2Q73 A;  3APO A;  4JI1 B;  2Q0O C;  4AHC A;  3L9D A;  4XDK A;  4YHH O;  1SZX A;  4J9Y B;  2F4V B;  2EJR A;  4X62 B;  2OWO A;  2UXB B;  2XAS A;  4H37 A;  1XL6 A;  3ML0 A;  4NXN O;  5CBG A;  2A79 B;  1XBL A;  1VF6 C;  4TQD A;  2DMX A;  3LNM B;  3C90 A;  2DQ0 A;  1BS3 A;  1FXH A;  5D5Q A;  4DR6 B;  4UVB A;  1QBZ A;  3ZRV A;  3ASO C;  1QVG U;  1NR1 A;  2IJJ A;  4K8X A;  1NBM G;  1OJH A;  2CTR A;  1L0L H;  2EIM B;  4GX5 A;  4YHH B;  3D36 A;  3JD4 A;  1ZWI C;  4O4J B;  4NXN B;  3CC4 V;  1H2G A;  2Z5U A;  4ZOL A;  4LFB B;  3SPC A;  1MA1 A;  1Z2G A;  2ZIM A;  4TV9 A;  3HKE A;  3CYO A;  5B1N A;  1XL4 A;  4FLX A;  3BPZ A;  3ABK C;  1XRE A;  1P84 F;  3UO2 A;  1K34 A;  2WA4 A;  5CBF A;  2UUC B;  1JQ0 A;  2F1M A;  4JI3 B;  2QJ1 A;  1S0V A;  3G4S V;  4H44 B;  4IHJ B;  5B3S C;  3MD0 A;  4GYC B;  1VQN V;  3H1J H;  4MTO A;  1VQ4 V;  4F6E A;  5JCO C;  2BTQ B;  3MAQ A;  3AG2 C;  4JAV A;  1RM1 C;  1TVK A;  3FB7 C;  4ZKI A;  5IYZ B;  4DR5 B;  1CP9 A;  3CHX A;  3W7U A;  2YIA A;  1S77 D;  3JAS B;  2YDE A;  1Q3E A;  4KUM A;  4PV1 B;  3G80 A;  1DLB A;  1VP7 A;  1QU7 A;  2YI8 A;  2UXN A;  1YIJ V;  1B06 A;  3DC6 A;  3T1C A;  1FFX A;  1FOU A;  1GM8 A;  2IJH A;  2V4D A;  2R70 A;  4KHP B;  3HB3 B;  5B1A C;  1M5I A;  1PL4 A;  3EXA A;  2JS5 A;  3AG1 C;  1S3J A;  1RPR A;  3BEH A;  1FFT B;  1K8A W;  4D7S A;  1M57 B;  1UPG A;  4FM2 A;  1FXK A;  1YXB A;  4MTX A;  3N2K A;  5LP6 A;  5EC2 C;  1QHT A;  3T1Y O;  5IJ0 A;  4ZI7 B;  4GKJ B;  3SPH A;  2CGO A;  2DW4 A;  4O4L A;  2L35 A;  4MVQ A;  3CCU V;  3DC5 A;  3D36 C;  1N0J A;  3CCJ V;  4DK0 A;  3JCU Z;  4QGP A;  1VQO V;  2A7W A;  4BIO A;  1GAX A;  5E1A C;  3FX7 A;  4WCE V;  4LNU A;  1PNL A;  4Z1M G;  1Q90 D;  3T1Y B;  4TSF G;  2A0L A;  3H1I H;  4JV5 O;  1QLE B;  4XBF A;  2XHB A;  3TET A;  4PI2 A;  1ZL8 B;  4PD4 F;  2UUA O;  4O4H B;  1GKF A;  1SQB H;  5CA0 B;  2DJV A;  1N32 B;  4P9P A;  4X1Y B;  3N2G A;  1AP5 A;  3WB1 A;  1WNS A;  2F43 G;  1YI2 V;  3JSN A;  1BMF G;  2A3Q A;  4NTX A;  3HKC A;  3F7Y C;  4UUJ C;  2EIK C;  1WB7 A;  4JV5 B;  5BZB A;  2ZIO A;  3TXS A;  1AP6 A;  4JI2 B;  1M1K W;  1RP3 B;  1Q86 W;  4NB5 A;  4WFG A;  2UUA B;  2RDC A;  2O57 A;  4MVU A;  1K33 A;  3G71 V;  1AJQ A;  1SS3 A;  4YJ2 A;  1M56 B;  4LWS B;  2M6Y A;  3ZJZ A;  3NXS A;  1N8R W;  1GMG A;  2NNU A;  1VQP V;  1NH2 B;  2QKC A;  5J9P C;  1XDC A;  1SF9 A;  1YSC A;  1GN4 A;  5CB4 A;  1DTO A;  3ABM B;  4N23 A;  4FM0 A;  4MVS A;  1WN7 A;  4QIW F;  1R73 A;  2DQ3 A;  1XMO O;  2JIZ G;  3OD4 A;  1Y67 A;  2YSU B;  5A2Q N;  2QDO A;  1MAB G;  3DXR A;  4LF6 B;  4LFC B;  1QQC A;  3THO A;  2MK3 A;  1GH6 A;  4O4J A;  1XIL A;  2OCC B;  4EFB A;  2P90 A;  1WA8 B;  1AB3 A;  4KP4 A;  1MOF A;  3Q4H A;  4DV2 O;  5J2T B;  1SQP H;  2EIL B;  4FZ0 A;  4I9W A;  4PDR A;  3LNN A;  4MTF A;  2YS8 A;  1XMO B;  1JPX A;  1Y76 B;  3IFX A;  4IHJ A;  2PTM A;  1BSM A;  4HNA B;  5BR8 B;  2N04 A;  1OCC B;  1SER A;  2A9H A;  3SR2 C;  2CH7 A;  2PI4 A;  1N36 B;  5EZY A;  3CEI A;  1PKX A;  3O65 A;  1PPJ H;  2PGG A;  4DV2 B;  1IBK O;  5LA6 A;  2JGD A;  3B8N A;  2QEX V;  1NKD A;  2WLM A;  1YHQ V;  4PA9 A;  5A9G A;  3E8B A;  4X88 A;  2VQE O;  1VQ6 V;  1SKV A;  2W0X A;  3A8T A;  3H1L H;  2D2C B;  1O9G A;  4X65 O;  4PJ0 Z;  5L3B A;  3GWO A;  3A0B Z;  2HJF C;  3K03 A;  3G6E V;  1IDS A; 
#chains in the Genus database with same CATH homology
 1AR4 A;  1BS3 A;  1MMM A;  1XDC A;  4YIP A;  3EVK A;  2P4K A;  4BR6 A;  1GN4 A;  3TJT A;  4JZ2 A;  1LUV A;  2ADQ B;  3AK1 A;  1D5N A;  1Y67 A;  1IXB A;  1I08 A;  1ZSP A;  3DC5 A;  1N0J A;  3KDR A;  4X9Q A;  1XIL A;  1WB8 A;  1MSD A;  1MA1 A;  1I0H A;  1MNG A;  1EM1 A;  1GN6 A;  3K9S A;  3MDS A;  1XRE A;  1IX9 A;  4JYY A;  1XUQ A;  3QVN A;  1BT8 A;  4GUN A;  2GDS A;  3C3T A;  1EN6 A;  5AG2 A;  1BSM A;  3KKY A;  1VAR A;  4F6E A;  1AP5 A;  4JZG A;  1ZUQ A;  2CDY A;  1ZLZ A;  3LSU A;  4YIO A;  3OT7 A;  3CEI A;  1AVM A;  2AW9 A;  3RN4 A;  2RCV A;  1WB7 A;  3AK3 A;  1ZTE A;  1AP6 A;  3BFR A;  1B06 A;  3DC6 A;  1PM9 A;  1EN5 A;  5A9G A;  4C7U A;  2QKA A;  3AK2 A;  1JR9 A;  1EN4 A;  1SZX A;  3IC9 A;  2ADP A;  3C3S A;  1KKC A;  1LUW A;  4E4E A;  1AR5 A;  2CE4 A;  1JA8 A;  1GN3 A;  1N0N A;  1GN2 A;  1PL4 A;  4FFK A;  1P7G A;  1VEW A;  1QNM A;  1IDS A;  2QKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...