2RCVA

Crystal structure of the bacillus subtilis superoxide dismutase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
b'AYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVADLDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFAAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDYISAFWNVVNWDEVARLYSER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Structure of Bacillus subtilis superoxide dismutase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 69
structure length 200
sequence length 200
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2rcvA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2rcvA02
1BS3A 2AW9A 1QNMA 2CDYA 3LSUA 1LUVA 1AVMA 1XILA 2QKAA 1N0NA 4YIOA 1EN5A 4JZ2A 3AK1A 3C3TA 1EN6A 1BT8A 1KKCA 1IX9A 1WB8A 1MSDA 1ZLZA 4GUNA 1N0JA 1AP6A 1D5NA 2P4KA 1JR9A 1P7GA 1EN4A 1GN3A 3TJTA 2QKCA 2RCVA 3C3SA 1I08A 3CEIA 3DC6A 3AK3A 4FFKA 3MDSA 1GN2A 3K9SA 3DC5A 1PL4A 2CE4A 1ZUQA 5A9GA 3AK2A 3BFRA 1GN4A 2ADQB 1SZXA 4C7UA 4BR6A 4X9QA 4JYYA 1MMMA 1IDSA 1JA8A 4F6EA 1Y67A 3OT7A 1ZTEA 1LUWA 1AR4A 2ADPA 1BSMA 3KKYA 3RN4A 1PM9A 1EM1A 1XDCA 1AR5A 1I0HA 1VARA 3QVNA 1B06A 1XREA 3EVKA 3IC9A 1AP5A 1MNGA 1WB7A 1GN6A 4JZGA 1MA1A 1VEWA 1IXBA 2GDSA 4YIPA 1ZSPA 5AG2A 1XUQA 4E4EA
chains in the Genus database with same CATH superfamily
4XDJA 3E89A 3JCUZ 1SC5B 1OV9A 3JASA 3J7AU 5KUKA 1S72V 1TUBB 2ZR2A 5C93A 4DV7O 1KQSU 2AXTZ 3JD0A 4DV1O 3LSSA 4UV8A 4DV0B 2XHBA 1XI1A 4YIOA 5KHGA 3G67A 4LFAO 2Y0IA 1VQ6V 4DR3O 4LFBB 4DR6O 3F5WC 4LF4O 3THOA 2N04A 3KCXA 4BIZA 1F4NA 2M6YA 3B09A 1XQ8A 1IBKO 5B66Z 1WP7A 1CXZB 3K5MA 1QHTA 1N8RW 1EBOA 3N2GA 4NTXA 4JI6O 4MS2A 1N33B 4NKGB 1OCRB 2KKWA 2EIKC 4O4JB 3EFFK 1ROPA 4FJCC 5KHHA 3C90A 1FJGO 2GTSA 2JK5C 1JNBA 1RM1B 3B77A 4PA9A 3OEEG 4TT3G 3B8NA 4R8CA 1QLEB 4FFBB 4I0XA 3CC4V 2QWPB 2N05A 4MTFA 2BCCH 1G8MA 2HLDG 3ZRXA 4X9QA 3FAVB 4BW5A 1R6KA 3RVYA 2IU0A 2GUZA 2DJVA 1P7BA 3RN4A 3VQVA 4RQFA 2HJFC 4MT8A 2BSKA 3UM7A 1I0HA 2YDEA 3JAWA 3OW2U 3FYIB 2Q9LA 2VRZA 3ZHSA 4O4LB 3L70H 2QWRB 3VQWA 4GX0A 3K57A 2ZM6O 4DV3B 5J2TB 1WA8B 2OCCC 3OUSA 1BS3A 1XNQB 4TOIA 1YITV 1FFTB 1AI4A 3ML0A 1AVMA 1XILA 2DYSC 3TETA 2QKAA 1EN5A 3AK1A 1XMQB 1K4CC 1HW7A 4RO2A 1WP8A 5JQGA 4MTXA 2Q0OC 4J41A 1SKVA 3ZEDA 2BE3A 1HWYA 5BMVB 5GONA 4DR1B 3ABLC 2H3OA 1SQPH 1PNMA 1WAZA 2DE0X 1JMKC 4JI3O 1R6NA 2EINC 4U3JA 2UU9B 1IURA 2EILB 3H1LH 4J7ZA 3S3XA 4KFMA 1JOYA 3CMEV 2QA4V 3OTFA 5IWAB 2BTQB 1VF5B 2AHYA 3RBZA 2P7TC 3OMNB 1YTFD 2Z5UA 4I4TA 4UCTA 5FLXN 1SQBH 5JJJB 3CCQV 3AG3C 5KX5A 2B5UA 1CEZA 1N34B 2P22C 1BSMA 3KKYA 2Y69B 1TA8A 2ZINA 1W0JG 2YEVB 1I94O 4PHZA 5L3FA 1S5HC 4N23A 3BHPA 2VQFO 1O9HA 3QVNA 1XREA 3CCVV 4DR4B 1XL6A 4RAIA 1KP3A 3NXSA 1ZWIC 3CCEV 4DO2A 1GN6A 3AG2C 2FMLA 4B3MB 2Q0AA 3SPHA 1XHXA 3SPIA 1X4TA 1UPGA 5ITZB 2GHYA 4IT5A 1M57B 2OYQA 4JYAB 1N36O 2EIMB 2ATKC 4MTOA 2ITCC 2UXXA 1VQMV 2FB5A 2JEXA 4G28B 4JZ2A 3CMAV 1DF4A 5JJEB 3T2MA 4MVRA 1IVSA 1SS3A 1BQZA 4GLXA 3CCRV 3OAAG 3QO5A 4J9YB 3BA8A 3ZRWB 1VF6A 3ZS8C 3CD6V 3HKEB 2UXDO 3ETQA 3TJTA 2ZE5A 2WA3A 2XOKG 3LDDA 3OTOO 1R3IC 1VQ8V 2HHHB 3HKCA 1GN2A 5FL7G 1M9NA 5LP6A 5LMNB 4GKKO 2CE4A 4YJ2A 5H5NA 5L3DA 1OCZC 4K35A 2B9ZA 4LWSB 1PV0A 3CRCA 2HR3A 3CCLV 4HZ3A 4JPRA 4JASA 1S0VA 4EKWA 4JGSA 3M99B 3E86A 5EZYA 1YJNV 4H44B 5LHIA 4DV4B 4B08A 3BCCH 1V55C 3J80N 2LO1A 4U7NA 5IYZB 1JCHA 2XAFA 1B06A 4D7TA 1ORQC 2Z0AA 5DECA 1VMGA 5FPOA 3BEHA 5CA1B 2Q6AA 1VQLV 3BVOA 5KHKA 5LL6Y 4BIOA 2R9AA 2ZR3A 4X88A 1XUQA 1NH2D 2R72A 3ZCCA 2IM9A 4FMTA 4B7KA 4MSWC 1W2BU 4MVZA 1L8DA 2R9IA 1TVKA 5DEDA 3PN1A 3G6BA 3CCJV 2NR5A 3RYIA 5B1NA 3CPWU 2W0XA 4DK0A 3K08A 3B4SA 1S5JA 4YY3B 4EB6B 4X1KA 5E1AC 3SR2C 1IJGA 3SYCA 5LYJB 3VQYA 4TWKA 2RCVA 1I08A 2WWWA 4FIPC 2ZQMA 3ABKC 3OMAB 2Y4TA 2HJDA 2E5LO 1PP9H 1HNXO 1DLBA 5H6QA 4FVMA 3UKMA 1Y6XA 4I9WA 1AJNA 3G6EV 4PDVA 3SYAA 2UUAB 1JFFB 4BR6A 3K58A 2B1GA 2DW4A 4F6RB 4ZI7A 4DUYO 1B04A 1ZTEA 1YI2V 3SYPA 1ZL8B 5LHHA 4FM1A 4LF9B 1MABG 1OJHA 3U11A 4OPHA 2IH3C 2EIKB 2IBZH 5J2UB 1SQXH 1S5LZ 3OE7G 3MHSC 1ZX3A 2RQ6A 4YJ3B 2WPDG 3A0HZ 1A32A 1FYJA 1Q8IA 4YIPA 2P90A 4PDMA 1G6UA 1QLNA 3RYCB 5LOVB 4RWUA 1AI5A 1DGSA 1FPOA 2AW9A 2UXCO 4NXNB 1YIJV 2CAZC 4OPAA 4J11A 4X1IA 4AILC 1LUVA 4NVPA 1JJ2U 2ITDC 2K9PA 3ZMZA 2CGOA 2DN9A 4JI7B 1YTFB 5IE9A 2YICA 2UXBB 3K5OA 1EN6A 4Z1MG 4GX5A 3I56V 1GH6A 2HG5C 5B1AC 3SDLA 1KECA 1T5EA 2L6LA 2OIGA 3D36A 3QG5A 3RYHB 1M56C 3CX5F 2UUCB 4CH6A 3UT5B 5IYCO 1WPXA 4JAAA 4JI4O 1YCIA 4DR7B 2P4VA 4JI8B 2OCCB 5FNVB 2HVKC 3E2EA 2Q69A 2AHZA 2ZNIA 2CH7B 3CEIA 4P9OA 3P3PA 2DYSB 4GZRB 2KSDA 2QKSA 2G38A 3AK2A 4LF5O 1PPJH 3VOUA 4LBEC 5L3EA 5KLVH 2WLHA 2WLLB 4B3SO 3ABLB 2P6JA 4HBNA 4KUMA 5EZYB 2YXYA 1P49A 4DR5B 3LSQA 1XNRO 3CCMV 2IJHA 1DF5A 2EINB 2GV9A 4TUYB 1HDJA 5BZBA 3EVKA 2QTOA 4DV1B 1M5IA 2Q7HA 3P32A 1KU9A 3L9DA 2OCHA 4LFAB 4DUZO 1GM7A 5FPRA 1R6TA 5AG2A 4LF4B 3RFRA 4B3TO 3AG3B 2V4DA 3IGAC 3K5NA 4PI2A 2JIZG 4IL6Z 5IYBO 2FYUH 4BWAA 3A2FA 2HFEC 1Y76A 1J5EO 4JI1O 2PUSA 2JDIG 4RQEA 3JAMN 1F51A 1MSDA 1SRYA 3WB2A 4FLUA 2QEXV 4D6TH 4X1KB 1V9PA 3HKDA 3CJHB 3AG2B 2LGWA 2QTSA 2P4KA 1HR0B 1KUQA 1WNSA 4CC6A 1HNWO 1SA0B 5BR8O 4J7JA 2YI9A 2PF4E 1BL8A 4O2BB 1Q6HA 4I50B 3AK3A 3BAAA 1AJQA 1VIBA 4W4LA 1XMOB 1MG1A 1NH2B 1PL4A 1XL4A 4B3RO 4GX1A 4RUFA 5EBMC 3BA9A 1NBMG 4PELA 1GN4A 1Q6IA 4ZHQA 4C7UA 4CZZA 5CB4B 2L35A 1KP2A 3N27A 1OCOC 2AGAA 1Y67A 1FAFA 2F95B 1LUWA 3QO8A 1S77D 5B3SC 4LNUB 3W7XA 1PM9A 1R3JC 1AR5A 4OXSA 4WFHA 2KG7B 3UO3A 2OT5A 4O4IA 3ZRVA 4ABMA 2QSAA 2Z3YA 4LC1A 2QM7A 3O9OA 3KZIZ 4QGPA 4KHPB 1OCZB 5DM6V 4GX2A 5EBWC 1JPXA 2Q67A 3K06A 3A8TA 2XUMA 4Q6GA 2A3QA 4JTAB 3ETGA 4R50A 4DV2B 1BQ0A 4G2KA 2ILMA 1V55B 2VS0A 4LF8B 4LFBO 4L8JA 2DWDC 2OIEA 1VF6C 1KKDA 1ZLZA 2YI8A 4UUJC 2E75B 4LF7B 1IBMO 1N33O 4HNAA 3BRCA 3APOA 3CSXA 1HNZB 1P7GA 3X2QC 5LP6C 1VQOV 4PJ0Z 1Q86W 3DXRA 4PI0A 3TGUH 4KP4A 3T4ZA 2P06A 4Z2WA 3T1YB 4K8ZA 4ZBMA 2F93B 1FOUA 3GWOA 5A9GA 4CC5A 3E35A 3FYEB 4IIJA 2Q8VA 2VQFB 1Y74B 4O2AB 4UCUA 2BOCC 2DQ0A 3HR0A 3ZHVA 3L72H 1AB3A 3SYOA 3KDRA 1BGYH 3SJBC 1X59A 2MW2B 1IBLB 3SJCC 4FLTA 2JGUA 3ABKB 3E22A 2EBOA 2C2AA 2JGDB 3R65A 5LA6B 3H1IH 1AILA 2FTKA 1WB7A 2IU3A 1Q7YW 1RP3B 4NTYA 1IXBA 2WLNA 1Q90D 3HKBB 4DV3O 4NXMB 2O57A 4X66B 4JI0B 1XNQO 5EYPA 3H9VA 3Q4HB 4X65O 1H2KA 4PV1B 2UUBB 4ICGA 3CE2A 1CPYA 1AJPA 1XMQO 2QJ1A 1F7YA 1VP7A 2UXDB 1FFXA 3JALB 4LFCO 3AG1C 3C3TA 4HYOA 4NR1A 1IXMA 2HEPA 2QGNA 4DRXB 3JASB 3UO2A 4K0KB 2YSUB 5IT9N 1NR7A 4PA4A 1SETA 3OGCC 4BW9A 1NI8A 2ODMA 1TGOA 3B40A 1GKFA 2IJJA 1MOFA 4OX9O 4PA6A 3DC5A 1VQ9V 2XNDG 1XBLA 4P2ZA 2X6BA 2MK3A 2ZE7A 3WG7C 2YIBA 5B1AB 4UVAA 1NTZH 5A2QN 3N2GB 2YIAA 2DOSA 2X6CA 3CCUV 2XT9A 1KBHA 1M93A 5CN0A 1M56B 1MZFA 2Q5ZA 4U3FH 3JAKA 1M1KW 1N34O 4GKJB 3JATA 3BABA 1QR8A 2F4VO 4JI2B 4MTGA 2Q68A 3SJQC 3ZHUA 3JARA 3K59A 3QTCA 4DR4O 4OGQB 1G1XB 4L87A 4PA3A 4I0XB 1F23A 1PNKA 5IDJA 4K3AA 5F2VO 1FXKA 1AP5A 4B3MO 5K1PA 2D3OW 5JH7A 1SZTA 2GDSA 4IHJA 2GUZB 4JYAO 2R70A 3CRQA 2DWEC 3ZJZA 2BSKB 1N4CA 3FB7C 1SQVH 4TQFA 3LSUA 3JAWB 1YEWA 3RYFA 4JI5O 4MVSA 5EK0A 4EFBA 2ZT9B 3I55V 3G80A 3D36C 4X1YA 3JYCA 5JVDA 2IJIA 2V1DA 2PY5A 2WLKA 1H2LA 4FZ1A 2ZXWC 1FKAO 5LMUO 2ZD9A 5BY1A 2H8PC 1Q81W 1RSOA 3ZN0A 4MW3A 2E5LB 1Y4MA 5EC2C 2WLIA 4LF6O 4TV8A 1KMIZ 3LUTB 4TV9A 2HP8A 3ZHTA 1KB9F 4O4HA 2YUAA 3TXQA 2HHHO 5JQGB 4ZOLA 3HPLC 1YZBA 3ZIAG 5LMNO 5JCOA 3CS5A 1K73W 2XAQA 5KAFZ 3WU2Z 3WB1A 1ZAUA 3H1HH 4F4LA 4DXWA 5GONB 3CHXA 1SERA 4H37A 1OCCC 1E1QG 1SQGA 2HVJC 4CBCA 5IJ9A 1HP8A 2JVDA 4JYYA 1JA8A 3U0ZA 2PI5A 5KMGA 1COWG 4IYIA 4U3JB 4AQYB 3T1HB 1AR4A 1E79G 5JWPA 4LP8A 2Q4PA 2KQXA 4UXNA 3JSLA 4JAVA 3RWRD 4IGGA 2F43G 1TUBA 1SF9A 4FK5C 2HKOA 4X62B 5CBFA 1YSCA 3CRMA 3ETEA 1GM8A 4I4TB 1L1FA 5KX5B 2FL4A 3ABUA 4UCRA 3K79A 1VQ4V 4EEQA 4J10A 4E4EA 5KHJA 1OCOB 3EXAA 1K5SA 2W6JG 3U10A 3ZN1A 5B3SB 4WF9V 4FLWA 1BE3H 4JI4B 1H2MA 1N32B 4A5UB 1N0NA 5TISZ 4E2LA 4YHHB 4YY3O 4O4JA 1BT8A 5LGNA 1M90W 1MSWD 1MZEA 1PNLA 4Q20A 3WFVA 2AZ2A 4JV5O 4X64B 3OM3B 1L0NH 2IW5A 4FFBA 1XHZA 1GAXA 2ZE8A 1H8HG 2CGNA 3K5LA 1WLEA 3FAVA 4B3SB 2X7RB 3N2KA 1BHAA 3MD0A 1GO3F 2LW7A 2UUAO 4KL1A 5JJNB 4DR2B 3QO7A 2Q7EA 1E1RG 2WLJA 4FLVA 3FB5C 2ZE6A 4MW8A 4O4LA 1GTOA 4LF9O 3W7SA 3X2QB 2ADPA 3HKCB 5LP6B 2EIJC 4N21A 3JARB 1OZ0A 1K92A 4YJ2B 4CS3A 1WA8A 1XDCA 5H9CA 4HAMA 1JVMA 3H01A 2ZDIA 3ZMVA 4FLYA 1R3LC 1THZA 1JJOA 4JZGA 4JI1B 2RN9A 1M4UA 3JD1A 1R73A 3DTUB 1U96A 1NTKH 4DV5B 4NXNO 3I5DA 1DTOA 5EBLC 1QBZA 3ZMTA 4K8XA 2Q7GA 5BMVA 3ASOC 1K3EA 4JI7O 3FKSG 4DW0A 5LXTA 1K4DC 4DV7B 4DV6O 4CH5A 4LH7A 1HNWB 4DYLA 4WCEV 3OR7C 5L3BA 5BR8B 3UQ8A 1WB8A 3CP1A 1NJIW 5CMUA 4DR3B 4DR6B 5H2FZ 4H0LB 4IYHA 1JQ0A 4J9ZB 3A0BZ 3H1KH 2LW1A 2Q73A 2JRIA 4B3RB 4DR7O 2EULA 4JI8O 3K0GA 1IBKB 1TVKB 2CTPA 4UV9A 1EN4A 1GN3A 3RYIB 1NZ6A 4QJFB 2VWKA 4JI6B 4JF3A 4QPJA 1NU1H 1LNQA 2PTMA 1F4MA 3PJSK 5L3GA 2FKXA 2GTAA 1H2NA 3JCZA 2LFSA 3AG1B 2WLMA 1FJGB 2YEVA 1V54C 3LNMB 1SQQH 2VQEO 4PDRA 3OMIB 5D5PA 2CUGA 1YDXA 4BIUA 2ZCEA 4QNHB 5KMGB 4DR5O 4F6EA 3CB2A 3FX7A 5ITZA 3TXSA 1K7DA 4LCUC 4PDLA 5BXZA 4QIWF 1QVGU 3P3NA 2DYRC 3K04A 3WG7B 3D3IA 4ZI7B 4WFEA 4JYBA 2ZKOA 4R6ZA 3F7VC 3ZHQA 4UFZA 5CA0A 1KC8W 2ZM6B 2QM4A 1OHHG 2CDYA 3ZRWA 1IBMB 2PYLA 5KHIA 3HKEA 2RMKB 1BMFG 3IJ4A 1AI6A 3KCYA 1W59A 4CH4A 4LR3A 2Y48A 1R1BA 2QWNB 2P5OA 4DK1A 4FLZA 4XDKA 1EZJA 1HR0O 1FS0G 2YXLA 2LGQA 4ZIBA 2DQ3A 2PYJA 1KYOF 4X1IB 5KUMA 4LWSA 4DV0O 3RW0A 1QCEA 1AI7A 3ETDA 2X0LA 1TAEA 1DK1A 2YS8A 2XAHA 3WB0A 1XMOO 4UVCA 1D5AA 3N2KB 4X89A 3LNNA 1YF2A 3K9SA 4MVUA 4JI3B 4Z1VA 1H2GA 3IAYA 5LBQA 1QR9A 2ZXWB 5IYZA 2E76B 3CRAA 3JD4A 1SZXA 1UFIA 2YC0A 1FD9A 2A0LA 5CA1A 4FM2A 1Q43A 3AG4C 1JX9A 2F1MA 1CP9A 1K8AW 2W0FC 1K5QA 5GTHZ 1NVPD 2NNUA 3L73H 3M8AA 3ZHRA 3O65A 1FXKC 2EJ7A 3ZMUA 3ASNC 4X65B 1NKDA 5H6RA 1VARA 2WA4A 4XDLA 5C8YA 5GW7A 1I94B 4KHPO 1NTMH 1G4YB 2VWJA 2A9HA 1NR1A 3SPJA 4LFCB 1OCCB 4CS4A 4MVMA 4EB6A 1Q3EA 3D3QA 4DV2O 3LDEA 1N36B 3E8GA 3L71H 5IYDO 2GBOA 5LXTB 3EHBB 3ZX6A 3OR6C 4LF8O 4J80A 5LYJA 3OFNG 3APQA 1RPOA 1KKCA 3ABMC 4EFEA 3RVZA 4UB8Z 4OX9B 4LF7O 3JD2A 3T1CA 1SQFA 4NTWA 3SJAC 2QWOB 1HNZO 3E8BA 4UVBA 1RFYA 2YIBD 1Z5WA 4W4KA 2YXHA 1JR9A 1AR1B 1Q6UA 2Y0PA 5JCOC 1JFFA 2XAJA 1I5XA 3K0DA 4CS2A 1Y76B 4I5SA 5IY5C 3LDCA 4F6RA 3SPCA 2QE7G 2NLJC 5GTIZ 1VQPV 3T1YO 1U97A 4UCOA 1VQ5V 3DC6A 1WJZA 1ZL8A 3OTOB 4DR1O 3B8MA 3HKDB 1VQ7V 3CC2V 2F4VB 3W7WA 5B1BC 5J2UA 4I9QA 4GKKB 3ZBHA 4MVOA 1GM9A 1MMMA 4YJ3A 2XASA 2UU9O 1IBLO 3BPZA 3R66A 3P30A 3CXHF 3RYCA 5LOVA 1B3QA 1EM1A 3JSNA 5IWAO 3W7UA 2BTOA 3G71V 2UXNA 4ZHQB 4UCSA 4I55A 3IC9A 4JI5B 2A7WA 1MNGA 4FPPA 1S3JA 4NXMO 1MA1A 2PGGA 4X66O 4JI0O 5B5EZ 1UJWB 1YJ9V 4X8AA 5LMUB 2UUBO 5CA0B 3K03A 3RYHA 1OCRC 4D7SA 3STLC 3G4SV 5IJ0A 2CK3G 3SYQA 4X20A 3UT5A 2QDOA 4O4IB 2EIJB 1O9GA 3CWBH 2XTAA 4LF6B 3RGBA 4I7ZB 5FNVA 2R9RB 1RM1C 5K1XA 4JTCB 3AG7A 4U7OA 5HFLA 3VQXA 3BY6A 2CH7A 2ETNA 2JEUA 4KXRA 1QLEC 3AEIA 2PZSA 4K0KO 1N0JA 3MAQA 2P67A 4WFGA 3QF7A 2ZNJA 1D5NA 2H94A 3K9AA 3E83A 5J9PC 2XAGA 1FXVA 2BOBC 2QKCA 4FM0A 2EX3A 3CC7V 2WLLA 3C3SA 3ASOB 3KG2A 4QE9A 1Q5OA 1S76D 3MDSA 4H13B 1YXBA 3HB3B 5LGUA 4GT1A 3B2EE 4FZ0A 5LHGA 4HNAB 2IH1C 4TUYA 3SPGA 1HNXB 1H2SB 2GSMB 5EIBC 4TSFG 4WFFA 4GKJO 4AI8A 3A0RA 3DXRB 3IFXA 3CRRA 3OT7A 4JI2O 1GMGA 3K3WA 4WBNA 1H8EG 2M7WA 5D5QA 2ARHA 4DUYB 1ENVA 2ZDIC 3STZC 1BCCH 3S3WA 2V7QG 1P4RA 5C8YB 4R7CA 4IIJB 1PKXA 3DGEA 1K9MW 2LP7A 3F5TA 3OUFA 1V54B 1VQKV 3ICXA 1VEWA 3FB6C 1J95A 4DV4O 1PD3A 3J81N 2LFRA 1YHQV 3L75H 3CJHA 4JV5B 5KA5A 3E22B 1QNMA 4GCZA 4PA7A 2UXCB 1L0LH 1QU7A 2EILC 3CYOA 1SA0A 3CCSV 2LJ2A 1NT2B 4O2BA 3IC7A 4I50A 3E8FA 1IX9A 2DYRB 5B1OA 1QQCA 5CBHA 1NVPB 4B7EA 1WN7A 4JAUA 5EYPB 1TUEB 2IJKA 1P84F 1KD1W 1PL0A 2ZIMA 1AROP 4QE7A 2EJRA 5CB4A 3OD4A 3NR7A 1FFXB 5EC1C 2Y69C 4BAYA 1QVFU 1YJWV 2AZ0A 4FFKA 5EIBD 4LNUA 2JS3A 4H33A 3SGIA 2A79B 4NB5A 1SESA 3M7MX 2KG7A 4UCVA 1I5YA 3GB7C 2ADQB 4LF5B 1K33A 1EZVH 3E8HA 1M57C 4AQYO 4LH6A 3FD9A 3T1HO 1IDSA 1YVWA 2EIMC 4DW1A 2B1IA 5E79Z 3OGIB 3F7YC 3UCSC 1W0KG 3JD3A 1WPBA 2WAMA 4G27B 4JYCA 3FB8C 4XBFA 3GWKC 1XNRB 3OEHG 5LGTA 2PI4A 4QPKA 1K34A 4X62O 4I55B 2X6AA 4J7KA 2RDCA 3JAKB 4DV6B 2QR4A 1Z5VA 3JATB 3FFQA 3DSQA 4DUZB 2JS5A 1VF7A 1URFA 2CTQA 4WFBV 3RT3C 3AG4B 5IJ0B 5J2TA 4X20B 2EZOA 2F66C 1H38A 4B3TB 1N32O 3ABTA 2WSSG 4YHHO 1FXKB 2OTJV 2QWQB 5L3CA 5KA6A 1H5WA 2E3CA 3TK1A 3ASNB 2OTLV 5KAIZ 4TQDA 2Y4UA 1Z2GA 4IHJB 5JH7B 1J5EB 2RNBA 2W6IG 4GUNA 2NN4A 4X64O 1AP6A 1GRJA 1D2DA 1RPRA 5HFMA 3RYFB 3QNEA 2DMXA 3ZRSA 2UXBO 1Y74A 4O2AA 2VQEB 4WFAV 2EZPA 4GYCB 4X1YB 5JVDB 2N74A 2JJ2G 2A06H 1Q82W 3VBBA 1BZKA 2JJ1G 2K1EA 2D2CB 1RSOB 4ZKIA 1K97A 2UUCO 2QM8A 1ZUQA 2ZIOA 2WLIB 4DR2O 3ABMB 1Y66A 2JGDA 4TV8B 3BFRA 2E74B 4PD4F 1B6QA 2BTQA 2OWOA 3MHHC 1NQTA 1EFRG 4TV9B 5LA6A 3CXCU 4O4HB 5CA3A 3L74H 4WBNB 4ZOLB 3HKBA 1NS1A 2YIDA 4MVQA 1BHBA 1FXHA 3T4DA 5DN6G 5IY5B 1GK9A 3TCUA 4NYKA 3Q4HA 2RJZA 1US6A 3GVMA 3ZMSA 1LR1A 5CBGA 1R3KC 4P30A 1XOUA 2F23A 3D8CA 2LQTA 4AHCA 5IJ9B 5B1BB 2CTWA 4YXWG 3H1JH 1XEQA 4CH3A 3JALA 4UB6Z 3W7TA 4JTDB 1VQNV 2CTRA 2KB1A 4FLXA 4J42A 4DV5O 1IZ3A 4ASUG 1ZSPA 4P9PA 4RUEA 1I7FA 4DRXA
chains in the Genus database with same CATH topology
1BS3A 2AW9A 1QNMA 2CDYA 3LSUA 1LUVA 1AVMA 1XILA 2QKAA 1N0NA 4YIOA 1EN5A 4JZ2A 3AK1A 3C3TA 1EN6A 1BT8A 1KKCA 1IX9A 1WB8A 1MSDA 1ZLZA 4GUNA 1N0JA 1AP6A 1D5NA 2P4KA 1JR9A 1P7GA 1EN4A 1GN3A 3TJTA 2QKCA 2RCVA 3C3SA 1I08A 3CEIA 3DC6A 3AK3A 4FFKA 3MDSA 1GN2A 3K9SA 3DC5A 1PL4A 2CE4A 1ZUQA 5A9GA 3AK2A 3BFRA 1GN4A 2ADQB 1SZXA 4C7UA 4BR6A 4X9QA 4JYYA 1MMMA 1IDSA 1JA8A 4F6EA 1Y67A 3OT7A 1ZTEA 3KDRA 1LUWA 1AR4A 2ADPA 1BSMA 3KKYA 3RN4A 1PM9A 1EM1A 1XDCA 1AR5A 1I0HA 1VARA 3QVNA 1B06A 1XREA 3EVKA 3IC9A 1AP5A 1MNGA 1WB7A 1GN6A 4JZGA 1MA1A 1VEWA 1IXBA 2GDSA 4YIPA 1ZSPA 5AG2A 1XUQA 4E4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BS3 A;  2AW9 A;  1QNM A;  2CDY A;  3LSU A;  1LUV A;  1AVM A;  1XIL A;  2QKA A;  1N0N A;  4YIO A;  1EN5 A;  4JZ2 A;  3AK1 A;  3C3T A;  1EN6 A;  1BT8 A;  1KKC A;  1IX9 A;  1WB8 A;  1MSD A;  1ZLZ A;  4GUN A;  1N0J A;  1AP6 A;  1D5N A;  2P4K A;  1JR9 A;  1P7G A;  1EN4 A;  1GN3 A;  3TJT A;  2QKC A;  2RCV A;  3C3S A;  1I08 A;  3CEI A;  3DC6 A;  3AK3 A;  4FFK A;  3MDS A;  1GN2 A;  3K9S A;  3DC5 A;  1PL4 A;  2CE4 A;  1ZUQ A;  5A9G A;  3AK2 A;  3BFR A;  1GN4 A;  2ADQ B;  1SZX A;  4C7U A;  4BR6 A;  4X9Q A;  4JYY A;  1MMM A;  1IDS A;  1JA8 A;  4F6E A;  1Y67 A;  3OT7 A;  1ZTE A;  1LUW A;  1AR4 A;  2ADP A;  1BSM A;  3KKY A;  3RN4 A;  1PM9 A;  1EM1 A;  1XDC A;  1AR5 A;  1I0H A;  1VAR A;  3QVN A;  1B06 A;  1XRE A;  3EVK A;  3IC9 A;  1AP5 A;  1MNG A;  1WB7 A;  1GN6 A;  4JZG A;  1MA1 A;  1VEW A;  1IXB A;  2GDS A;  4YIP A;  1ZSP A;  5AG2 A;  1XUQ A;  4E4E A; 
#chains in the Genus database with same CATH topology
 4XDJ A;  3E89 A;  3JCU Z;  1SC5 B;  1OV9 A;  3JAS A;  3J7A U;  5KUK A;  1S72 V;  1TUB B;  2ZR2 A;  5C93 A;  4DV7 O;  1KQS U;  2AXT Z;  3JD0 A;  4DV1 O;  3LSS A;  4UV8 A;  4DV0 B;  2XHB A;  1XI1 A;  4YIO A;  5KHG A;  3G67 A;  4LFA O;  2Y0I A;  1VQ6 V;  4DR3 O;  4LFB B;  4DR6 O;  3F5W C;  4LF4 O;  3THO A;  2N04 A;  3KCX A;  4BIZ A;  1F4N A;  2M6Y A;  3B09 A;  1XQ8 A;  1IBK O;  5B66 Z;  1WP7 A;  1CXZ B;  3K5M A;  1QHT A;  1N8R W;  1EBO A;  3N2G A;  4NTX A;  4JI6 O;  4MS2 A;  1N33 B;  4NKG B;  1OCR B;  2KKW A;  2EIK C;  4O4J B;  3EFF K;  1ROP A;  4FJC C;  5KHH A;  3C90 A;  1FJG O;  2GTS A;  2JK5 C;  1JNB A;  1RM1 B;  3B77 A;  4PA9 A;  3OEE G;  4TT3 G;  3B8N A;  4R8C A;  1QLE B;  4FFB B;  4I0X A;  3CC4 V;  2QWP B;  2N05 A;  4MTF A;  2BCC H;  1G8M A;  2HLD G;  3ZRX A;  4X9Q A;  3FAV B;  4BW5 A;  1R6K A;  3RVY A;  2IU0 A;  2GUZ A;  2DJV A;  1P7B A;  3RN4 A;  3VQV A;  4RQF A;  2HJF C;  4MT8 A;  2BSK A;  3UM7 A;  1I0H A;  2YDE A;  3JAW A;  3OW2 U;  3FYI B;  2Q9L A;  2VRZ A;  3ZHS A;  4O4L B;  3L70 H;  2QWR B;  3VQW A;  4GX0 A;  3K57 A;  2ZM6 O;  4DV3 B;  5J2T B;  1WA8 B;  2OCC C;  3OUS A;  1BS3 A;  1XNQ B;  4TOI A;  1YIT V;  1FFT B;  1AI4 A;  3ML0 A;  1AVM A;  1XIL A;  2DYS C;  3TET A;  2QKA A;  1EN5 A;  3AK1 A;  1XMQ B;  1K4C C;  1HW7 A;  4RO2 A;  1WP8 A;  5JQG A;  4MTX A;  2Q0O C;  4J41 A;  1SKV A;  3ZED A;  2BE3 A;  1HWY A;  5BMV B;  5GON A;  4DR1 B;  3ABL C;  2H3O A;  1SQP H;  1PNM A;  1WAZ A;  2DE0 X;  1JMK C;  4JI3 O;  1R6N A;  2EIN C;  4U3J A;  2UU9 B;  1IUR A;  2EIL B;  3H1L H;  4J7Z A;  3S3X A;  4KFM A;  1JOY A;  3CME V;  2QA4 V;  3OTF A;  5IWA B;  2BTQ B;  1VF5 B;  2AHY A;  3RBZ A;  2P7T C;  3OMN B;  1YTF D;  2Z5U A;  4I4T A;  4UCT A;  5FLX N;  1SQB H;  5JJJ B;  3CCQ V;  3AG3 C;  5KX5 A;  2B5U A;  1CEZ A;  1N34 B;  2P22 C;  1BSM A;  3KKY A;  2Y69 B;  1TA8 A;  2ZIN A;  1W0J G;  2YEV B;  1I94 O;  4PHZ A;  5L3F A;  1S5H C;  4N23 A;  3BHP A;  2VQF O;  1O9H A;  3QVN A;  1XRE A;  3CCV V;  4DR4 B;  1XL6 A;  4RAI A;  1KP3 A;  3NXS A;  1ZWI C;  3CCE V;  4DO2 A;  1GN6 A;  3AG2 C;  2FML A;  4B3M B;  2Q0A A;  3SPH A;  1XHX A;  3SPI A;  1X4T A;  1UPG A;  5ITZ B;  2GHY A;  4IT5 A;  1M57 B;  2OYQ A;  4JYA B;  1N36 O;  2EIM B;  2ATK C;  4MTO A;  2ITC C;  2UXX A;  1VQM V;  2FB5 A;  2JEX A;  4G28 B;  4JZ2 A;  3CMA V;  1DF4 A;  5JJE B;  3T2M A;  4MVR A;  1IVS A;  1SS3 A;  1BQZ A;  4GLX A;  3CCR V;  3OAA G;  3QO5 A;  4J9Y B;  3BA8 A;  3ZRW B;  1VF6 A;  3ZS8 C;  3CD6 V;  3HKE B;  2UXD O;  3ETQ A;  3TJT A;  2ZE5 A;  2WA3 A;  2XOK G;  3LDD A;  3OTO O;  1R3I C;  1VQ8 V;  2HHH B;  3HKC A;  1GN2 A;  5FL7 G;  1M9N A;  5LP6 A;  5LMN B;  4GKK O;  2CE4 A;  4YJ2 A;  5H5N A;  5L3D A;  1OCZ C;  4K35 A;  2B9Z A;  4LWS B;  1PV0 A;  3CRC A;  2HR3 A;  3CCL V;  4HZ3 A;  4JPR A;  4JAS A;  1S0V A;  4EKW A;  4JGS A;  3M99 B;  3E86 A;  5EZY A;  1YJN V;  4H44 B;  5LHI A;  4DV4 B;  4B08 A;  3BCC H;  1V55 C;  3J80 N;  2LO1 A;  4U7N A;  5IYZ B;  1JCH A;  2XAF A;  1B06 A;  4D7T A;  1ORQ C;  2Z0A A;  5DEC A;  1VMG A;  5FPO A;  3BEH A;  5CA1 B;  2Q6A A;  1VQL V;  3BVO A;  5KHK A;  5LL6 Y;  4BIO A;  2R9A A;  2ZR3 A;  4X88 A;  1XUQ A;  1NH2 D;  2R72 A;  3ZCC A;  2IM9 A;  4FMT A;  4B7K A;  4MSW C;  1W2B U;  4MVZ A;  1L8D A;  2R9I A;  1TVK A;  5DED A;  3PN1 A;  3G6B A;  3CCJ V;  2NR5 A;  3RYI A;  5B1N A;  3CPW U;  2W0X A;  4DK0 A;  3K08 A;  3B4S A;  1S5J A;  4YY3 B;  4EB6 B;  4X1K A;  5E1A C;  3SR2 C;  1IJG A;  3SYC A;  5LYJ B;  3VQY A;  4TWK A;  2RCV A;  1I08 A;  2WWW A;  4FIP C;  2ZQM A;  3ABK C;  3OMA B;  2Y4T A;  2HJD A;  2E5L O;  1PP9 H;  1HNX O;  1DLB A;  5H6Q A;  4FVM A;  3UKM A;  1Y6X A;  4I9W A;  1AJN A;  3G6E V;  4PDV A;  3SYA A;  2UUA B;  1JFF B;  4BR6 A;  3K58 A;  2B1G A;  2DW4 A;  4F6R B;  4ZI7 A;  4DUY O;  1B04 A;  1ZTE A;  1YI2 V;  3SYP A;  1ZL8 B;  5LHH A;  4FM1 A;  4LF9 B;  1MAB G;  1OJH A;  3U11 A;  4OPH A;  2IH3 C;  2EIK B;  2IBZ H;  5J2U B;  1SQX H;  1S5L Z;  3OE7 G;  3MHS C;  1ZX3 A;  2RQ6 A;  4YJ3 B;  2WPD G;  3A0H Z;  1A32 A;  1FYJ A;  1Q8I A;  4YIP A;  2P90 A;  4PDM A;  1G6U A;  1QLN A;  3RYC B;  5LOV B;  4RWU A;  1AI5 A;  1DGS A;  1FPO A;  2AW9 A;  2UXC O;  4NXN B;  1YIJ V;  2CAZ C;  4OPA A;  4J11 A;  4X1I A;  4AIL C;  1LUV A;  4NVP A;  1JJ2 U;  2ITD C;  2K9P A;  3ZMZ A;  2CGO A;  2DN9 A;  4JI7 B;  1YTF B;  5IE9 A;  2YIC A;  2UXB B;  3K5O A;  1EN6 A;  4Z1M G;  4GX5 A;  3I56 V;  1GH6 A;  2HG5 C;  5B1A C;  3SDL A;  1KEC A;  1T5E A;  2L6L A;  2OIG A;  3D36 A;  3QG5 A;  3RYH B;  1M56 C;  3CX5 F;  2UUC B;  4CH6 A;  3UT5 B;  5IYC O;  1WPX A;  4JAA A;  4JI4 O;  1YCI A;  4DR7 B;  2P4V A;  4JI8 B;  2OCC B;  5FNV B;  2HVK C;  3E2E A;  2Q69 A;  2AHZ A;  2ZNI A;  2CH7 B;  3CEI A;  4P9O A;  3P3P A;  2DYS B;  4GZR B;  2KSD A;  2QKS A;  2G38 A;  3AK2 A;  4LF5 O;  1PPJ H;  3VOU A;  4LBE C;  5L3E A;  5KLV H;  2WLH A;  2WLL B;  4B3S O;  3ABL B;  2P6J A;  4HBN A;  4KUM A;  5EZY B;  2YXY A;  1P49 A;  4DR5 B;  3LSQ A;  1XNR O;  3CCM V;  2IJH A;  1DF5 A;  2EIN B;  2GV9 A;  4TUY B;  1HDJ A;  5BZB A;  3EVK A;  2QTO A;  4DV1 B;  1M5I A;  2Q7H A;  3P32 A;  1KU9 A;  3L9D A;  2OCH A;  4LFA B;  4DUZ O;  1GM7 A;  5FPR A;  1R6T A;  5AG2 A;  4LF4 B;  3RFR A;  4B3T O;  3AG3 B;  2V4D A;  3IGA C;  3K5N A;  4PI2 A;  2JIZ G;  4IL6 Z;  5IYB O;  2FYU H;  4BWA A;  3A2F A;  2HFE C;  1Y76 A;  1J5E O;  4JI1 O;  2PUS A;  2JDI G;  4RQE A;  3JAM N;  1F51 A;  1MSD A;  1SRY A;  3WB2 A;  4FLU A;  2QEX V;  4D6T H;  4X1K B;  1V9P A;  3HKD A;  3CJH B;  3AG2 B;  2LGW A;  2QTS A;  2P4K A;  1HR0 B;  1KUQ A;  1WNS A;  4CC6 A;  1HNW O;  1SA0 B;  5BR8 O;  4J7J A;  2YI9 A;  2PF4 E;  1BL8 A;  4O2B B;  1Q6H A;  4I50 B;  3AK3 A;  3BAA A;  1AJQ A;  1VIB A;  4W4L A;  1XMO B;  1MG1 A;  1NH2 B;  1PL4 A;  1XL4 A;  4B3R O;  4GX1 A;  4RUF A;  5EBM C;  3BA9 A;  1NBM G;  4PEL A;  1GN4 A;  1Q6I A;  4ZHQ A;  4C7U A;  4CZZ A;  5CB4 B;  2L35 A;  1KP2 A;  3N27 A;  1OCO C;  2AGA A;  1Y67 A;  1FAF A;  2F95 B;  1LUW A;  3QO8 A;  1S77 D;  5B3S C;  4LNU B;  3W7X A;  1PM9 A;  1R3J C;  1AR5 A;  4OXS A;  4WFH A;  2KG7 B;  3UO3 A;  2OT5 A;  4O4I A;  3ZRV A;  4ABM A;  2QSA A;  2Z3Y A;  4LC1 A;  2QM7 A;  3O9O A;  3KZI Z;  4QGP A;  4KHP B;  1OCZ B;  5DM6 V;  4GX2 A;  5EBW C;  1JPX A;  2Q67 A;  3K06 A;  3A8T A;  2XUM A;  4Q6G A;  2A3Q A;  4JTA B;  3ETG A;  4R50 A;  4DV2 B;  1BQ0 A;  4G2K A;  2ILM A;  1V55 B;  2VS0 A;  4LF8 B;  4LFB O;  4L8J A;  2DWD C;  2OIE A;  1VF6 C;  1KKD A;  1ZLZ A;  2YI8 A;  4UUJ C;  2E75 B;  4LF7 B;  1IBM O;  1N33 O;  4HNA A;  3BRC A;  3APO A;  3CSX A;  1HNZ B;  1P7G A;  3X2Q C;  5LP6 C;  1VQO V;  4PJ0 Z;  1Q86 W;  3DXR A;  4PI0 A;  3TGU H;  4KP4 A;  3T4Z A;  2P06 A;  4Z2W A;  3T1Y B;  4K8Z A;  4ZBM A;  2F93 B;  1FOU A;  3GWO A;  5A9G A;  4CC5 A;  3E35 A;  3FYE B;  4IIJ A;  2Q8V A;  2VQF B;  1Y74 B;  4O2A B;  4UCU A;  2BOC C;  2DQ0 A;  3HR0 A;  3ZHV A;  3L72 H;  1AB3 A;  3SYO A;  3KDR A;  1BGY H;  3SJB C;  1X59 A;  2MW2 B;  1IBL B;  3SJC C;  4FLT A;  2JGU A;  3ABK B;  3E22 A;  2EBO A;  2C2A A;  2JGD B;  3R65 A;  5LA6 B;  3H1I H;  1AIL A;  2FTK A;  1WB7 A;  2IU3 A;  1Q7Y W;  1RP3 B;  4NTY A;  1IXB A;  2WLN A;  1Q90 D;  3HKB B;  4DV3 O;  4NXM B;  2O57 A;  4X66 B;  4JI0 B;  1XNQ O;  5EYP A;  3H9V A;  3Q4H B;  4X65 O;  1H2K A;  4PV1 B;  2UUB B;  4ICG A;  3CE2 A;  1CPY A;  1AJP A;  1XMQ O;  2QJ1 A;  1F7Y A;  1VP7 A;  2UXD B;  1FFX A;  3JAL B;  4LFC O;  3AG1 C;  3C3T A;  4HYO A;  4NR1 A;  1IXM A;  2HEP A;  2QGN A;  4DRX B;  3JAS B;  3UO2 A;  4K0K B;  2YSU B;  5IT9 N;  1NR7 A;  4PA4 A;  1SET A;  3OGC C;  4BW9 A;  1NI8 A;  2ODM A;  1TGO A;  3B40 A;  1GKF A;  2IJJ A;  1MOF A;  4OX9 O;  4PA6 A;  3DC5 A;  1VQ9 V;  2XND G;  1XBL A;  4P2Z A;  2X6B A;  2MK3 A;  2ZE7 A;  3WG7 C;  2YIB A;  5B1A B;  4UVA A;  1NTZ H;  5A2Q N;  3N2G B;  2YIA A;  2DOS A;  2X6C A;  3CCU V;  2XT9 A;  1KBH A;  1M93 A;  5CN0 A;  1M56 B;  1MZF A;  2Q5Z A;  4U3F H;  3JAK A;  1M1K W;  1N34 O;  4GKJ B;  3JAT A;  3BAB A;  1QR8 A;  2F4V O;  4JI2 B;  4MTG A;  2Q68 A;  3SJQ C;  3ZHU A;  3JAR A;  3K59 A;  3QTC A;  4DR4 O;  4OGQ B;  1G1X B;  4L87 A;  4PA3 A;  4I0X B;  1F23 A;  1PNK A;  5IDJ A;  4K3A A;  5F2V O;  1FXK A;  1AP5 A;  4B3M O;  5K1P A;  2D3O W;  5JH7 A;  1SZT A;  2GDS A;  4IHJ A;  2GUZ B;  4JYA O;  2R70 A;  3CRQ A;  2DWE C;  3ZJZ A;  2BSK B;  1N4C A;  3FB7 C;  1SQV H;  4TQF A;  3LSU A;  3JAW B;  1YEW A;  3RYF A;  4JI5 O;  4MVS A;  5EK0 A;  4EFB A;  2ZT9 B;  3I55 V;  3G80 A;  3D36 C;  4X1Y A;  3JYC A;  5JVD A;  2IJI A;  2V1D A;  2PY5 A;  2WLK A;  1H2L A;  4FZ1 A;  2ZXW C;  1FKA O;  5LMU O;  2ZD9 A;  5BY1 A;  2H8P C;  1Q81 W;  1RSO A;  3ZN0 A;  4MW3 A;  2E5L B;  1Y4M A;  5EC2 C;  2WLI A;  4LF6 O;  4TV8 A;  1KMI Z;  3LUT B;  4TV9 A;  2HP8 A;  3ZHT A;  1KB9 F;  4O4H A;  2YUA A;  3TXQ A;  2HHH O;  5JQG B;  4ZOL A;  3HPL C;  1YZB A;  3ZIA G;  5LMN O;  5JCO A;  3CS5 A;  1K73 W;  2XAQ A;  5KAF Z;  3WU2 Z;  3WB1 A;  1ZAU A;  3H1H H;  4F4L A;  4DXW A;  5GON B;  3CHX A;  1SER A;  4H37 A;  1OCC C;  1E1Q G;  1SQG A;  2HVJ C;  4CBC A;  5IJ9 A;  1HP8 A;  2JVD A;  4JYY A;  1JA8 A;  3U0Z A;  2PI5 A;  5KMG A;  1COW G;  4IYI A;  4U3J B;  4AQY B;  3T1H B;  1AR4 A;  1E79 G;  5JWP A;  4LP8 A;  2Q4P A;  2KQX A;  4UXN A;  3JSL A;  4JAV A;  3RWR D;  4IGG A;  2F43 G;  1TUB A;  1SF9 A;  4FK5 C;  2HKO A;  4X62 B;  5CBF A;  1YSC A;  3CRM A;  3ETE A;  1GM8 A;  4I4T B;  1L1F A;  5KX5 B;  2FL4 A;  3ABU A;  4UCR A;  3K79 A;  1VQ4 V;  4EEQ A;  4J10 A;  4E4E A;  5KHJ A;  1OCO B;  3EXA A;  1K5S A;  2W6J G;  3U10 A;  3ZN1 A;  5B3S B;  4WF9 V;  4FLW A;  1BE3 H;  4JI4 B;  1H2M A;  1N32 B;  4A5U B;  1N0N A;  5TIS Z;  4E2L A;  4YHH B;  4YY3 O;  4O4J A;  1BT8 A;  5LGN A;  1M90 W;  1MSW D;  1MZE A;  1PNL A;  4Q20 A;  3WFV A;  2AZ2 A;  4JV5 O;  4X64 B;  3OM3 B;  1L0N H;  2IW5 A;  4FFB A;  1XHZ A;  1GAX A;  2ZE8 A;  1H8H G;  2CGN A;  3K5L A;  1WLE A;  3FAV A;  4B3S B;  2X7R B;  3N2K A;  1BHA A;  3MD0 A;  1GO3 F;  2LW7 A;  2UUA O;  4KL1 A;  5JJN B;  4DR2 B;  3QO7 A;  2Q7E A;  1E1R G;  2WLJ A;  4FLV A;  3FB5 C;  2ZE6 A;  4MW8 A;  4O4L A;  1GTO A;  4LF9 O;  3W7S A;  3X2Q B;  2ADP A;  3HKC B;  5LP6 B;  2EIJ C;  4N21 A;  3JAR B;  1OZ0 A;  1K92 A;  4YJ2 B;  4CS3 A;  1WA8 A;  1XDC A;  5H9C A;  4HAM A;  1JVM A;  3H01 A;  2ZDI A;  3ZMV A;  4FLY A;  1R3L C;  1THZ A;  1JJO A;  4JZG A;  4JI1 B;  2RN9 A;  1M4U A;  3JD1 A;  1R73 A;  3DTU B;  1U96 A;  1NTK H;  4DV5 B;  4NXN O;  3I5D A;  1DTO A;  5EBL C;  1QBZ A;  3ZMT A;  4K8X A;  2Q7G A;  5BMV A;  3ASO C;  1K3E A;  4JI7 O;  3FKS G;  4DW0 A;  5LXT A;  1K4D C;  4DV7 B;  4DV6 O;  4CH5 A;  4LH7 A;  1HNW B;  4DYL A;  4WCE V;  3OR7 C;  5L3B A;  5BR8 B;  3UQ8 A;  1WB8 A;  3CP1 A;  1NJI W;  5CMU A;  4DR3 B;  4DR6 B;  5H2F Z;  4H0L B;  4IYH A;  1JQ0 A;  4J9Z B;  3A0B Z;  3H1K H;  2LW1 A;  2Q73 A;  2JRI A;  4B3R B;  4DR7 O;  2EUL A;  4JI8 O;  3K0G A;  1IBK B;  1TVK B;  2CTP A;  4UV9 A;  1EN4 A;  1GN3 A;  3RYI B;  1NZ6 A;  4QJF B;  2VWK A;  4JI6 B;  4JF3 A;  4QPJ A;  1NU1 H;  1LNQ A;  2PTM A;  1F4M A;  3PJS K;  5L3G A;  2FKX A;  2GTA A;  1H2N A;  3JCZ A;  2LFS A;  3AG1 B;  2WLM A;  1FJG B;  2YEV A;  1V54 C;  3LNM B;  1SQQ H;  2VQE O;  4PDR A;  3OMI B;  5D5P A;  2CUG A;  1YDX A;  4BIU A;  2ZCE A;  4QNH B;  5KMG B;  4DR5 O;  4F6E A;  3CB2 A;  3FX7 A;  5ITZ A;  3TXS A;  1K7D A;  4LCU C;  4PDL A;  5BXZ A;  4QIW F;  1QVG U;  3P3N A;  2DYR C;  3K04 A;  3WG7 B;  3D3I A;  4ZI7 B;  4WFE A;  4JYB A;  2ZKO A;  4R6Z A;  3F7V C;  3ZHQ A;  4UFZ A;  5CA0 A;  1KC8 W;  2ZM6 B;  2QM4 A;  1OHH G;  2CDY A;  3ZRW A;  1IBM B;  2PYL A;  5KHI A;  3HKE A;  2RMK B;  1BMF G;  3IJ4 A;  1AI6 A;  3KCY A;  1W59 A;  4CH4 A;  4LR3 A;  2Y48 A;  1R1B A;  2QWN B;  2P5O A;  4DK1 A;  4FLZ A;  4XDK A;  1EZJ A;  1HR0 O;  1FS0 G;  2YXL A;  2LGQ A;  4ZIB A;  2DQ3 A;  2PYJ A;  1KYO F;  4X1I B;  5KUM A;  4LWS A;  4DV0 O;  3RW0 A;  1QCE A;  1AI7 A;  3ETD A;  2X0L A;  1TAE A;  1DK1 A;  2YS8 A;  2XAH A;  3WB0 A;  1XMO O;  4UVC A;  1D5A A;  3N2K B;  4X89 A;  3LNN A;  1YF2 A;  3K9S A;  4MVU A;  4JI3 B;  4Z1V A;  1H2G A;  3IAY A;  5LBQ A;  1QR9 A;  2ZXW B;  5IYZ A;  2E76 B;  3CRA A;  3JD4 A;  1SZX A;  1UFI A;  2YC0 A;  1FD9 A;  2A0L A;  5CA1 A;  4FM2 A;  1Q43 A;  3AG4 C;  1JX9 A;  2F1M A;  1CP9 A;  1K8A W;  2W0F C;  1K5Q A;  5GTH Z;  1NVP D;  2NNU A;  3L73 H;  3M8A A;  3ZHR A;  3O65 A;  1FXK C;  2EJ7 A;  3ZMU A;  3ASN C;  4X65 B;  1NKD A;  5H6R A;  1VAR A;  2WA4 A;  4XDL A;  5C8Y A;  5GW7 A;  1I94 B;  4KHP O;  1NTM H;  1G4Y B;  2VWJ A;  2A9H A;  1NR1 A;  3SPJ A;  4LFC B;  1OCC B;  4CS4 A;  4MVM A;  4EB6 A;  1Q3E A;  3D3Q A;  4DV2 O;  3LDE A;  1N36 B;  3E8G A;  3L71 H;  5IYD O;  2GBO A;  5LXT B;  3EHB B;  3ZX6 A;  3OR6 C;  4LF8 O;  4J80 A;  5LYJ A;  3OFN G;  3APQ A;  1RPO A;  1KKC A;  3ABM C;  4EFE A;  3RVZ A;  4UB8 Z;  4OX9 B;  4LF7 O;  3JD2 A;  3T1C A;  1SQF A;  4NTW A;  3SJA C;  2QWO B;  1HNZ O;  3E8B A;  4UVB A;  1RFY A;  2YIB D;  1Z5W A;  4W4K A;  2YXH A;  1JR9 A;  1AR1 B;  1Q6U A;  2Y0P A;  5JCO C;  1JFF A;  2XAJ A;  1I5X A;  3K0D A;  4CS2 A;  1Y76 B;  4I5S A;  5IY5 C;  3LDC A;  4F6R A;  3SPC A;  2QE7 G;  2NLJ C;  5GTI Z;  1VQP V;  3T1Y O;  1U97 A;  4UCO A;  1VQ5 V;  3DC6 A;  1WJZ A;  1ZL8 A;  3OTO B;  4DR1 O;  3B8M A;  3HKD B;  1VQ7 V;  3CC2 V;  2F4V B;  3W7W A;  5B1B C;  5J2U A;  4I9Q A;  4GKK B;  3ZBH A;  4MVO A;  1GM9 A;  1MMM A;  4YJ3 A;  2XAS A;  2UU9 O;  1IBL O;  3BPZ A;  3R66 A;  3P30 A;  3CXH F;  3RYC A;  5LOV A;  1B3Q A;  1EM1 A;  3JSN A;  5IWA O;  3W7U A;  2BTO A;  3G71 V;  2UXN A;  4ZHQ B;  4UCS A;  4I55 A;  3IC9 A;  4JI5 B;  2A7W A;  1MNG A;  4FPP A;  1S3J A;  4NXM O;  1MA1 A;  2PGG A;  4X66 O;  4JI0 O;  5B5E Z;  1UJW B;  1YJ9 V;  4X8A A;  5LMU B;  2UUB O;  5CA0 B;  3K03 A;  3RYH A;  1OCR C;  4D7S A;  3STL C;  3G4S V;  5IJ0 A;  2CK3 G;  3SYQ A;  4X20 A;  3UT5 A;  2QDO A;  4O4I B;  2EIJ B;  1O9G A;  3CWB H;  2XTA A;  4LF6 B;  3RGB A;  4I7Z B;  5FNV A;  2R9R B;  1RM1 C;  5K1X A;  4JTC B;  3AG7 A;  4U7O A;  5HFL A;  3VQX A;  3BY6 A;  2CH7 A;  2ETN A;  2JEU A;  4KXR A;  1QLE C;  3AEI A;  2PZS A;  4K0K O;  1N0J A;  3MAQ A;  2P67 A;  4WFG A;  3QF7 A;  2ZNJ A;  1D5N A;  2H94 A;  3K9A A;  3E83 A;  5J9P C;  2XAG A;  1FXV A;  2BOB C;  2QKC A;  4FM0 A;  2EX3 A;  3CC7 V;  2WLL A;  3C3S A;  3ASO B;  3KG2 A;  4QE9 A;  1Q5O A;  1S76 D;  3MDS A;  4H13 B;  1YXB A;  3HB3 B;  5LGU A;  4GT1 A;  3B2E E;  4FZ0 A;  5LHG A;  4HNA B;  2IH1 C;  4TUY A;  3SPG A;  1HNX B;  1H2S B;  2GSM B;  5EIB C;  4TSF G;  4WFF A;  4GKJ O;  4AI8 A;  3A0R A;  3DXR B;  3IFX A;  3CRR A;  3OT7 A;  4JI2 O;  1GMG A;  3K3W A;  4WBN A;  1H8E G;  2M7W A;  5D5Q A;  2ARH A;  4DUY B;  1ENV A;  2ZDI C;  3STZ C;  1BCC H;  3S3W A;  2V7Q G;  1P4R A;  5C8Y B;  4R7C A;  4IIJ B;  1PKX A;  3DGE A;  1K9M W;  2LP7 A;  3F5T A;  3OUF A;  1V54 B;  1VQK V;  3ICX A;  1VEW A;  3FB6 C;  1J95 A;  4DV4 O;  1PD3 A;  3J81 N;  2LFR A;  1YHQ V;  3L75 H;  3CJH A;  4JV5 B;  5KA5 A;  3E22 B;  1QNM A;  4GCZ A;  4PA7 A;  2UXC B;  1L0L H;  1QU7 A;  2EIL C;  3CYO A;  1SA0 A;  3CCS V;  2LJ2 A;  1NT2 B;  4O2B A;  3IC7 A;  4I50 A;  3E8F A;  1IX9 A;  2DYR B;  5B1O A;  1QQC A;  5CBH A;  1NVP B;  4B7E A;  1WN7 A;  4JAU A;  5EYP B;  1TUE B;  2IJK A;  1P84 F;  1KD1 W;  1PL0 A;  2ZIM A;  1ARO P;  4QE7 A;  2EJR A;  5CB4 A;  3OD4 A;  3NR7 A;  1FFX B;  5EC1 C;  2Y69 C;  4BAY A;  1QVF U;  1YJW V;  2AZ0 A;  4FFK A;  5EIB D;  4LNU A;  2JS3 A;  4H33 A;  3SGI A;  2A79 B;  4NB5 A;  1SES A;  3M7M X;  2KG7 A;  4UCV A;  1I5Y A;  3GB7 C;  2ADQ B;  4LF5 B;  1K33 A;  1EZV H;  3E8H A;  1M57 C;  4AQY O;  4LH6 A;  3FD9 A;  3T1H O;  1IDS A;  1YVW A;  2EIM C;  4DW1 A;  2B1I A;  5E79 Z;  3OGI B;  3F7Y C;  3UCS C;  1W0K G;  3JD3 A;  1WPB A;  2WAM A;  4G27 B;  4JYC A;  3FB8 C;  4XBF A;  3GWK C;  1XNR B;  3OEH G;  5LGT A;  2PI4 A;  4QPK A;  1K34 A;  4X62 O;  4I55 B;  2X6A A;  4J7K A;  2RDC A;  3JAK B;  4DV6 B;  2QR4 A;  1Z5V A;  3JAT B;  3FFQ A;  3DSQ A;  4DUZ B;  2JS5 A;  1VF7 A;  1URF A;  2CTQ A;  4WFB V;  3RT3 C;  3AG4 B;  5IJ0 B;  5J2T A;  4X20 B;  2EZO A;  2F66 C;  1H38 A;  4B3T B;  1N32 O;  3ABT A;  2WSS G;  4YHH O;  1FXK B;  2OTJ V;  2QWQ B;  5L3C A;  5KA6 A;  1H5W A;  2E3C A;  3TK1 A;  3ASN B;  2OTL V;  5KAI Z;  4TQD A;  2Y4U A;  1Z2G A;  4IHJ B;  5JH7 B;  1J5E B;  2RNB A;  2W6I G;  4GUN A;  2NN4 A;  4X64 O;  1AP6 A;  1GRJ A;  1D2D A;  1RPR A;  5HFM A;  3RYF B;  3QNE A;  2DMX A;  3ZRS A;  2UXB O;  1Y74 A;  4O2A A;  2VQE B;  4WFA V;  2EZP A;  4GYC B;  4X1Y B;  5JVD B;  2N74 A;  2JJ2 G;  2A06 H;  1Q82 W;  3VBB A;  1BZK A;  2JJ1 G;  2K1E A;  2D2C B;  1RSO B;  4ZKI A;  1K97 A;  2UUC O;  2QM8 A;  1ZUQ A;  2ZIO A;  2WLI B;  4DR2 O;  3ABM B;  1Y66 A;  2JGD A;  4TV8 B;  3BFR A;  2E74 B;  4PD4 F;  1B6Q A;  2BTQ A;  2OWO A;  3MHH C;  1NQT A;  1EFR G;  4TV9 B;  5LA6 A;  3CXC U;  4O4H B;  5CA3 A;  3L74 H;  4WBN B;  4ZOL B;  3HKB A;  1NS1 A;  2YID A;  4MVQ A;  1BHB A;  1FXH A;  3T4D A;  5DN6 G;  5IY5 B;  1GK9 A;  3TCU A;  4NYK A;  3Q4H A;  2RJZ A;  1US6 A;  3GVM A;  3ZMS A;  1LR1 A;  5CBG A;  1R3K C;  4P30 A;  1XOU A;  2F23 A;  3D8C A;  2LQT A;  4AHC A;  5IJ9 B;  5B1B B;  2CTW A;  4YXW G;  3H1J H;  1XEQ A;  4CH3 A;  3JAL A;  4UB6 Z;  3W7T A;  4JTD B;  1VQN V;  2CTR A;  2KB1 A;  4FLX A;  4J42 A;  4DV5 O;  1IZ3 A;  4ASU G;  1ZSP A;  4P9P A;  4RUE A;  1I7F A;  4DRX A; 
#chains in the Genus database with same CATH homology
 1BS3 A;  2AW9 A;  1QNM A;  2CDY A;  3LSU A;  1LUV A;  1AVM A;  1XIL A;  2QKA A;  1N0N A;  4YIO A;  1EN5 A;  4JZ2 A;  3AK1 A;  3C3T A;  1EN6 A;  1BT8 A;  1KKC A;  1IX9 A;  1WB8 A;  1MSD A;  1ZLZ A;  4GUN A;  1N0J A;  1AP6 A;  1D5N A;  2P4K A;  1JR9 A;  1P7G A;  1EN4 A;  1GN3 A;  3TJT A;  2QKC A;  2RCV A;  3C3S A;  1I08 A;  3CEI A;  3DC6 A;  3AK3 A;  4FFK A;  3MDS A;  1GN2 A;  3K9S A;  3DC5 A;  1PL4 A;  2CE4 A;  1ZUQ A;  5A9G A;  3AK2 A;  3BFR A;  1GN4 A;  2ADQ B;  1SZX A;  4C7U A;  4BR6 A;  4X9Q A;  4JYY A;  1MMM A;  1IDS A;  1JA8 A;  4F6E A;  1Y67 A;  3OT7 A;  1ZTE A;  3KDR A;  1LUW A;  1AR4 A;  2ADP A;  1BSM A;  3KKY A;  3RN4 A;  1PM9 A;  1EM1 A;  1XDC A;  1AR5 A;  1I0H A;  1VAR A;  3QVN A;  1B06 A;  1XRE A;  3EVK A;  3IC9 A;  1AP5 A;  1MNG A;  1WB7 A;  1GN6 A;  4JZG A;  1MA1 A;  1VEW A;  1IXB A;  2GDS A;  4YIP A;  1ZSP A;  5AG2 A;  1XUQ A;  4E4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...