2RCVA

Crystal structure of the bacillus subtilis superoxide dismutase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
AYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVADLDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFAAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDYISAFWNVVNWDEVARLYSER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bacillus subtilis superoxide dismutase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 69
structure length 200
sequence length 200
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2rcvA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2rcvA02
1VARA 3TJTA 2ADQB 3EVKA 3RN4A 1GN2A 1ZUQA 1ZSPA 3MDSA 2QKAA 1P7GA 2P4KA 2CDYA 1IXBA 1SZXA 4JZGA 2AW9A 1QNMA 1BT8A 1JR9A 1XREA 4GUNA 3AK3A 4X9QA 1AVMA 1JA8A 1EN6A 1XILA 3OT7A 1LUWA 3BFRA 2ADPA 1KKCA 1ZLZA 3AK2A 3DC6A 3LSUA 1D5NA 1BS3A 1IX9A 1EN5A 1B06A 3IC9A 4BR6A 1EN4A 1PM9A 3C3TA 3DC5A 1EM1A 1I08A 1MA1A 1N0JA 1PL4A 3CEIA 4FFKA 1BSMA 1AP5A 1MSDA 2QKCA 3QVNA 1I0HA 4JZ2A 1GN3A 3KKYA 1VEWA 4YIOA 1AP6A 2GDSA 1GN4A 1N0NA 4YIPA 1AR5A 3AK1A 1XUQA 1GN6A 4E4EA 1WB7A 1LUVA 5A9GA 2RCVA 1WB8A 4F6EA 1AR4A 1Y67A 5AG2A 1ZTEA 2CE4A 3C3SA 1MNGA 1XDCA 4JYYA 1MMMA 3K9SA 1IDSA 4C7UA
chains in the Genus database with same CATH superfamily
2YI8A 5B3SB 1O9HA 4B7KA 4ICGA 4O2AA 4TWKA 1XMOO 4X1IB 3MDSA 4X1KB 2ZKOA 2AHYA 4OGQB 5J2TA 1XMQB 3OR6C 2YEVB 3K59A 4K0KB 4J42A 4F6RA 4JI8O 5DM6V 2ZCEA 4BW5A 1IJGA 1FXKB 4LNUB 1BHBA 2QEXV 3AG1C 4XDLA 1J95A 2VWKA 4IHJB 1PNMA 5CMUA 2P7TC 1T5EA 3ZBHA 1XQ8A 3DC6A 3D3IA 5FLXN 1E79G 5L3BA 3CCMV 4FIPC 5IYZB 2A06H 1ORQC 5JJNB 4FLUA 4UB6Z 2OWOA 2QWQB 4Q6GA 2B9ZA 3H1JH 4UV8A 1R1BA 1KC8W 1I08A 3OUSA 4O2AB 4UVAA 1H38A 1H2SB 1NTZH 3OM3B 4TV8A 3A0HZ 1SZTA 5LBQA 4LWSB 3ZHUA 1Y76A 4WFHA 3BEHA 4UCOA 5KHGA 5EBMC 1JJ2U 4FMTA 1I5XA 3LNMB 2HLDG 2P5OA 4YIPA 1AR5A 4DR2B 4ZBMA 4J11A 4B7EA 2Q0OC 4I55A 2JEXA 3RYIA 2PY5A 4UUJC 4JI3B 1Y67A 2Y69C 2DYRB 1THZA 1S72V 2UXDB 3W7SA 3B40A 1FD9A 1KYOF 2N74A 1YCIA 4DV4B 1GRJA 5BXZA 1RSOA 3K9SA 1FXKC 3CCSV 1V55B 4BW9A 1WA8B 4I0XB 4U3JA 2ADQB 1VIBA 4GX2A 2EIKB 2K9PA 5B1NA 3CRMA 1BCCH 1G1XB 3T4DA 4JYAB 3SPGA 1K4CC 1SQPH 4DR1O 2NNUA 3SYAA 3N2KB 1IURA 1AJPA 1PP9H 3G67A 2WLJA 1S5JA 4YJ2A 1MZEA 3ZMZA 1YJWV 1RFYA 3OUFA 4AQYB 5JCOA 2GUZA 3JARA 1M9NA 1VF6C 2GSMB 5IY5B 5BZBA 4DR6O 4YJ3A 1IX9A 2WLHA 4U3FH 2HKOA 1OCRB 3SPHA 4OX9B 1SETA 2IBZH 1V54C 1VP7A 2XHBA 1WPBA 5H9CA 2JGUA 2JGDB 2QKCA 2VS0A 1M57C 4L87A 1SESA 3HKDA 1IBLB 1TAEA 2CH7A 4CZZA 2PYJA 3THOA 1Y4MA 5JVDA 1Q90D 2PTMA 3F5TA 1VQ4V 4J80A 1NR7A 1VQ6V 3CCEV 1DK1A 5KMGA 2WLIA 4HAMA 4K0KO 4XBFA 1GM7A 2Z3YA 2YIBA 1SQGA 1SRYA 5CB4B 2CTRA 4TV9B 3GWOA 4DV6B 2JGDA 4AI8A 4KXRA 4FLZA 1MNGA 3K0DA 4YJ3B 1MMMA 3JD0A 4DK1A 2WA4A 2AZ2A 4FPPA 5EBWC 4NXNO 2M7WA 3ABTA 3E8BA 3JAKB 2P6JA 2Q0AA 1NR1A 4RUFA 3FYEB 5EK0A 1SS3A 1H8EG 3R66A 3L72H 2JJ2G 1QU7A 3VQXA 4DV2B 3JASB 4EEQA 4JYAO 4X1IA 4B3TB 2EILC 5FPOA 3AEIA 2QGNA 2EZPA 2OIGA 1TGOA 1SERA 2GV9A 4MVQA 5CA0A 3OE7G 2Q9LA 4LF5O 2UU9B 2E5LB 3MAQA 4DV4O 1DGSA 2HJFC 1XEQA 3ETGA 3SYQA 4LF8B 1Q6IA 3CSXA 1RM1C 2V4DA 2VQEB 1N32B 4H33A 1M4UA 2ZNIA 1B06A 1NTKH 1IZ3A 3HB3B 1M56B 4GX0A 3D36C 2XT9A 5LOVB 4U7NA 2FMLA 1BGYH 3CYOA 1MSWD 4CH5A 4GLXA 4DR2O 1Y66A 3CEIA 5IYZA 3QO5A 2V1DA 4LP8A 2DYSB 1FXHA 1VEWA 3LDDA 3A0RA 2AHZA 3K57A 4YHHB 1TVKA 2OCCB 5LYJA 3STLC 4DW0A 2B5UA 5JQGB 1NBMG 3JD4A 1R3JC 4NVPA 3LDEA 4DR4B 1GM9A 4DR7O 2WPDG 2WSSG 3SJCC 5EYPB 1AI5A 4X89A 3H01A 4LF6O 2XAQA 3S3WA 1OCOC 4I50A 5J2TB 3TXQA 4BIZA 1LR1A 2KG7B 5IJ9A 2A3QA 4TUYB 3N2GB 4FJCC 1JPXA 1XDCA 3K79A 4GKJB 1VF5B 1IDSA 1HNZO 4X1YA 1SQFA 4PHZA 2P4VA 2AZ0A 3CMAV 5LHGA 2CUGA 4X20A 3HKCB 4RO2A 3UM7A 3ZHRA 5JJEB 2IJKA 2UXNA 1SQBH 1XMOB 3FB5C 2A7WA 4FVMA 3CWBH 1QHTA 1AVMA 2Y48A 1EN6A 3RYCA 2DWEC 5GONB 3VQVA 4YY3O 1Q7YW 2X6BA 3CMEV 3EHBB 1AJNA 2FB5A 4JAAA 3AK2A 2GBOA 2QKSA 3LSUA 5FPRA 2EIKC 4W4KA 1RPRA 4LF4B 1I94O 2EIJC 3IC9A 4MVZA 3STZC 4H0LB 2YIDA 1OCOB 2GTAA 1URFA 1YIJV 5EZYA 1PKXA 4AILC 1JX9A 2QR4A 3P32A 4YHHO 3CCVV 1FKAO 1IBMO 1HNWB 2KKWA 1M1KW 1MZFA 2QWOB 3AK1A 3K08A 1BZKA 1YZBA 1WB7A 3QTCA 1WB8A 4OPHA 1SA0A 1NU1H 4R8CA 1QLNA 4ZHQB 5LGNA 1FPOA 1W2BU 5IT9N 2ZDIA 5AG2A 4JI0O 1AILA 1NH2D 3RVYA 3CRCA 3K0GA 4IIJB 2Y0PA 4JYYA 1GH6A 2EINB 3K9AA 4EFEA 3K3WA 3T4ZA 1K5SA 4K8ZA 1K34A 1PPJH 3CXCU 3RYHB 4BIOA 1GAXA 4O4HB 5CBHA 4PDLA 3E2EA 1AI7A 2ZDIC 2LP7A 4JAVA 2X6CA 4RAIA 3ZMTA 4NKGB 4MTOA 4JZGA 1FJGO 5B1OA 4HBNA 4UCSA 4J9ZB 3D3QA 3ETDA 1FAFA 1HP8A 1K92A 4WBNA 2IJIA 1VQ9V 4DV0O 2QTOA 3ASOB 4TQFA 1JNBA 4LFCB 3UO2A 1FFXA 2DOSA 2XAJA 4FM2A 1YJNV 3WB1A 5CN0A 4I9QA 4JI2O 3JAMN 3AG2B 1IXMA 4ZI7A 3G6EV 2EILB 4NXMO 4L8JA 5L3CA 3N27A 1P4RA 3CC4V 3W7XA 5HFLA 2DE0X 3NR7A 2EX3A 3APQA 1NS1A 1R3IC 3AG7A 4X65O 3QVNA 4MVRA 4PDMA 1Y74B 4UXNA 2KQXA 1ZL8B 3QO8A 1OCCC 1RPOA 2GDSA 3B09A 1NKDA 1K9MW 2ZE8A 2VQFB 2UXBO 4JAUA 4UCRA 1I94B 1L8DA 5EYPA 1N34O 1YDXA 1R6KA 5B1AC 5J2UB 4FZ0A 3AG3C 5L3EA 1GO3F 1WJZA 1KB9F 3CPWU 4FLYA 3JASA 2EINC 2Z0AA 2YXLA 4DR6B 3J81N 2UUBB 5LP6B 2GHYA 2IJHA 1VMGA 5KHKA 5CBFA 2ITCC 2BE3A 2R9IA 5H6QA 4HNAB 4TUYA 2X6AA 3EVKA 1Z5VA 3R65A 4J9YB 5K1PA 2P06A 4KHPB 5IJ0A 5J2UA 3ABUA 3WU2Z 2ZIOA 4JI4O 4F6RB 3O65A 1R3LC 5LXTB 5C93A 1S5LZ 1K7DA 1GTOA 1XNQO 1OHHG 1NTMH 2YS8A 4RQFA 2ZM6B 4ABMA 3ABKC 1TUBB 5F2VO 1BMFG 1K73W 1XNRB 1KKCA 3C90A 3E22B 3SYCA 5JWPA 3N2GA 1N4CA 3U11A 2XTAA 3X2QC 2ZE7A 1QLEB 4JI3O 4N21A 1AI4A 5B1AB 5GTIZ 3ASNB 3LNNA 3IFXA 1OCCB 4PI2A 4Z1MG 1DF5A 1OJHA 1NH2B 1S77D 4FFKA 5CBGA 1BSMA 2ZXWB 1AP5A 1MSDA 3ZCCA 1NZ6A 5D5QA 5LMNO 3OFNG 1AP6A 1Y74A 1J5EB 1GN4A 4GX1A 1N8RW 1Q82W 3PN1A 1XL4A 3ABKB 1K97A 3TGUH 4LFAB 4JTCB 1YTFB 3ML0A 1R3KC 3ETEA 5ITZA 5IWAB 1R6NA 3B8NA 1X59A 3GWKC 4GKKO 2UU9O 2Y0IA 1YSCA 4IIJA 4X64O 4WFGA 4Z1VA 4CBCA 2YI9A 1S76D 2R9RB 5KHIA 5LMUB 5KUMA 1K8AW 4R50A 3CRAA 3UKMA 2FL4A 4TT3G 4DUZB 1ZUQA 3IAYA 1RSOB 2ODMA 2ZINA 5KAIZ 1YTFD 1XMQO 2Y69B 5L3GA 1QLEC 2RQ6A 4NXNB 1ZAUA 3U10A 5BMVA 2UXCB 4JI1B 1RM1B 3TETA 1YITV 4EKWA 1F4NA 1QVFU 4XDKA 2DQ3A 3UO3A 3JD1A 4DV7O 3CRQA 2QM8A 4FZ1A 1IBKO 2YXHA 2PGGA 4G28B 3L9DA 5CA0B 2N04A 3K5NA 4JV5B 2DWDC 3T2MA 3JD3A 5TISZ 2CTQA 1PNKA 4JI7B 1B3QA 4E2LA 3CJHB 4CC5A 2NLJC 1SA0B 2F43G 4CC6A 2IU3A 3ZRSA 5KAFZ 2VQFO 2WLMA 1EN4A 3DSQA 3C3TA 4RQEA 5BR8B 3CS5A 4JI6O 3ZMVA 5JVDB 3K06A 2JS5A 1W0JG 3ASNC 1D2DA 4YXWG 3QG5A 4UB8Z 3JALB 2RNBA 2F1MA 4K35A 4NTWA 1H8HG 2UUAO 4X88A 5LHHA 2IJJA 1CPYA 4E4EA 4MVMA 4DV7B 1JMKC 4I4TB 2UXXA 3H9VA 3LSSA 4IL6Z 4CS2A 2BOCC 4TOIA 3CCRV 2EZOA 4JI1O 3ABMC 3ZS8C 4JI2B 1YEWA 2WA3A 2XAGA 1AR1B 2OCHA 1NT2B 4LF9O 4DV0B 4KFMA 1SQQH 3BHPA 4B3SB 2JVDA 2FKXA 2UUCO 2ZD9A 5IJ0B 4N23A 3CD6V 2Q7EA 1ZSPA 1WP8A 5LGUA 4F4LA 4LC1A 2XNDG 1OCRC 1HNZB 2EIMC 4I4TA 1PNLA 4PA7A 4I7ZB 4H44B 1JR9A 3AG1B 1KKDA 4DR3O 3K03A 4GKKB 1EZVH 2V7QG 3WG7B 4LF6B 1JVMA 4CS4A 1LNQA 1XILA 4HYOA 5IWAO 4U7OA 1HWYA 2GTSA 4QJFB 5GW7A 3QO7A 2ZQMA 2HHHB 3RYCB 1YI2V 1ZLZA 4R6ZA 2DN9A 1K33A 5LP6A 3RFRA 1J5EO 2WLIB 3D8CA 3ICXA 5LMNB 1WPXA 1PD3A 1JOYA 5FNVA 1KQSU 1IBMB 2WAMA 1KUQA 1WLEA 4O2BA 4PI0A 1Q43A 2QA4V 1TVKB 4JZ2A 4JASA 2RDCA 5L3DA 2YSUB 4H13B 4LF8O 1TA8A 1G4YB 3E86A 5KX5B 3LUTB 4XDJA 2A0LA 2E5LO 1NJIW 1XNRO 2PI4A 2KG7A 3ZMSA 5L3FA 2ZM6O 4I50B 3E8GA 2WLLB 3PJSK 1XNQB 3MD0A 3BPZA 1CEZA 2WLNA 3G4SV 1JFFA 4DV1B 4DV3B 1SQXH 2C2AA 4DV2O 3KDRA 1SQVH 2YIBD 3C3SA 1MG1A 4X20B 2F23A 2UUCB 1VQKV 2E3CA 1BT8A 1KBHA 1VARA 3B8MA 3TJTA 3SPIA 4GZRB 4O4JA 2IH1C 2HG5C 2HVJC 3KG2A 1SC5B 3Q4HA 4JGSA 2Z5UA 1BQ0A 4MTXA 1HNXB 1ZL8A 2ETNA 1SZXA 5IYCO 2ILMA 2DYRC 5GONA 4PDRA 2IW5A 1XREA 1JJOA 3HPLC 4DV6O 3B77A 4J7KA 3H1IH 2P67A 1EFRG 3J80N 3ZHVA 2UUAB 1M56C 1Z5WA 1UFIA 5CA1B 1FFXB 1WA8A 3UCSC 3OEHG 4UV9A 2IM9A 3O9OA 3TXSA 5DECA 5B1BB 4GT1A 4UVCA 4O4IB 4QGPA 4WFFA 2QWRB 4BAYA 3OMAB 5LL6Y 2DJVA 2XOKG 4DW1A 5B66Z 3TK1A 1Q6UA 3WB0A 4B3MB 1D5AA 1EM1A 4O4LB 4H37A 4CH4A 1XHXA 3EXAA 3BABA 4OX9O 2XAFA 1H2MA 4JV5O 4WFEA 1N33B 3KKYA 2PYLA 3AG4B 4I55B 2ZE6A 4FLTA 1BQZA 3JSLA 2K1EA 4ASUG 4PD4F 3P3NA 5J9PC 2YXYA 1O9GA 1KECA 4B3RB 4LF5B 1ZTEA 3SDLA 3HKBB 3I5DA 4QIWF 3T1CA 4C7UA 3S3XA 3AG3B 4QE7A 4WF9V 2AGAA 4G2KA 1UPGA 5EC2C 3E8HA 5D5PA 5DEDA 4ZKIA 2F93B 5B3SC 2LJ2A 2B1GA 3HKEB 2D2CB 4X64B 1VQNV 2R9AA 2WWWA 2VRZA 4TV9A 2UXDO 2JRIA 4JI0B 1M90W 2W6JG 4GYCB 1OCZC 1KP3A 1Y76B 2JDIG 1GMGA 3L75H 3OGIB 1QR9A 2Q73A 4HZ3A 2F66C 2QE7G 3T1YO 3FFQA 1N33O 4MTGA 2CK3G 4AHCA 1B6QA 4DR5O 1Q81W 3M8AA 5EBLC 1F7YA 1BS3A 2LW1A 2Q8VA 1M93A 2DYSC 3K04A 4FK5C 4ZI7B 5KA5A 3SJAC 3ASOC 1MA1A 2E74B 3ABMB 1MABG 1QR8A 3CXHF 4LF4O 1IBLO 1GK9A 2XASA 1RP3B 1H2NA 5FNVB 1YJ9V 4DRXA 4J10A 1S3JA 1FXVA 5BMVB 3IJ4A 5JH7B 3AG4C 1VF6A 1DF4A 2B1IA 3L74H 1AR4A 3CCJV 1NI8A 1DLBA 4J41A 2QJ1A 3ZHSA 1HNXO 2H3OA 4P9PA 4WCEV 3RVZA 2ZIMA 4KHPO 4WBNB 2ZR3A 3CCLV 4PA3A 2QTSA 3L71H 5H6RA 2EJRA 3T1YB 3AG2C 1AROP 3KZIZ 4PV1B 2Q4PA 4K3AA 1NQTA 4P30A 5B5EZ 3U0ZA 4DR1B 5E1AC 3JARB 1CP9A 3UQ8A 3ETQA 4EB6A 4D6TH 4DV1O 5GTHZ 2YIAA 5EC1C 3BAAA 4GKJO 2RN9A 1EZJA 2P90A 2MW2B 1OCZB 1AJQA 3L73H 3A2FA 2BTQA 5KX5A 3Q4HB 1TUBA 2W0FC 1WP7A 3T1HB 4LBEC 1I5YA 3OT7A 2CGOA 2CH7B 4LF7O 3P30A 2BSKB 2ITDC 1JFFB 5LOVA 2Q7GA 3G6BA 5KMGB 1Q6HA 1US6A 1D5NA 4X62B 3UT5A 1U97A 2WLLA 4O4LA 2JEUA 4LH7A 1N0JA 3JYCA 4NXMB 3RT3C 2ZT9B 4J7JA 4O4IA 2XUMA 2JJ1G 2BTOA 3JCUZ 4PA6A 1XHZA 1NVPB 3OTFA 3CRRA 3ZEDA 2VQEO 1N32O 3SYPA 2BSKA 4IHJA 2NR5A 5IDJA 1N0NA 4P2ZA 4QPKA 2QDOA 3H1KH 4DR3B 2RCVA 2JIZG 2EIJB 1K3EA 5LA6B 1BE3H 2W0XA 3P3PA 3K5MA 3FD9A 1AI6A 1W59A 1G8MA 3SR2C 3A8TA 2F95B 3ZHQA 3KCXA 3OR7C 3JATA 2D3OW 3F7VC 4LFBO 4Z2WA 1XI1A 3ZRWA 3RGBA 3FB7C 3MHSC 1YHQV 2QM7A 2LGQA 2F4VO 2R70A 4D7SA 5JJJB 3J7AU 3F5WC 3RYIB 1P7GA 4FLWA 4PDVA 3I55V 2FYUH 2E76B 2F4VB 4UVBA 2H94A 4QNHB 1Q3EA 1YVWA 2BTQB 1XL6A 3RW0A 5DN6G 1JA8A 3OEEG 1L0LH 5IYDO 1LUWA 1M5IA 5E79Z 2FTKA 2YICA 4IGGA 1R6TA 2ADPA 1IVSA 1K5QA 5A2QN 1S0VA 4MVUA 4NTXA 2N05A 1COWG 1EN5A 4MTFA 4W4LA 2QWNB 3ZMUA 3ABLB 1PM9A 3DC5A 1TUEB 3N2KA 2OCCC 3ZX6A 1VQOV 4JTAB 3IC7A 1XBLA 4DXWA 4YY3B 4ZHQA 3BCCH 3A0BZ 2KB1A 4TV8B 1V55C 1GN6A 2NN4A 3OAAG 2PUSA 4NYKA 4DRXB 1U96A 2UXCO 2A79B 2HEPA 2Q67A 4JI5O 5EIBC 3W7TA 1K4DC 3CCUV 1HR0B 4I5SA 4JYCA 4OPAA 2QSAA 2CTWA 2HHHO 4DUZO 1JQ0A 3OD4A 2XAHA 4UCTA 3RBZA 3OTOO 2VWJA 3RYFA 2CAZC 1VQLV 4PA9A 2E75B 2QKAA 3E35A 2OTJV 1IXBA 1ZWIC 1UJWB 1QNMA 1VQ8V 1WNSA 3K5LA 1ENVA 4DV5O 1H5WA 2Q5ZA 1BHAA 4DUYB 4LNUA 2PZSA 4BWAA 4GCZA 2RMKB 3K58A 4JPRA 5KUKA 3JALA 4HNAA 4LH6A 3B2EE 2LO1A 4JI5B 3ZJZA 2EIMB 1PL0A 4MVSA 3NXSA 2AXTZ 3ZHTA 3OW2U 4LR3A 3LDCA 2ZXWC 4IT5A 3E8FA 2RJZA 4LWSA 2X7RB 4EB6B 4UCUA 4A5UB 2IH3C 3JAWA 3DXRB 3K5OA 1GN3A 3HKEA 2A9HA 4Q20A 4YIOA 2Q7HA 3HKDB 2ZE5A 5EIBD 4O2BB 4RWUA 3CE2A 4ZOLA 2BOBC 4O4HA 3OMNB 3GVMA 1XUQA 3SYOA 1L1FA 2Q68A 3SPCA 4X66B 1FYJA 5CA3A 2EULA 4NR1A 2JS3A 1WN7A 4JI4B 2H8PC 2L6LA 4DYLA 3BY6A 4TQDA 4JI7O 1E1RG 1VQ5V 1P7BA 1OV9A 3KCYA 4FFBA 4PELA 5FL7G 1GM8A 3HKBA 4D7TA 4JF3A 4KUMA 2IU0A 3FKSG 1N36O 1N36B 1KD1W 2OTLV 1CXZB 1Z2GA 5LGTA 5H5NA 3DXRA 3CX5F 2O57A 3VQYA 3CHXA 3APOA 5C8YA 2LFRA 4UCVA 4DO2A 2HFEC 4X9QA 3E22A 4PA4A 3WB2A 4CH3A 4FFBB 1SKVA 4X1YB 3ZN1A 3BFRA 1H2LA 3ZRVA 4X66O 3ZIAG 5LMUO 3SJBC 4ZIBA 1JCHA 3M99B 4MS2A 2HP8A 3HR0A 4MW8A 5K1XA 2MK3A 5CA1A 5IE9A 5LA6A 4RUEA 5KHJA 1KP2A 1MOFA 3RYHA 1AB3A 3VBBA 4GX5A 4LFAO 5IYBO 1FXKA 2OIEA 2Q6AA 3L70H 4AQYO 4P9OA 4CH6A 2ARHA 2Y4UA 3BA9A 4LFCO 3BA8A 1GKFA 3ZRWB 5HFMA 1LUVA 4QPJA 4MVOA 2QWPB 5A9GA 2QM4A 4B3MO 3QF7A 4G27B 3CJHA 4F6EA 1M57B 5LYJB 2GUZB 2LW7A 3FAVA 4DUYO 4MT8A 4DV5B 2JK5C 3EFFK 2EJ7A 3SPJA 3T1HO 4MW3A 2LFSA 1DTOA 3H1LH 3CCQV 1QBZA 2X0LA 3OTOB 3QNEA 2ZNJA 2W6IG 3RN4A 4DK0A 1GN2A 1P84F 2P4KA 2CDYA 3WG7C 4OXSA 4X1KA 2AW9A 1HR0O 3D36A 1ZX3A 1Y6XA 4LCUC 1OZ0A 1KU9A 3OMIB 2L35A 2CGNA 3M7MX 1WAZA 1VF7A 4R7CA 2PI5A 1YXBA 5LHIA 1EBOA 4NB5A 5H2FZ 3DTUB 3VOUA 3JSNA 4QE9A 3I56V 2EBOA 1I7FA 4DV3O 2UUBO 1Q86W 1B04A 5ITZB 1H2GA 1L0NH 1G6UA 4BR6A 3VQWA 3JATB 2DQ0A 2ATKC 3JAKA 1N34B 2HVKC 4BIUA 3RYFB 3X2QB 4TSFG 1ROPA 3MHHC 2UXBB 3FX7A 3CB2A 1E1QG 4WFBV 3BVOA 2YDEA 3GB7C 5JQGA 5EZYB 2LQTA 1W0KG 5IY5C 5LXTA 1F4MA 4B08A 2LGWA 4X65B 2CTPA 4JI8B 3SGIA 2Y4TA 4X8AA 1VQMV 2M6YA 2YC0A 4IYIA 3G71V 4WFAV 4DR5B 3E89A 4FM1A 3G80A 1NVPD 5BY1A 1FOUA 1V54B 5JH7A 3RWRD 4I0XA 3BRCA 4FM0A 3DGEA 1A32A 4IYHA 2OYQA 2KSDA 4J7ZA 1P49A 3SJQC 5KLVH 2WLKA 3CC2V 1Q8IA 4KL1A 1S5HC 4JYBA 3TCUA 3FB8C 4LFBB 4MSWC 3JD2A 4I9WA 5LP6C 2HJDA 1YF2A 2DW4A 4YJ2B 1Q5OA 1FJGB 4EFBA 4GUNA 4ZOLB 4DR7B 1PV0A 3AK3A 3WFVA 1FS0G 3LSQA 4DR4O 1SF9A 3B4SA 3JAWB 3W7WA 3FB6C 4NTYA 3FYIB 1H2KA 3ABLC 1QCEA 4B3SO 5KHHA 2OT5A 1HDJA 3UT5B 1HW7A 4LF9B 2HR3A 3ZN0A 1R73A 4O4JB 4B3RO 5IJ9B 3IGAC 1VQPV 1QVGU 1QQCA 5JCOC 1XOUA 3H1HH 3ZRXA 4UFZA 1BL8A 2G38A 1V9PA 1F51A 1PL4A 3HKCA 2Q69A 3OGCC 2P22C 1I0HA 3F7YC 4X62O 4CS3A 1KMIZ 1HNWO 2DMXA 2YEVA 3JCZA 5KA6A 5C8YB 5CB4A 5B1BC 4K8XA 3CP1A 4JI6B 4FLVA 5BR8O 1F23A 4LF7B 2PF4E 2ZR2A 4B3TO 2YUAA 1VQ7V 3E83A 2R72A 2BCCH 4KP4A 1FFTB 4JTDB 2CE4A 1X4TA 4PJ0Z 3W7UA 4FLXA 3CC7V 3FAVB 4U3JB 1IBKB
chains in the Genus database with same CATH topology
1VARA 3TJTA 2ADQB 3EVKA 3RN4A 1GN2A 1ZUQA 1ZSPA 3MDSA 2QKAA 1P7GA 2P4KA 2CDYA 1IXBA 1SZXA 4JZGA 2AW9A 1QNMA 1BT8A 1JR9A 1XREA 4GUNA 3AK3A 4X9QA 1AVMA 1JA8A 1EN6A 1XILA 3OT7A 1LUWA 3BFRA 2ADPA 1KKCA 1ZLZA 3AK2A 3DC6A 3LSUA 1D5NA 1BS3A 1IX9A 1EN5A 1B06A 3IC9A 4BR6A 1EN4A 1PM9A 3C3TA 3DC5A 1EM1A 1I08A 1MA1A 1N0JA 1PL4A 3CEIA 4FFKA 1BSMA 1AP5A 1MSDA 2QKCA 3QVNA 1I0HA 4JZ2A 1GN3A 3KKYA 1VEWA 4YIOA 1AP6A 2GDSA 1GN4A 1N0NA 4YIPA 1AR5A 3AK1A 1XUQA 1GN6A 4E4EA 1WB7A 1LUVA 5A9GA 2RCVA 1WB8A 4F6EA 1AR4A 1Y67A 5AG2A 1ZTEA 2CE4A 3KDRA 3C3SA 1MNGA 1XDCA 4JYYA 1MMMA 3K9SA 1IDSA 4C7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAR A;  3TJT A;  2ADQ B;  3EVK A;  3RN4 A;  1GN2 A;  1ZUQ A;  1ZSP A;  3MDS A;  2QKA A;  1P7G A;  2P4K A;  2CDY A;  1IXB A;  1SZX A;  4JZG A;  2AW9 A;  1QNM A;  1BT8 A;  1JR9 A;  1XRE A;  4GUN A;  3AK3 A;  4X9Q A;  1AVM A;  1JA8 A;  1EN6 A;  1XIL A;  3OT7 A;  1LUW A;  3BFR A;  2ADP A;  1KKC A;  1ZLZ A;  3AK2 A;  3DC6 A;  3LSU A;  1D5N A;  1BS3 A;  1IX9 A;  1EN5 A;  1B06 A;  3IC9 A;  4BR6 A;  1EN4 A;  1PM9 A;  3C3T A;  3DC5 A;  1EM1 A;  1I08 A;  1MA1 A;  1N0J A;  1PL4 A;  3CEI A;  4FFK A;  1BSM A;  1AP5 A;  1MSD A;  2QKC A;  3QVN A;  1I0H A;  4JZ2 A;  1GN3 A;  3KKY A;  1VEW A;  4YIO A;  1AP6 A;  2GDS A;  1GN4 A;  1N0N A;  4YIP A;  1AR5 A;  3AK1 A;  1XUQ A;  1GN6 A;  4E4E A;  1WB7 A;  1LUV A;  5A9G A;  2RCV A;  1WB8 A;  4F6E A;  1AR4 A;  1Y67 A;  5AG2 A;  1ZTE A;  2CE4 A;  3C3S A;  1MNG A;  1XDC A;  4JYY A;  1MMM A;  3K9S A;  1IDS A;  4C7U A; 
#chains in the Genus database with same CATH topology
 2YI8 A;  5B3S B;  1O9H A;  4B7K A;  4ICG A;  4O2A A;  4TWK A;  1XMO O;  4X1I B;  3MDS A;  4X1K B;  2ZKO A;  2AHY A;  4OGQ B;  5J2T A;  1XMQ B;  3OR6 C;  2YEV B;  3K59 A;  4K0K B;  4J42 A;  4F6R A;  4JI8 O;  5DM6 V;  2ZCE A;  4BW5 A;  1IJG A;  1FXK B;  4LNU B;  1BHB A;  2QEX V;  3AG1 C;  4XDL A;  1J95 A;  2VWK A;  4IHJ B;  1PNM A;  5CMU A;  2P7T C;  1T5E A;  3ZBH A;  1XQ8 A;  3DC6 A;  3D3I A;  5FLX N;  1E79 G;  5L3B A;  3CCM V;  4FIP C;  5IYZ B;  2A06 H;  1ORQ C;  5JJN B;  4FLU A;  4UB6 Z;  2OWO A;  2QWQ B;  4Q6G A;  2B9Z A;  3H1J H;  4UV8 A;  1R1B A;  1KC8 W;  1I08 A;  3OUS A;  4O2A B;  4UVA A;  1H38 A;  1H2S B;  1NTZ H;  3OM3 B;  4TV8 A;  3A0H Z;  1SZT A;  5LBQ A;  4LWS B;  3ZHU A;  1Y76 A;  4WFH A;  3BEH A;  4UCO A;  5KHG A;  5EBM C;  1JJ2 U;  4FMT A;  1I5X A;  3LNM B;  2HLD G;  2P5O A;  4YIP A;  1AR5 A;  4DR2 B;  4ZBM A;  4J11 A;  4B7E A;  2Q0O C;  4I55 A;  2JEX A;  3RYI A;  2PY5 A;  4UUJ C;  4JI3 B;  1Y67 A;  2Y69 C;  2DYR B;  1THZ A;  1S72 V;  2UXD B;  3W7S A;  3B40 A;  1FD9 A;  1KYO F;  2N74 A;  1YCI A;  4DV4 B;  1GRJ A;  5BXZ A;  1RSO A;  3K9S A;  1FXK C;  3CCS V;  1V55 B;  4BW9 A;  1WA8 B;  4I0X B;  4U3J A;  2ADQ B;  1VIB A;  4GX2 A;  2EIK B;  2K9P A;  5B1N A;  3CRM A;  1BCC H;  1G1X B;  3T4D A;  4JYA B;  3SPG A;  1K4C C;  1SQP H;  4DR1 O;  2NNU A;  3SYA A;  3N2K B;  1IUR A;  1AJP A;  1PP9 H;  3G67 A;  2WLJ A;  1S5J A;  4YJ2 A;  1MZE A;  3ZMZ A;  1YJW V;  1RFY A;  3OUF A;  4AQY B;  5JCO A;  2GUZ A;  3JAR A;  1M9N A;  1VF6 C;  2GSM B;  5IY5 B;  5BZB A;  4DR6 O;  4YJ3 A;  1IX9 A;  2WLH A;  4U3F H;  2HKO A;  1OCR B;  3SPH A;  4OX9 B;  1SET A;  2IBZ H;  1V54 C;  1VP7 A;  2XHB A;  1WPB A;  5H9C A;  2JGU A;  2JGD B;  2QKC A;  2VS0 A;  1M57 C;  4L87 A;  1SES A;  3HKD A;  1IBL B;  1TAE A;  2CH7 A;  4CZZ A;  2PYJ A;  3THO A;  1Y4M A;  5JVD A;  1Q90 D;  2PTM A;  3F5T A;  1VQ4 V;  4J80 A;  1NR7 A;  1VQ6 V;  3CCE V;  1DK1 A;  5KMG A;  2WLI A;  4HAM A;  4K0K O;  4XBF A;  1GM7 A;  2Z3Y A;  2YIB A;  1SQG A;  1SRY A;  5CB4 B;  2CTR A;  4TV9 B;  3GWO A;  4DV6 B;  2JGD A;  4AI8 A;  4KXR A;  4FLZ A;  1MNG A;  3K0D A;  4YJ3 B;  1MMM A;  3JD0 A;  4DK1 A;  2WA4 A;  2AZ2 A;  4FPP A;  5EBW C;  4NXN O;  2M7W A;  3ABT A;  3E8B A;  3JAK B;  2P6J A;  2Q0A A;  1NR1 A;  4RUF A;  3FYE B;  5EK0 A;  1SS3 A;  1H8E G;  3R66 A;  3L72 H;  2JJ2 G;  1QU7 A;  3VQX A;  4DV2 B;  3JAS B;  4EEQ A;  4JYA O;  4X1I A;  4B3T B;  2EIL C;  5FPO A;  3AEI A;  2QGN A;  2EZP A;  2OIG A;  1TGO A;  1SER A;  2GV9 A;  4MVQ A;  5CA0 A;  3OE7 G;  2Q9L A;  4LF5 O;  2UU9 B;  2E5L B;  3MAQ A;  4DV4 O;  1DGS A;  2HJF C;  1XEQ A;  3ETG A;  3SYQ A;  4LF8 B;  1Q6I A;  3CSX A;  1RM1 C;  2V4D A;  2VQE B;  1N32 B;  4H33 A;  1M4U A;  2ZNI A;  1B06 A;  1NTK H;  1IZ3 A;  3HB3 B;  1M56 B;  4GX0 A;  3D36 C;  2XT9 A;  5LOV B;  4U7N A;  2FML A;  1BGY H;  3CYO A;  1MSW D;  4CH5 A;  4GLX A;  4DR2 O;  1Y66 A;  3CEI A;  5IYZ A;  3QO5 A;  2V1D A;  4LP8 A;  2DYS B;  1FXH A;  1VEW A;  3LDD A;  3A0R A;  2AHZ A;  3K57 A;  4YHH B;  1TVK A;  2OCC B;  5LYJ A;  3STL C;  4DW0 A;  2B5U A;  5JQG B;  1NBM G;  3JD4 A;  1R3J C;  4NVP A;  3LDE A;  4DR4 B;  1GM9 A;  4DR7 O;  2WPD G;  2WSS G;  3SJC C;  5EYP B;  1AI5 A;  4X89 A;  3H01 A;  4LF6 O;  2XAQ A;  3S3W A;  1OCO C;  4I50 A;  5J2T B;  3TXQ A;  4BIZ A;  1LR1 A;  2KG7 B;  5IJ9 A;  2A3Q A;  4TUY B;  3N2G B;  4FJC C;  1JPX A;  1XDC A;  3K79 A;  4GKJ B;  1VF5 B;  1IDS A;  1HNZ O;  4X1Y A;  1SQF A;  4PHZ A;  2P4V A;  2AZ0 A;  3CMA V;  5LHG A;  2CUG A;  4X20 A;  3HKC B;  4RO2 A;  3UM7 A;  3ZHR A;  5JJE B;  2IJK A;  2UXN A;  1SQB H;  1XMO B;  3FB5 C;  2A7W A;  4FVM A;  3CWB H;  1QHT A;  1AVM A;  2Y48 A;  1EN6 A;  3RYC A;  2DWE C;  5GON B;  3VQV A;  4YY3 O;  1Q7Y W;  2X6B A;  3CME V;  3EHB B;  1AJN A;  2FB5 A;  4JAA A;  3AK2 A;  2GBO A;  2QKS A;  3LSU A;  5FPR A;  2EIK C;  4W4K A;  1RPR A;  4LF4 B;  1I94 O;  2EIJ C;  3IC9 A;  4MVZ A;  3STZ C;  4H0L B;  2YID A;  1OCO B;  2GTA A;  1URF A;  1YIJ V;  5EZY A;  1PKX A;  4AIL C;  1JX9 A;  2QR4 A;  3P32 A;  4YHH O;  3CCV V;  1FKA O;  1IBM O;  1HNW B;  2KKW A;  1M1K W;  1MZF A;  2QWO B;  3AK1 A;  3K08 A;  1BZK A;  1YZB A;  1WB7 A;  3QTC A;  1WB8 A;  4OPH A;  1SA0 A;  1NU1 H;  4R8C A;  1QLN A;  4ZHQ B;  5LGN A;  1FPO A;  1W2B U;  5IT9 N;  2ZDI A;  5AG2 A;  4JI0 O;  1AIL A;  1NH2 D;  3RVY A;  3CRC A;  3K0G A;  4IIJ B;  2Y0P A;  4JYY A;  1GH6 A;  2EIN B;  3K9A A;  4EFE A;  3K3W A;  3T4Z A;  1K5S A;  4K8Z A;  1K34 A;  1PPJ H;  3CXC U;  3RYH B;  4BIO A;  1GAX A;  4O4H B;  5CBH A;  4PDL A;  3E2E A;  1AI7 A;  2ZDI C;  2LP7 A;  4JAV A;  2X6C A;  4RAI A;  3ZMT A;  4NKG B;  4MTO A;  4JZG A;  1FJG O;  5B1O A;  4HBN A;  4UCS A;  4J9Z B;  3D3Q A;  3ETD A;  1FAF A;  1HP8 A;  1K92 A;  4WBN A;  2IJI A;  1VQ9 V;  4DV0 O;  2QTO A;  3ASO B;  4TQF A;  1JNB A;  4LFC B;  3UO2 A;  1FFX A;  2DOS A;  2XAJ A;  4FM2 A;  1YJN V;  3WB1 A;  5CN0 A;  4I9Q A;  4JI2 O;  3JAM N;  3AG2 B;  1IXM A;  4ZI7 A;  3G6E V;  2EIL B;  4NXM O;  4L8J A;  5L3C A;  3N27 A;  1P4R A;  3CC4 V;  3W7X A;  5HFL A;  2DE0 X;  3NR7 A;  2EX3 A;  3APQ A;  1NS1 A;  1R3I C;  3AG7 A;  4X65 O;  3QVN A;  4MVR A;  4PDM A;  1Y74 B;  4UXN A;  2KQX A;  1ZL8 B;  3QO8 A;  1OCC C;  1RPO A;  2GDS A;  3B09 A;  1NKD A;  1K9M W;  2ZE8 A;  2VQF B;  2UXB O;  4JAU A;  4UCR A;  1I94 B;  1L8D A;  5EYP A;  1N34 O;  1YDX A;  1R6K A;  5B1A C;  5J2U B;  4FZ0 A;  3AG3 C;  5L3E A;  1GO3 F;  1WJZ A;  1KB9 F;  3CPW U;  4FLY A;  3JAS A;  2EIN C;  2Z0A A;  2YXL A;  4DR6 B;  3J81 N;  2UUB B;  5LP6 B;  2GHY A;  2IJH A;  1VMG A;  5KHK A;  5CBF A;  2ITC C;  2BE3 A;  2R9I A;  5H6Q A;  4HNA B;  4TUY A;  2X6A A;  3EVK A;  1Z5V A;  3R65 A;  4J9Y B;  5K1P A;  2P06 A;  4KHP B;  5IJ0 A;  5J2U A;  3ABU A;  3WU2 Z;  2ZIO A;  4JI4 O;  4F6R B;  3O65 A;  1R3L C;  5LXT B;  5C93 A;  1S5L Z;  1K7D A;  1GTO A;  1XNQ O;  1OHH G;  1NTM H;  2YS8 A;  4RQF A;  2ZM6 B;  4ABM A;  3ABK C;  1TUB B;  5F2V O;  1BMF G;  1K73 W;  1XNR B;  1KKC A;  3C90 A;  3E22 B;  3SYC A;  5JWP A;  3N2G A;  1N4C A;  3U11 A;  2XTA A;  3X2Q C;  2ZE7 A;  1QLE B;  4JI3 O;  4N21 A;  1AI4 A;  5B1A B;  5GTI Z;  3ASN B;  3LNN A;  3IFX A;  1OCC B;  4PI2 A;  4Z1M G;  1DF5 A;  1OJH A;  1NH2 B;  1S77 D;  4FFK A;  5CBG A;  1BSM A;  2ZXW B;  1AP5 A;  1MSD A;  3ZCC A;  1NZ6 A;  5D5Q A;  5LMN O;  3OFN G;  1AP6 A;  1Y74 A;  1J5E B;  1GN4 A;  4GX1 A;  1N8R W;  1Q82 W;  3PN1 A;  1XL4 A;  3ABK B;  1K97 A;  3TGU H;  4LFA B;  4JTC B;  1YTF B;  3ML0 A;  1R3K C;  3ETE A;  5ITZ A;  5IWA B;  1R6N A;  3B8N A;  1X59 A;  3GWK C;  4GKK O;  2UU9 O;  2Y0I A;  1YSC A;  4IIJ A;  4X64 O;  4WFG A;  4Z1V A;  4CBC A;  2YI9 A;  1S76 D;  2R9R B;  5KHI A;  5LMU B;  5KUM A;  1K8A W;  4R50 A;  3CRA A;  3UKM A;  2FL4 A;  4TT3 G;  4DUZ B;  1ZUQ A;  3IAY A;  1RSO B;  2ODM A;  2ZIN A;  5KAI Z;  1YTF D;  1XMQ O;  2Y69 B;  5L3G A;  1QLE C;  2RQ6 A;  4NXN B;  1ZAU A;  3U10 A;  5BMV A;  2UXC B;  4JI1 B;  1RM1 B;  3TET A;  1YIT V;  4EKW A;  1F4N A;  1QVF U;  4XDK A;  2DQ3 A;  3UO3 A;  3JD1 A;  4DV7 O;  3CRQ A;  2QM8 A;  4FZ1 A;  1IBK O;  2YXH A;  2PGG A;  4G28 B;  3L9D A;  5CA0 B;  2N04 A;  3K5N A;  4JV5 B;  2DWD C;  3T2M A;  3JD3 A;  5TIS Z;  2CTQ A;  1PNK A;  4JI7 B;  1B3Q A;  4E2L A;  3CJH B;  4CC5 A;  2NLJ C;  1SA0 B;  2F43 G;  4CC6 A;  2IU3 A;  3ZRS A;  5KAF Z;  2VQF O;  2WLM A;  1EN4 A;  3DSQ A;  3C3T A;  4RQE A;  5BR8 B;  3CS5 A;  4JI6 O;  3ZMV A;  5JVD B;  3K06 A;  2JS5 A;  1W0J G;  3ASN C;  1D2D A;  4YXW G;  3QG5 A;  4UB8 Z;  3JAL B;  2RNB A;  2F1M A;  4K35 A;  4NTW A;  1H8H G;  2UUA O;  4X88 A;  5LHH A;  2IJJ A;  1CPY A;  4E4E A;  4MVM A;  4DV7 B;  1JMK C;  4I4T B;  2UXX A;  3H9V A;  3LSS A;  4IL6 Z;  4CS2 A;  2BOC C;  4TOI A;  3CCR V;  2EZO A;  4JI1 O;  3ABM C;  3ZS8 C;  4JI2 B;  1YEW A;  2WA3 A;  2XAG A;  1AR1 B;  2OCH A;  1NT2 B;  4LF9 O;  4DV0 B;  4KFM A;  1SQQ H;  3BHP A;  4B3S B;  2JVD A;  2FKX A;  2UUC O;  2ZD9 A;  5IJ0 B;  4N23 A;  3CD6 V;  2Q7E A;  1ZSP A;  1WP8 A;  5LGU A;  4F4L A;  4LC1 A;  2XND G;  1OCR C;  1HNZ B;  2EIM C;  4I4T A;  1PNL A;  4PA7 A;  4I7Z B;  4H44 B;  1JR9 A;  3AG1 B;  1KKD A;  4DR3 O;  3K03 A;  4GKK B;  1EZV H;  2V7Q G;  3WG7 B;  4LF6 B;  1JVM A;  4CS4 A;  1LNQ A;  1XIL A;  4HYO A;  5IWA O;  4U7O A;  1HWY A;  2GTS A;  4QJF B;  5GW7 A;  3QO7 A;  2ZQM A;  2HHH B;  3RYC B;  1YI2 V;  1ZLZ A;  4R6Z A;  2DN9 A;  1K33 A;  5LP6 A;  3RFR A;  1J5E O;  2WLI B;  3D8C A;  3ICX A;  5LMN B;  1WPX A;  1PD3 A;  1JOY A;  5FNV A;  1KQS U;  1IBM B;  2WAM A;  1KUQ A;  1WLE A;  4O2B A;  4PI0 A;  1Q43 A;  2QA4 V;  1TVK B;  4JZ2 A;  4JAS A;  2RDC A;  5L3D A;  2YSU B;  4H13 B;  4LF8 O;  1TA8 A;  1G4Y B;  3E86 A;  5KX5 B;  3LUT B;  4XDJ A;  2A0L A;  2E5L O;  1NJI W;  1XNR O;  2PI4 A;  2KG7 A;  3ZMS A;  5L3F A;  2ZM6 O;  4I50 B;  3E8G A;  2WLL B;  3PJS K;  1XNQ B;  3MD0 A;  3BPZ A;  1CEZ A;  2WLN A;  3G4S V;  1JFF A;  4DV1 B;  4DV3 B;  1SQX H;  2C2A A;  4DV2 O;  3KDR A;  1SQV H;  2YIB D;  3C3S A;  1MG1 A;  4X20 B;  2F23 A;  2UUC B;  1VQK V;  2E3C A;  1BT8 A;  1KBH A;  1VAR A;  3B8M A;  3TJT A;  3SPI A;  4GZR B;  4O4J A;  2IH1 C;  2HG5 C;  2HVJ C;  3KG2 A;  1SC5 B;  3Q4H A;  4JGS A;  2Z5U A;  1BQ0 A;  4MTX A;  1HNX B;  1ZL8 A;  2ETN A;  1SZX A;  5IYC O;  2ILM A;  2DYR C;  5GON A;  4PDR A;  2IW5 A;  1XRE A;  1JJO A;  3HPL C;  4DV6 O;  3B77 A;  4J7K A;  3H1I H;  2P67 A;  1EFR G;  3J80 N;  3ZHV A;  2UUA B;  1M56 C;  1Z5W A;  1UFI A;  5CA1 B;  1FFX B;  1WA8 A;  3UCS C;  3OEH G;  4UV9 A;  2IM9 A;  3O9O A;  3TXS A;  5DEC A;  5B1B B;  4GT1 A;  4UVC A;  4O4I B;  4QGP A;  4WFF A;  2QWR B;  4BAY A;  3OMA B;  5LL6 Y;  2DJV A;  2XOK G;  4DW1 A;  5B66 Z;  3TK1 A;  1Q6U A;  3WB0 A;  4B3M B;  1D5A A;  1EM1 A;  4O4L B;  4H37 A;  4CH4 A;  1XHX A;  3EXA A;  3BAB A;  4OX9 O;  2XAF A;  1H2M A;  4JV5 O;  4WFE A;  1N33 B;  3KKY A;  2PYL A;  3AG4 B;  4I55 B;  2ZE6 A;  4FLT A;  1BQZ A;  3JSL A;  2K1E A;  4ASU G;  4PD4 F;  3P3N A;  5J9P C;  2YXY A;  1O9G A;  1KEC A;  4B3R B;  4LF5 B;  1ZTE A;  3SDL A;  3HKB B;  3I5D A;  4QIW F;  3T1C A;  4C7U A;  3S3X A;  3AG3 B;  4QE7 A;  4WF9 V;  2AGA A;  4G2K A;  1UPG A;  5EC2 C;  3E8H A;  5D5P A;  5DED A;  4ZKI A;  2F93 B;  5B3S C;  2LJ2 A;  2B1G A;  3HKE B;  2D2C B;  4X64 B;  1VQN V;  2R9A A;  2WWW A;  2VRZ A;  4TV9 A;  2UXD O;  2JRI A;  4JI0 B;  1M90 W;  2W6J G;  4GYC B;  1OCZ C;  1KP3 A;  1Y76 B;  2JDI G;  1GMG A;  3L75 H;  3OGI B;  1QR9 A;  2Q73 A;  4HZ3 A;  2F66 C;  2QE7 G;  3T1Y O;  3FFQ A;  1N33 O;  4MTG A;  2CK3 G;  4AHC A;  1B6Q A;  4DR5 O;  1Q81 W;  3M8A A;  5EBL C;  1F7Y A;  1BS3 A;  2LW1 A;  2Q8V A;  1M93 A;  2DYS C;  3K04 A;  4FK5 C;  4ZI7 B;  5KA5 A;  3SJA C;  3ASO C;  1MA1 A;  2E74 B;  3ABM B;  1MAB G;  1QR8 A;  3CXH F;  4LF4 O;  1IBL O;  1GK9 A;  2XAS A;  1RP3 B;  1H2N A;  5FNV B;  1YJ9 V;  4DRX A;  4J10 A;  1S3J A;  1FXV A;  5BMV B;  3IJ4 A;  5JH7 B;  3AG4 C;  1VF6 A;  1DF4 A;  2B1I A;  3L74 H;  1AR4 A;  3CCJ V;  1NI8 A;  1DLB A;  4J41 A;  2QJ1 A;  3ZHS A;  1HNX O;  2H3O A;  4P9P A;  4WCE V;  3RVZ A;  2ZIM A;  4KHP O;  4WBN B;  2ZR3 A;  3CCL V;  4PA3 A;  2QTS A;  3L71 H;  5H6R A;  2EJR A;  3T1Y B;  3AG2 C;  1ARO P;  3KZI Z;  4PV1 B;  2Q4P A;  4K3A A;  1NQT A;  4P30 A;  5B5E Z;  3U0Z A;  4DR1 B;  5E1A C;  3JAR B;  1CP9 A;  3UQ8 A;  3ETQ A;  4EB6 A;  4D6T H;  4DV1 O;  5GTH Z;  2YIA A;  5EC1 C;  3BAA A;  4GKJ O;  2RN9 A;  1EZJ A;  2P90 A;  2MW2 B;  1OCZ B;  1AJQ A;  3L73 H;  3A2F A;  2BTQ A;  5KX5 A;  3Q4H B;  1TUB A;  2W0F C;  1WP7 A;  3T1H B;  4LBE C;  1I5Y A;  3OT7 A;  2CGO A;  2CH7 B;  4LF7 O;  3P30 A;  2BSK B;  2ITD C;  1JFF B;  5LOV A;  2Q7G A;  3G6B A;  5KMG B;  1Q6H A;  1US6 A;  1D5N A;  4X62 B;  3UT5 A;  1U97 A;  2WLL A;  4O4L A;  2JEU A;  4LH7 A;  1N0J A;  3JYC A;  4NXM B;  3RT3 C;  2ZT9 B;  4J7J A;  4O4I A;  2XUM A;  2JJ1 G;  2BTO A;  3JCU Z;  4PA6 A;  1XHZ A;  1NVP B;  3OTF A;  3CRR A;  3ZED A;  2VQE O;  1N32 O;  3SYP A;  2BSK A;  4IHJ A;  2NR5 A;  5IDJ A;  1N0N A;  4P2Z A;  4QPK A;  2QDO A;  3H1K H;  4DR3 B;  2RCV A;  2JIZ G;  2EIJ B;  1K3E A;  5LA6 B;  1BE3 H;  2W0X A;  3P3P A;  3K5M A;  3FD9 A;  1AI6 A;  1W59 A;  1G8M A;  3SR2 C;  3A8T A;  2F95 B;  3ZHQ A;  3KCX A;  3OR7 C;  3JAT A;  2D3O W;  3F7V C;  4LFB O;  4Z2W A;  1XI1 A;  3ZRW A;  3RGB A;  3FB7 C;  3MHS C;  1YHQ V;  2QM7 A;  2LGQ A;  2F4V O;  2R70 A;  4D7S A;  5JJJ B;  3J7A U;  3F5W C;  3RYI B;  1P7G A;  4FLW A;  4PDV A;  3I55 V;  2FYU H;  2E76 B;  2F4V B;  4UVB A;  2H94 A;  4QNH B;  1Q3E A;  1YVW A;  2BTQ B;  1XL6 A;  3RW0 A;  5DN6 G;  1JA8 A;  3OEE G;  1L0L H;  5IYD O;  1LUW A;  1M5I A;  5E79 Z;  2FTK A;  2YIC A;  4IGG A;  1R6T A;  2ADP A;  1IVS A;  1K5Q A;  5A2Q N;  1S0V A;  4MVU A;  4NTX A;  2N05 A;  1COW G;  1EN5 A;  4MTF A;  4W4L A;  2QWN B;  3ZMU A;  3ABL B;  1PM9 A;  3DC5 A;  1TUE B;  3N2K A;  2OCC C;  3ZX6 A;  1VQO V;  4JTA B;  3IC7 A;  1XBL A;  4DXW A;  4YY3 B;  4ZHQ A;  3BCC H;  3A0B Z;  2KB1 A;  4TV8 B;  1V55 C;  1GN6 A;  2NN4 A;  3OAA G;  2PUS A;  4NYK A;  4DRX B;  1U96 A;  2UXC O;  2A79 B;  2HEP A;  2Q67 A;  4JI5 O;  5EIB C;  3W7T A;  1K4D C;  3CCU V;  1HR0 B;  4I5S A;  4JYC A;  4OPA A;  2QSA A;  2CTW A;  2HHH O;  4DUZ O;  1JQ0 A;  3OD4 A;  2XAH A;  4UCT A;  3RBZ A;  3OTO O;  2VWJ A;  3RYF A;  2CAZ C;  1VQL V;  4PA9 A;  2E75 B;  2QKA A;  3E35 A;  2OTJ V;  1IXB A;  1ZWI C;  1UJW B;  1QNM A;  1VQ8 V;  1WNS A;  3K5L A;  1ENV A;  4DV5 O;  1H5W A;  2Q5Z A;  1BHA A;  4DUY B;  4LNU A;  2PZS A;  4BWA A;  4GCZ A;  2RMK B;  3K58 A;  4JPR A;  5KUK A;  3JAL A;  4HNA A;  4LH6 A;  3B2E E;  2LO1 A;  4JI5 B;  3ZJZ A;  2EIM B;  1PL0 A;  4MVS A;  3NXS A;  2AXT Z;  3ZHT A;  3OW2 U;  4LR3 A;  3LDC A;  2ZXW C;  4IT5 A;  3E8F A;  2RJZ A;  4LWS A;  2X7R B;  4EB6 B;  4UCU A;  4A5U B;  2IH3 C;  3JAW A;  3DXR B;  3K5O A;  1GN3 A;  3HKE A;  2A9H A;  4Q20 A;  4YIO A;  2Q7H A;  3HKD B;  2ZE5 A;  5EIB D;  4O2B B;  4RWU A;  3CE2 A;  4ZOL A;  2BOB C;  4O4H A;  3OMN B;  3GVM A;  1XUQ A;  3SYO A;  1L1F A;  2Q68 A;  3SPC A;  4X66 B;  1FYJ A;  5CA3 A;  2EUL A;  4NR1 A;  2JS3 A;  1WN7 A;  4JI4 B;  2H8P C;  2L6L A;  4DYL A;  3BY6 A;  4TQD A;  4JI7 O;  1E1R G;  1VQ5 V;  1P7B A;  1OV9 A;  3KCY A;  4FFB A;  4PEL A;  5FL7 G;  1GM8 A;  3HKB A;  4D7T A;  4JF3 A;  4KUM A;  2IU0 A;  3FKS G;  1N36 O;  1N36 B;  1KD1 W;  2OTL V;  1CXZ B;  1Z2G A;  5LGT A;  5H5N A;  3DXR A;  3CX5 F;  2O57 A;  3VQY A;  3CHX A;  3APO A;  5C8Y A;  2LFR A;  4UCV A;  4DO2 A;  2HFE C;  4X9Q A;  3E22 A;  4PA4 A;  3WB2 A;  4CH3 A;  4FFB B;  1SKV A;  4X1Y B;  3ZN1 A;  3BFR A;  1H2L A;  3ZRV A;  4X66 O;  3ZIA G;  5LMU O;  3SJB C;  4ZIB A;  1JCH A;  3M99 B;  4MS2 A;  2HP8 A;  3HR0 A;  4MW8 A;  5K1X A;  2MK3 A;  5CA1 A;  5IE9 A;  5LA6 A;  4RUE A;  5KHJ A;  1KP2 A;  1MOF A;  3RYH A;  1AB3 A;  3VBB A;  4GX5 A;  4LFA O;  5IYB O;  1FXK A;  2OIE A;  2Q6A A;  3L70 H;  4AQY O;  4P9O A;  4CH6 A;  2ARH A;  2Y4U A;  3BA9 A;  4LFC O;  3BA8 A;  1GKF A;  3ZRW B;  5HFM A;  1LUV A;  4QPJ A;  4MVO A;  2QWP B;  5A9G A;  2QM4 A;  4B3M O;  3QF7 A;  4G27 B;  3CJH A;  4F6E A;  1M57 B;  5LYJ B;  2GUZ B;  2LW7 A;  3FAV A;  4DUY O;  4MT8 A;  4DV5 B;  2JK5 C;  3EFF K;  2EJ7 A;  3SPJ A;  3T1H O;  4MW3 A;  2LFS A;  1DTO A;  3H1L H;  3CCQ V;  1QBZ A;  2X0L A;  3OTO B;  3QNE A;  2ZNJ A;  2W6I G;  3RN4 A;  4DK0 A;  1GN2 A;  1P84 F;  2P4K A;  2CDY A;  3WG7 C;  4OXS A;  4X1K A;  2AW9 A;  1HR0 O;  3D36 A;  1ZX3 A;  1Y6X A;  4LCU C;  1OZ0 A;  1KU9 A;  3OMI B;  2L35 A;  2CGN A;  3M7M X;  1WAZ A;  1VF7 A;  4R7C A;  2PI5 A;  1YXB A;  5LHI A;  1EBO A;  4NB5 A;  5H2F Z;  3DTU B;  3VOU A;  3JSN A;  4QE9 A;  3I56 V;  2EBO A;  1I7F A;  4DV3 O;  2UUB O;  1Q86 W;  1B04 A;  5ITZ B;  1H2G A;  1L0N H;  1G6U A;  4BR6 A;  3VQW A;  3JAT B;  2DQ0 A;  2ATK C;  3JAK A;  1N34 B;  2HVK C;  4BIU A;  3RYF B;  3X2Q B;  4TSF G;  1ROP A;  3MHH C;  2UXB B;  3FX7 A;  3CB2 A;  1E1Q G;  4WFB V;  3BVO A;  2YDE A;  3GB7 C;  5JQG A;  5EZY B;  2LQT A;  1W0K G;  5IY5 C;  5LXT A;  1F4M A;  4B08 A;  2LGW A;  4X65 B;  2CTP A;  4JI8 B;  3SGI A;  2Y4T A;  4X8A A;  1VQM V;  2M6Y A;  2YC0 A;  4IYI A;  3G71 V;  4WFA V;  4DR5 B;  3E89 A;  4FM1 A;  3G80 A;  1NVP D;  5BY1 A;  1FOU A;  1V54 B;  5JH7 A;  3RWR D;  4I0X A;  3BRC A;  4FM0 A;  3DGE A;  1A32 A;  4IYH A;  2OYQ A;  2KSD A;  4J7Z A;  1P49 A;  3SJQ C;  5KLV H;  2WLK A;  3CC2 V;  1Q8I A;  4KL1 A;  1S5H C;  4JYB A;  3TCU A;  3FB8 C;  4LFB B;  4MSW C;  3JD2 A;  4I9W A;  5LP6 C;  2HJD A;  1YF2 A;  2DW4 A;  4YJ2 B;  1Q5O A;  1FJG B;  4EFB A;  4GUN A;  4ZOL B;  4DR7 B;  1PV0 A;  3AK3 A;  3WFV A;  1FS0 G;  3LSQ A;  4DR4 O;  1SF9 A;  3B4S A;  3JAW B;  3W7W A;  3FB6 C;  4NTY A;  3FYI B;  1H2K A;  3ABL C;  1QCE A;  4B3S O;  5KHH A;  2OT5 A;  1HDJ A;  3UT5 B;  1HW7 A;  4LF9 B;  2HR3 A;  3ZN0 A;  1R73 A;  4O4J B;  4B3R O;  5IJ9 B;  3IGA C;  1VQP V;  1QVG U;  1QQC A;  5JCO C;  1XOU A;  3H1H H;  3ZRX A;  4UFZ A;  1BL8 A;  2G38 A;  1V9P A;  1F51 A;  1PL4 A;  3HKC A;  2Q69 A;  3OGC C;  2P22 C;  1I0H A;  3F7Y C;  4X62 O;  4CS3 A;  1KMI Z;  1HNW O;  2DMX A;  2YEV A;  3JCZ A;  5KA6 A;  5C8Y B;  5CB4 A;  5B1B C;  4K8X A;  3CP1 A;  4JI6 B;  4FLV A;  5BR8 O;  1F23 A;  4LF7 B;  2PF4 E;  2ZR2 A;  4B3T O;  2YUA A;  1VQ7 V;  3E83 A;  2R72 A;  2BCC H;  4KP4 A;  1FFT B;  4JTD B;  2CE4 A;  1X4T A;  4PJ0 Z;  3W7U A;  4FLX A;  3CC7 V;  3FAV B;  4U3J B;  1IBK B; 
#chains in the Genus database with same CATH homology
 1VAR A;  3TJT A;  2ADQ B;  3EVK A;  3RN4 A;  1GN2 A;  1ZUQ A;  1ZSP A;  3MDS A;  2QKA A;  1P7G A;  2P4K A;  2CDY A;  1IXB A;  1SZX A;  4JZG A;  2AW9 A;  1QNM A;  1BT8 A;  1JR9 A;  1XRE A;  4GUN A;  3AK3 A;  4X9Q A;  1AVM A;  1JA8 A;  1EN6 A;  1XIL A;  3OT7 A;  1LUW A;  3BFR A;  2ADP A;  1KKC A;  1ZLZ A;  3AK2 A;  3DC6 A;  3LSU A;  1D5N A;  1BS3 A;  1IX9 A;  1EN5 A;  1B06 A;  3IC9 A;  4BR6 A;  1EN4 A;  1PM9 A;  3C3T A;  3DC5 A;  1EM1 A;  1I08 A;  1MA1 A;  1N0J A;  1PL4 A;  3CEI A;  4FFK A;  1BSM A;  1AP5 A;  1MSD A;  2QKC A;  3QVN A;  1I0H A;  4JZ2 A;  1GN3 A;  3KKY A;  1VEW A;  4YIO A;  1AP6 A;  2GDS A;  1GN4 A;  1N0N A;  4YIP A;  1AR5 A;  3AK1 A;  1XUQ A;  1GN6 A;  4E4E A;  1WB7 A;  1LUV A;  5A9G A;  2RCV A;  1WB8 A;  4F6E A;  1AR4 A;  1Y67 A;  5AG2 A;  1ZTE A;  2CE4 A;  3KDR A;  3C3S A;  1MNG A;  1XDC A;  4JYY A;  1MMM A;  3K9S A;  1IDS A;  4C7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...