3AK1A

Superoxide dismutase from aeropyrum pernix k1, apo-form
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
MVSFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAVMRDFSFNYAGHIMHTIFWPNMAPPGKGGGTPGGRVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDPLTEELRILQVEKHNVLMTAGLVPILVIDVWEHAYYLQYKNDRGSYVENWWNVVNWDDVEKRLEQALNNAKPLYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn/Fe]
publication title Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 - insights into the enzyme mechanism and stability
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 76
structure length 212
sequence length 212
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ak1A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ak1A02
3K9SA 1BS3A 3C3TA 1BT8A 1IDSA 3DC5A 1EN5A 4F6EA 1IX9A 1GN4A 1WB8A 3AK2A 1AR5A 1Y67A 1VARA 3MDSA 2QKCA 1IXBA 2AW9A 1EM1A 1GN3A 1XDCA 1LUWA 2CE4A 1EN4A 1I08A 4YIPA 1LUVA 1MNGA 1GN2A 1JA8A 2GDSA 1PM9A 1ZSPA 4GUNA 1AP6A 1JR9A 1SZXA 1GN6A 5A9GA 1MA1A 4JZ2A 4JZGA 1WB7A 2CDYA 1XILA 4BR6A 2RCVA 2QKAA 1N0NA 1AVMA 1PL4A 4YIOA 3IC9A 3OT7A 3EVKA 3AK1A 1AR4A 3QVNA 1XREA 3RN4A 1XUQA 3LSUA 3TJTA 2P4KA 2ADQB 1BSMA 1B06A 1KKCA 3DC6A 3KKYA 1QNMA 1P7GA 1N0JA 1I0HA 1EN6A 5AG2A 1VEWA 4E4EA 1D5NA 3C3SA 3CEIA 3AK3A 4X9QA 1MSDA 4FFKA 1ZTEA 4JYYA 4C7UA 1MMMA 1ZLZA 2ADPA 1AP5A 3BFRA 1ZUQA
chains in the Genus database with same CATH superfamily
4MVSA 3C3TA 2EULA 1YJNV 2A06H 4JTAB 1QLNA 1R6TA 3FKSG 1GM7A 1KB9F 3UT5A 4F6RB 1NTMH 3JALA 4LF7B 2KG7B 3L9DA 4R6ZA 5IWAO 4GX0A 3ZRSA 4JGSA 1SA0A 5GTHZ 4FVMA 1GN3A 2LGQA 5GONB 1EZVH 1JOYA 1U96A 5LGUA 1SQXH 1SRYA 2JEUA 5DEDA 2GSMB 1ZL8A 1F23A 1I08A 1YTFB 4WCEV 2UUCO 1XHZA 3BCCH 1FS0G 2F93B 1V54C 3CCEV 3OUFA 2WLLB 5CBGA 1URFA 3E86A 4D6TH 5L3BA 4K8XA 1XILA 1FJGO 5A2QN 2HEPA 5BY1A 1GKFA 3B8NA 2AZ0A 4WFFA 4RAIA 3IC9A 2QWPB 4UCSA 1PNKA 2UXXA 3QVNA 3JSLA 1LR1A 1VF6C 4CS4A 3B2EE 1VF6A 1SA0B 4ZKIA 4QJFB 3SJQC 5B66Z 3F7YC 4PA9A 3TXQA 1I0HA 1EN6A 1ZL8B 4MVQA 2JIZG 1RP3B 2MW2B 1W59A 2QWOB 5LMUO 3STLC 1V54B 3MD0A 2UUAB 1P4RA 1NTKH 3ZMSA 1KECA 1Q6HA 3CHXA 5CB4A 2B1IA 1SESA 4J9ZB 4FFBB 1G8MA 1WP7A 2Z3YA 3Q4HB 3F5WC 2QDOA 1YTFD 1YSCA 5C8YA 3CX5F 2XASA 1XHXA 3HR0A 1R3IC 2EJRA 3OD4A 4X64O 4LF9O 5CA1A 3RYCB 1P84F 2JEXA 5ITZB 4TUYA 2C2AA 1Y6XA 4NTXA 4WFHA 2E75B 1BQZA 1YHQV 5IWAB 2QSAA 3UCSC 2R70A 2EZPA 4GX5A 2JK5C 3JD3A 4FLYA 2Z5UA 3CXCU 1EN4A 1X4TA 3P30A 1R3LC 1KC8W 1YEWA 3EHBB 4PDLA 3RVYA 1JVMA 1F4NA 5KA6A 2EINC 2OYQA 2UUCB 2OCHA 2EZOA 1Q43A 3BPZA 4XDJA 2ODMA 1WA8A 5J2UB 5CB4B 1Z5WA 3X2QC 1R3JC 3SPHA 1N34O 3LNNA 2JRIA 5C8YB 2ETNA 1FJGB 2W6IG 1G1XB 1WP8A 1RSOA 3GWOA 2AGAA 3ZJZA 5CA1B 1XREA 5KUKA 2DWEC 3B40A 4N23A 4AILC 1W0JG 1YJWV 3ZRWB 5BZBA 3W7UA 3TETA 5B1BC 2Q0AA 4DV5O 4FJCC 2WPDG 2V1DA 4P30A 1OHHG 5EIBC 1K4DC 2DQ0A 1JCHA 4JYAO 5KA5A 4GX1A 3E8GA 1Q82W 4K35A 4RWUA 5LYJA 5B3SB 4UUJC 4U3FH 1GO3F 2XAGA 1WA8B 2EINB 2GUZA 5LMUB 1XQ8A 1SC5B 3D8CA 3SPIA 4B08A 3OW2U 3OUSA 3X2QB 4MW3A 1FXVA 4U7OA 4R7CA 3CSXA 1BGYH 1RSOB 4JAAA 4JI0O 5KHHA 4HNAB 3JD0A 2HFEC 3BABA 1GAXA 4X64B 2QE7G 3ZHUA 4LF9B 1HP8A 3DGEA 4J7JA 1M9NA 3VQXA 3FD9A 1EZJA 2VRZA 2H3OA 2QM7A 4DR3O 3AG3C 2EILB 2L35A 1LUVA 2WLMA 4YIPA 2LO1A 3K3WA 1NBMG 4ZHQA 4RQEA 3WG7B 3OMIB 1GN6A 2YIBA 1OCOB 4NXNO 5JWPA 2Q73A 1VQOV 1JFFA 1GRJA 2JJ1G 5LHGA 3RWRD 1R1BA 2EIKC 2BSKB 4IYHA 2DW4A 1ZWIC 2G38A 2F43G 4A5UB 5KAFZ 5BR8O 1N34B 4J42A 4X1KA 5EBMC 3SPJA 2LW1A 3LSUA 3G80A 1O9GA 3QG5A 3RW0A 2HG5C 2Y4TA 2LFRA 1AI4A 1Q5OA 5DM6V 2AHZA 1VEWA 1THZA 2XTAA 3AG3B 1F4MA 4DV5B 4UCOA 2N05A 1FFXA 2BTQB 3W7SA 1VQ7V 1MSDA 4QE7A 3ETEA 2ZNJA 3VBBA 4PDRA 1WJZA 4JYAB 2DYSC 2E76B 2W6JG 4KUMA 1JFFB 2ZE5A 4FLXA 1KP2A 5KAIZ 2DOSA 2EIKB 5EIBD 5IDJA 1ZAUA 3PJSK 2A9HA 3A0HZ 1M1KW 4X1KB 4BIUA 2UU9O 4MT8A 2AXTZ 3P32A 2YICA 1O9HA 2IH3C 1FD9A 3ZN1A 4JI0B 3SPGA 5FLXN 1SERA 4R50A 1S5LZ 1SS3A 4J9YB 2UUBO 2YUAA 4JASA 2KB1A 2FYUH 4DR3B 1I5XA 2CDYA 2YDEA 2DYSB 3CE2A 3HKEA 4UVCA 2B5UA 1Y74A 1AJNA 4NXNB 4MSWC 4DO2A 5KMGA 1J5EO 3R65A 3T1YO 1PPJH 3NR7A 3VQVA 2YIBD 3RBZA 1TUBA 1IBLO 4EB6A 3WB2A 1S72V 5BR8B 2YEVA 4X1YA 1B06A 1KKCA 3AG4B 3OAAG 1NKDA 1PNMA 4MVMA 3ABLC 1VP7A 1F51A 3J80N 1GK9A 3BRCA 4FZ1A 3AK3A 1XNQO 1XMQO 5EBWC 3L75H 3LDCA 2RNBA 4J80A 3OEEG 1RM1B 4JAUA 2ADPA 1FXKC 3CB2A 4LH7A 1NJIW 3BFRA 4I50A 3ZN0A 1G6UA 1GM9A 1FXKA 3KCXA 1K5SA 2WA4A 2RQ6A 3HKEB 1WN7A 3H1LH 1Y74B 3WB1A 2CH7B 3ETGA 2CGOA 4FLUA 4YHHO 1AR5A 3G6EV 1WLEA 1W2BU 1YJ9V 1DK1A 3H9VA 2PYLA 3MDSA 3N2GA 4EB6B 5J9PC 4WFAV 1B3QA 4P9OA 2PYJA 5D5QA 2UU9B 2DYRC 1VQ6V 3D36C 2HJDA 4B3TO 3ABLB 4MVZA 4Z2WA 3D36A 3GB7C 4TT3G 2LJ2A 4O2AA 1N32O 1AI5A 4MS2A 1Y66A 3ASOC 4WFBV 3K5LA 1FOUA 4I50B 4R8CA 2UUBB 3IC7A 1FXKB 5IYDO 1VQPV 2Q69A 1K73W 1Z5VA 1GM8A 4MTXA 5DN6G 3ZMTA 1WPXA 4B3RO 4MVUA 5L3CA 3JARA 1AR4A 3KCYA 3RYFA 1H2NA 3N2GB 1R6NA 1J5EB 1IBKO 2P22C 3T1YB 2OTJV 2CUGA 1IBLB 1YZBA 4PDVA 2DYRB 1VMGA 4X89A 1Y76A 4JI2O 4LWSA 3ML0A 4QE9A 1F7YA 3HB3B 4X62O 1M90W 4PD4F 1BE3H 4O4IA 2Y48A 4NTWA 3ASOB 1XNQB 1XMQB 4DV6O 1OCRC 1R73A 2BOCC 2ZIMA 4JI3O 4TOIA 2WAMA 3K57A 3ZHVA 1IJGA 3UQ8A 1XL6A 3L72H 3STZC 2EIMB 3AK2A 4WFEA 5H2FZ 3JARB 4F4LA 3RYFB 4DV4O 4RO2A 4YHHB 2Q67A 2DMXA 2Q9LA 3JAMN 3OMNB 3TXSA 1QQCA 2ZINA 1VQMV 4AQYO 2CE4A 3K5OA 2Y0PA 1SQGA 2HR3A 4LWSB 4QPKA 4FPPA 4TQFA 1FFTB 1OCZC 4GZRB 4MW8A 4LFAO 3CCUV 1JR9A 1SZXA 4B3TB 4FLVA 1DF4A 2W0XA 1N32B 2RCVA 2YI8A 1P7BA 5CA0A 2P90A 4DV2O 4FZ0A 1ORQC 1BL8A 3H1KH 2PGGA 4IGGA 1ZX3A 1MZEA 2XHBA 4BW5A 2ZXWC 1XEQA 2V4DA 3K5NA 3OR6C 4WBNA 5BXZA 4FIPC 4B3RB 3AEIA 1Y4MA 3JD2A 3ETQA 2Q7GA 1NVPB 1QNMA 1H5WA 2EBOA 3CPWU 3KDRA 1JMKC 1IBKB 3FYIB 1MG1A 4CH6A 3UT5B 1KQSU 5EC1C 1HWYA 4NYKA 4J11A 1HNZO 4AI8A 3JALB 4JI2B 4PI2A 1A32A 1OCZB 3CWBH 3SGIA 4J7ZA 4X20A 2O57A 3FFQA 4X62B 5H9CA 3CCRV 2QR4A 4LC1A 2D2CB 5CA0B 3IAYA 2ATKC 3S3XA 4UB8Z 4DV6B 1NR1A 5H6QA 4JI3B 1JQ0A 3M99B 2ZXWB 2P4VA 4TSFG 1JJOA 1GTOA 4FK5C 5FNVA 1DTOA 1EM1A 2QTSA 3K0DA 2P67A 1YIJV 4DR4O 1B04A 2CGNA 1BHBA 4DV4B 4D7SA 2F66C 4AQYB 2RDCA 4YY3O 5EK0A 1PM9A 3W7TA 3I55V 4JZ2A 4P9PA 4X20B 3G71V 2JGDA 1B6QA 1NVPD 4ZI7A 4DW0A 4LFAB 3N2KA 5L3GA 3E89A 3B77A 2IU3A 3PN1A 4H37A 1PL0A 1YI2V 3DTUB 3ZHQA 4DV2B 4QNHB 1AI6A 1Q6UA 1TVKA 2FTKA 1ENVA 3JASA 4CH3A 5FNVB 1HR0O 1UPGA 5HFLA 1CPYA 3KKYA 3SR2C 1AROP 2F4VO 1CXZB 2QGNA 5AG2A 3K06A 4I7ZB 4KP4A 1XOUA 2HVKC 2M7WA 3C90A 1TAEA 1YF2A 3K04A 1JX9A 1N8RW 3AG1C 1IVSA 2JS5A 2ITCC 1QLEC 3E22A 2Q6AA 2ZR2A 1EFRG 4FMTA 2ARHA 2OCCC 4TUYB 4K0KO 3CCJV 4ZI7B 2QM4A 1HNZB 1BHAA 3K03A 1BQ0A 2FB5A 4Z1MG 1YITV 2QWQB 3APQA 1H2LA 3ZRVA 4CS2A 4F6EA 5E1AC 4L8JA 1WB8A 1N36O 4DR1O 2ZKOA 2PY5A 1M5IA 1H8EG 1TVKB 3ZEDA 3JASB 5GTIZ 1IXBA 3ZX6A 2X6BA 2VWKA 3ABKC 1LUWA 5CBHA 1N4CA 4LR3A 2NLJC 4NKGB 2IH1C 4DR4B 1GN2A 3JYCA 2GDSA 3CCMV 1NZ6A 3AG1B 5TISZ 3A2FA 1QLEB 4X88A 2HKOA 1KKDA 4YY3B 2OCCB 5LOVA 2YIAA 1H2SB 5B1BB 2F23A 1PL4A 1Q6IA 2LP7A 1OZ0A 3SYCA 2PI4A 3ZMVA 1NQTA 4JI8O 1SZTA 3EVKA 4UXNA 4JF3A 2DQ3A 3OMAB 5LYJB 2ZCEA 2QKSA 2LW7A 3TCUA 3A8TA 4UB6Z 2GUZB 3K5MA 4W4KA 1VF7A 3CRRA 3ABKB 2L6LA 3T4DA 4ICGA 3CC2V 1TUEB 4PA6A 3ZRXA 4DR2O 1HR0B 3CEIA 4DYLA 2F4VB 5F2VO 1DF5A 3BA8A 1S0VA 2WLHA 5BMVA 3T4ZA 5LL6Y 4I0XA 3M8AA 4JI6O 4PV1B 5LOVB 2DE0X 2B9ZA 4CZZA 2F95B 4ZOLA 2GV9A 2KSDA 4K0KB 3SJBC 4DV7O 4GLXA 3CC4V 4ZHQB 3K08A 4J41A 4Q20A 5KHGA 4JI7O 1N36B 5LXTA 2YXYA 4UVBA 4DR1B 2BTOA 2ZDIC 4UVAA 3UO3A 5LGNA 3HKBA 2ZDIA 5LHHA 4IT5A 1Q86W 5KHIA 1QVGU 1XNRO 3BAAA 1SETA 3JD1A 4NTYA 4DW1A 1ZSPA 3LDEA 2IJKA 2WWWA 2A7WA 5BMVB 3S3WA 3K59A 4LNUA 3ZCCA 2UXBO 2R9AA 4ZOLB 1S5JA 3T1CA 1NT2B 5KHJA 1FFXB 4N21A 5JCOC 1G4YB 1HNWO 4TV8A 5J2TA 2OWOA 5JCOA 4LFBO 4FLWA 4JI8B 5LXTB 1H8HG 3THOA 1W0KG 2BCCH 2WLNA 2IJJA 3CCLV 1X59A 1YXBA 1YVWA 3C3SA 4PJ0Z 1AR1B 4TWKA 2PTMA 5L3EA 1WNSA 2DWDC 2Q68A 1ZTEA 2Q8VA 3CCVV 1NI8A 4I5SA 5H6RA 2K9PA 3OTOO 1QBZA 3AG2C 4UV8A 2UXDO 4K8ZA 4UFZA 4IHJA 3D3IA 3UO2A 4CH4A 4JI6B 4X1IA 3TGUH 1Y67A 2EJ7A 2YS8A 5K1PA 4TV8B 5J2TB 4DV7B 5FPRA 3M7MX 4OPHA 4YJ2A 2A79B 4GKKO 2OTLV 2FMLA 4RUFA 4UCVA 2A3QA 4JI7B 3ZBHA 2BOBC 1VQKV 1MNGA 5KX5A 3ASNC 5KMGB 1RPRA 3U11A 5LGTA 2VQFO 3H1HH 1AJPA 1TUBB 4DK0A 3QTCA 5LP6C 1XNRB 1HW7A 3SYPA 1N33O 4B3SO 5LP6A 2YEVB 1FYJA 3KZIZ 4X1YB 5LA6A 3AG2B 1HNXO 2QKAA 1FPOA 1JNBA 3P3NA 4JPRA 4DR6O 1GMGA 3D3QA 4G28B 4PA4A 4IHJB 1M57C 3U0ZA 4HBNA 4X1IB 2UXBB 4GYCB 1H2GA 1BMFG 3RN4A 1SF9A 2Q7EA 2JVDA 3TJTA 1QVFU 4YJ2B 3CXHF 5L3DA 2Q4PA 3QF7A 3T2MA 1BSMA 3I56V 1R3KC 1VIBA 1NH2B 1HNWB 3MHSC 4JYBA 5LHIA 4U3JA 4QIWF 4EKWA 1T5EA 2XUMA 3VQWA 4LFBB 1Q7YW 2PF4E 4DV0O 5JJJB 4E4EA 4ZIBA 1YDXA 3JD4A 5LMNO 4ABMA 5KX5B 1K8AW 4I55A 2LQTA 4LBEC 3ASNB 1IURA 4DR7O 1D2DA 1UFIA 2NNUA 4LF6O 1H2KA 1MMMA 5CMUA 3CS5A 2IBZH 3FYEB 4WF9V 5LP6B 2R72A 5LA6B 4B7EA 1BS3A 4G2KA 3W7XA 4B3MO 4P2ZA 5C93A 3DC5A 3OTOB 3CCSV 4ASUG 1IX9A 1M57B 3OEHG 3L70H 4BWAA 2UXDB 1PV0A 1XBLA 1K4CC 4MVOA 4O2AB 1SQQH 1IBMO 1TA8A 3IJ4A 4QGPA 5B1NA 3FB5C 2GTAA 4J7KA 1AILA 4XDKA 4OX9O 1CP9A 3AG7A 2Z0AA 3VOUA 3DXRA 4GKKB 4OPAA 4F6RA 4I55B 1SQFA 2KG7A 4DXWA 1JA8A 3RYIA 4J10A 5A9GA 4GKJO 3CCQV 2X7RB 4JZGA 4X8AA 1NH2D 2RJZA 5IJ0A 2VQFB 3L73H 3B8MA 1PKXA 4JTDB 3J81N 4I9QA 2OT5A 3JAWA 1H2MA 1Y76B 3U10A 1N33B 4B3SB 1XMOO 2XAQA 3LUTB 4FM1A 1HNXB 4XBFA 4DR6B 3A0BZ 1XL4A 2IU0A 4JI5O 1XUQA 3BA9A 2QWRB 4O4IB 1KBHA 2ADQB 2IJHA 2B1GA 4H0LB 3CP1A 5EYPA 4I9WA 2QEXV 3GVMA 3HKDA 1E1RG 1OCRB 3RGBA 2QTOA 3CC7V 3DXRB 1QCEA 2AHYA 1I94O 3G4SV 1VQ4V 4UCRA 4DV0B 3RYIB 2CAZC 4FM0A 4JYYA 3GWKC 5LMNB 3SJAC 2P7TC 1SQBH 3K9AA 3EFFK 5IJ0B 4JI4O 4DR7B 5FL7G 3APOA 3JCZA 3G6BA 1BT8A 4LF6B 3JAWB 4DV3O 4LCUC 2Y69C 2ZQMA 4JV5O 1US6A 2W0FC 4B3MB 1Q3EA 4W4LA 3TK1A 4UCUA 1MZFA 1MABG 3HKCA 2XOKG 5EYPB 4FFBA 3HKDB 3Q4HA 1IBMB 3SJCC 2N74A 2WLIA 1TGOA 1PD3A 4OX9B 2M6YA 1I7FA 1MOFA 1K7DA 3RYCA 1JJ2U 5ITZA 4WBNB 1LNQA 1S5HC 4GCZA 1K97A 4MTOA 4GKJB 1AVMA 4DR5O 2IW5A 3CD6V 1KU9A 5IYZA 2XT9A 4NXMO 3K79A 1WPBA 1K5QA 2Y69B 3OR7C 5D5PA 1XMOB 5J2UA 2P4KA 1SQVH 3HKCB 2AZ2A 4YXWG 3CJHA 1S3JA 1KD1W 2ZIOA 4UCTA 2GBOA 4JI5B 2WLIB 4CS3A 5L3FA 1HDJA 4XDLA 4DUZO 4CBCA 1M4UA 2Q7HA 3VQYA 1SKVA 3OFNG 4TV9A 1L0NH 2ZM6O 4X65O 2R9IA 3ZRWA 1I94B 4AHCA 2ZT9B 4CC5A 4KFMA 4JI1O 3K9SA 1IDSA 2YIDA 1EBOA 3SDLA 1BZKA 1NS1A 2NR5A 1GN4A 5IYZB 5B3SC 2EIJC 4JI4B 2P5OA 3ZHRA 4OXSA 4DK1A 5GW7A 4YJ3A 3B4SA 3QO7A 2E5LO 4DV3B 2ZNIA 3OGIB 3CJHB 4X66O 4WFGA 4DUYO 4JV5B 2JGDB 5IYBO 3K58A 3N2KB 4MTGA 1QHTA 3BVOA 5IY5C 1S76D 2VQEO 1NR7A 4DRXA 2JGUA 4TV9B 4PI0A 4EFBA 1WAZA 5JVDA 1AB3A 4HNAA 2HVJC 2XAFA 4BIZA 3ZS8C 5JH7A 2PZSA 5IJ9A 4KL1A 1AJQA 4EEQA 2D3OW 1V9PA 3ZIAG 2EILC 1NTZH 1KP3A 3A0RA 2CTQA 2Y0IA 3FB8C 2N04A 4U7NA 3R66A 3WG7C 3FB7C 3DSQA 2EIJB 2X0LA 2OIGA 4YJ3B 1OCOC 4DR5B 4LF5O 2PI5A 5IYCO 4QPJA 4NB5A 3EXAA 3E22B 2WLJA 4NXMB 1D5AA 5KLVH 3CRMA 1L0LH 4LF4O 3ABMC 1RFYA 2BSKA 2JS3A 2F1MA 2XAHA 2ZD9A 3O9OA 2K1EA 3SYOA 5B5EZ 1P49A 5CN0A 2XAJA 5IY5B 1AI7A 2H8PC 2YC0A 4DRXB 2LFSA 5JVDB 2CTWA 4DUZB 2CTRA 2WLKA 4HZ3A 5JJEB 1IZ3A 5JH7B 5IJ9B 4DV1O 4MVRA 4FLZA 4NR1A 1ZUQA 1M56C 3O65A 2ZM6B 4X65B 4BW9A 1R6KA 3OM3B 3BEHA 4Z1VA 2ZE6A 2BTQA 4JI1B 3CMAV 2HJFC 5JQGA 3E83A 1JPXA 3IGAC 3WU2Z 3OGCC 4UV9A 3CMEV 2E5LB 3ABMB 1K34A 2E74B 4X66B 4DUYB 3E8FA 4B7KA 3MHHC 4CC6A 3LSSA 1L8DA 2EX3A 4GUNA 3ABUA 5E79Z 2VQEB 3F5TA 3CRCA 4H13B 5EC2C 3ZMUA 2E3CA 2HP8A 1M56B 3K0GA 2Y4UA 1Z2GA 2PUSA 5H5NA 1K33A 5FPOA 4JYCA 3RVZA 2OIEA 3L71H 3J7AU 3AK1A 2KKWA 4PDMA 1I5YA 3JATA 2MK3A 1K9MW 3NXSA 2YXHA 4D7TA 2WA3A 5JQGB 3E35A 4I0XB 5B1OA 4KHPO 3F7VC 1FXHA 2WSSG 2YSUB 3BHPA 4LF5B 1N0JA 3ZHTA 1XI1A 3E8BA 3IFXA 3RT3C 5B1AC 4X9QA 4LF4B 2X6AA 4GT1A 3BY6A 1NU1H 4FFKA 4IIJA 5KUMA 4BAYA 2IM9A 5CA3A 2UXCO 4C7UA 1H38A 3T1HO 5JJNB 2GTSA 1DLBA 4MTFA 4LP8A 2XNDG 3AG4C 2VWJA 5IT9N 5EBLC 3ICXA 4K3AA 1VQ5V 3RFRA 2R9RB 1DGSA 3SPCA 1MSWD 3HKBB 1EN5A 4DV1B 1QR9A 3W7WA 3FB6C 2QWNB 2GHYA 2A0LA 3ABTA 3JATB 1RM1C 1U97A 4HAMA 4HYOA 1RPOA 4RQFA 2NN4A 2QKCA 4DR2B 3QO5A 1S77D 1V55C 4LF8O 2DN9A 1FKAO 5K1XA 1Q81W 3SYAA 1XDCA 3WFVA 4LNUB 1VF5B 1OCCC 2CH7A 1COWG 2LGWA 2HHHO 4O4LA 5B1AB 1KYOF 4IIJB 3UM7A 1KUQA 2H94A 1AP6A 4JTCB 1K3EA 4BR6A 1OV9A 3LNMB 4L87A 4RUEA 2JJ2G 2ZE7A 2YI9A 3JAKA 4YIOA 3OT7A 3SYQA 2VS0A 4O4JA 1E1QG 3UKMA 2FKXA 4LFCO 2JDIG 2ZR3A 4O2BA 3ETDA 1VQNV 5DECA 4GX2A 1UJWB 1V55B 1K92A 3DC6A 2CK3G 3WB0A 2KQXA 4CH5A 3FX7A 3JCUZ 4PA7A 3B09A 1OCCB 4KHPB 1YCIA 4O4LB 4I4TA 4LH6A 2BE3A 1CEZA 4NVPA 4ZBMA 1BCCH 1PP9H 3H01A 1ZLZA 1AP5A 4IYIA 3E2EA 1J95A 4LF7O 2UXCB 3T1HB 1E79G 2QM8A 3LSQA 3L74H 5LBQA 3JAKB 3FAVA 4O4JB 4BIOA 1VARA 4H44B 4KXRA 4H33A 4O2BB 5EZYA 2IJIA 2RMKB 4G27B 2QA4V 2AW9A 3HPLC 3E8HA 3KG2A 3G67A 1PNLA 1SQPH 3I5DA 2EIMC 3RYHA 5HFMA 4LF8B 2RN9A 3LDDA 4PHZA 1VQLV 1Q8IA 4FM2A 4I4TB 2P6JA 3CRAA 3H1JH 3H1IH 4O4HA 3P3PA 3QO8A 1L1FA 3ZMZA 3ZHSA 3QNEA 5CBFA 1MA1A 2HHHB 1WB7A 2P06A 3OE7G 1IXMA 3CYOA 2ZE8A 3CRQA 1QU7A 2CTPA 4U3JB 1N0NA 4IL6Z 3MAQA 2UXNA 4TQDA 5IE9A 3FAVB 3N27A 2V7QG 1VQ9V 4E2LA 3OTFA 2Q0OC 1KMIZ 5EZYB 2ILMA 2HLDG 1ROPA 2X6CA 2YXLA 1M93A 4LFCB 1GH6A 5GONA 4Q6GA 1QR8A 2Q5ZA 1P7GA 1FAFA 1VQ8V 3RYHB 4PELA 2QJ1A 2UUAO 1D5NA 1Q90D 4OGQB 4JAVA 4PA3A 1OJHA 4O4HB 2WLLA 4EFEA 4FLTA 2ITDC 2FL4A 3JSNA 2DJVA 5KHKA
chains in the Genus database with same CATH topology
3K9SA 1BS3A 3C3TA 1BT8A 1IDSA 3DC5A 1EN5A 4F6EA 1IX9A 1GN4A 1WB8A 3AK2A 1AR5A 1Y67A 1VARA 3MDSA 2QKCA 1IXBA 2AW9A 1EM1A 1GN3A 1XDCA 1LUWA 2CE4A 1EN4A 1I08A 4YIPA 1LUVA 1MNGA 1GN2A 1JA8A 2GDSA 1PM9A 1ZSPA 4GUNA 1AP6A 1JR9A 1SZXA 1GN6A 5A9GA 1MA1A 4JZ2A 4JZGA 1WB7A 2CDYA 1XILA 4BR6A 2RCVA 2QKAA 1N0NA 1AVMA 1PL4A 4YIOA 3IC9A 3OT7A 3EVKA 3AK1A 1AR4A 3QVNA 1XREA 3RN4A 1XUQA 3LSUA 3TJTA 2P4KA 2ADQB 1BSMA 1B06A 1KKCA 3DC6A 3KKYA 1QNMA 1P7GA 1N0JA 1I0HA 1EN6A 5AG2A 3KDRA 1VEWA 4E4EA 1D5NA 3C3SA 3CEIA 3AK3A 4X9QA 1MSDA 4FFKA 1ZTEA 4JYYA 4C7UA 1MMMA 1ZLZA 2ADPA 1AP5A 3BFRA 1ZUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9S A;  1BS3 A;  3C3T A;  1BT8 A;  1IDS A;  3DC5 A;  1EN5 A;  4F6E A;  1IX9 A;  1GN4 A;  1WB8 A;  3AK2 A;  1AR5 A;  1Y67 A;  1VAR A;  3MDS A;  2QKC A;  1IXB A;  2AW9 A;  1EM1 A;  1GN3 A;  1XDC A;  1LUW A;  2CE4 A;  1EN4 A;  1I08 A;  4YIP A;  1LUV A;  1MNG A;  1GN2 A;  1JA8 A;  2GDS A;  1PM9 A;  1ZSP A;  4GUN A;  1AP6 A;  1JR9 A;  1SZX A;  1GN6 A;  5A9G A;  1MA1 A;  4JZ2 A;  4JZG A;  1WB7 A;  2CDY A;  1XIL A;  4BR6 A;  2RCV A;  2QKA A;  1N0N A;  1AVM A;  1PL4 A;  4YIO A;  3IC9 A;  3OT7 A;  3EVK A;  3AK1 A;  1AR4 A;  3QVN A;  1XRE A;  3RN4 A;  1XUQ A;  3LSU A;  3TJT A;  2P4K A;  2ADQ B;  1BSM A;  1B06 A;  1KKC A;  3DC6 A;  3KKY A;  1QNM A;  1P7G A;  1N0J A;  1I0H A;  1EN6 A;  5AG2 A;  1VEW A;  4E4E A;  1D5N A;  3C3S A;  3CEI A;  3AK3 A;  4X9Q A;  1MSD A;  4FFK A;  1ZTE A;  4JYY A;  4C7U A;  1MMM A;  1ZLZ A;  2ADP A;  1AP5 A;  3BFR A;  1ZUQ A; 
#chains in the Genus database with same CATH topology
 4MVS A;  3C3T A;  2EUL A;  1YJN V;  2A06 H;  4JTA B;  1QLN A;  1R6T A;  3FKS G;  1GM7 A;  1KB9 F;  3UT5 A;  4F6R B;  1NTM H;  3JAL A;  4LF7 B;  2KG7 B;  3L9D A;  4R6Z A;  5IWA O;  4GX0 A;  3ZRS A;  4JGS A;  1SA0 A;  5GTH Z;  4FVM A;  1GN3 A;  2LGQ A;  5GON B;  1EZV H;  1JOY A;  1U96 A;  5LGU A;  1SQX H;  1SRY A;  2JEU A;  5DED A;  2GSM B;  1ZL8 A;  1F23 A;  1I08 A;  1YTF B;  4WCE V;  2UUC O;  1XHZ A;  3BCC H;  1FS0 G;  2F93 B;  1V54 C;  3CCE V;  3OUF A;  2WLL B;  5CBG A;  1URF A;  3E86 A;  4D6T H;  5L3B A;  4K8X A;  1XIL A;  1FJG O;  5A2Q N;  2HEP A;  5BY1 A;  1GKF A;  3B8N A;  2AZ0 A;  4WFF A;  4RAI A;  3IC9 A;  2QWP B;  4UCS A;  1PNK A;  2UXX A;  3QVN A;  3JSL A;  1LR1 A;  1VF6 C;  4CS4 A;  3B2E E;  1VF6 A;  1SA0 B;  4ZKI A;  4QJF B;  3SJQ C;  5B66 Z;  3F7Y C;  4PA9 A;  3TXQ A;  1I0H A;  1EN6 A;  1ZL8 B;  4MVQ A;  2JIZ G;  1RP3 B;  2MW2 B;  1W59 A;  2QWO B;  5LMU O;  3STL C;  1V54 B;  3MD0 A;  2UUA B;  1P4R A;  1NTK H;  3ZMS A;  1KEC A;  1Q6H A;  3CHX A;  5CB4 A;  2B1I A;  1SES A;  4J9Z B;  4FFB B;  1G8M A;  1WP7 A;  2Z3Y A;  3Q4H B;  3F5W C;  2QDO A;  1YTF D;  1YSC A;  5C8Y A;  3CX5 F;  2XAS A;  1XHX A;  3HR0 A;  1R3I C;  2EJR A;  3OD4 A;  4X64 O;  4LF9 O;  5CA1 A;  3RYC B;  1P84 F;  2JEX A;  5ITZ B;  4TUY A;  2C2A A;  1Y6X A;  4NTX A;  4WFH A;  2E75 B;  1BQZ A;  1YHQ V;  5IWA B;  2QSA A;  3UCS C;  2R70 A;  2EZP A;  4GX5 A;  2JK5 C;  3JD3 A;  4FLY A;  2Z5U A;  3CXC U;  1EN4 A;  1X4T A;  3P30 A;  1R3L C;  1KC8 W;  1YEW A;  3EHB B;  4PDL A;  3RVY A;  1JVM A;  1F4N A;  5KA6 A;  2EIN C;  2OYQ A;  2UUC B;  2OCH A;  2EZO A;  1Q43 A;  3BPZ A;  4XDJ A;  2ODM A;  1WA8 A;  5J2U B;  5CB4 B;  1Z5W A;  3X2Q C;  1R3J C;  3SPH A;  1N34 O;  3LNN A;  2JRI A;  5C8Y B;  2ETN A;  1FJG B;  2W6I G;  1G1X B;  1WP8 A;  1RSO A;  3GWO A;  2AGA A;  3ZJZ A;  5CA1 B;  1XRE A;  5KUK A;  2DWE C;  3B40 A;  4N23 A;  4AIL C;  1W0J G;  1YJW V;  3ZRW B;  5BZB A;  3W7U A;  3TET A;  5B1B C;  2Q0A A;  4DV5 O;  4FJC C;  2WPD G;  2V1D A;  4P30 A;  1OHH G;  5EIB C;  1K4D C;  2DQ0 A;  1JCH A;  4JYA O;  5KA5 A;  4GX1 A;  3E8G A;  1Q82 W;  4K35 A;  4RWU A;  5LYJ A;  5B3S B;  4UUJ C;  4U3F H;  1GO3 F;  2XAG A;  1WA8 B;  2EIN B;  2GUZ A;  5LMU B;  1XQ8 A;  1SC5 B;  3D8C A;  3SPI A;  4B08 A;  3OW2 U;  3OUS A;  3X2Q B;  4MW3 A;  1FXV A;  4U7O A;  4R7C A;  3CSX A;  1BGY H;  1RSO B;  4JAA A;  4JI0 O;  5KHH A;  4HNA B;  3JD0 A;  2HFE C;  3BAB A;  1GAX A;  4X64 B;  2QE7 G;  3ZHU A;  4LF9 B;  1HP8 A;  3DGE A;  4J7J A;  1M9N A;  3VQX A;  3FD9 A;  1EZJ A;  2VRZ A;  2H3O A;  2QM7 A;  4DR3 O;  3AG3 C;  2EIL B;  2L35 A;  1LUV A;  2WLM A;  4YIP A;  2LO1 A;  3K3W A;  1NBM G;  4ZHQ A;  4RQE A;  3WG7 B;  3OMI B;  1GN6 A;  2YIB A;  1OCO B;  4NXN O;  5JWP A;  2Q73 A;  1VQO V;  1JFF A;  1GRJ A;  2JJ1 G;  5LHG A;  3RWR D;  1R1B A;  2EIK C;  2BSK B;  4IYH A;  2DW4 A;  1ZWI C;  2G38 A;  2F43 G;  4A5U B;  5KAF Z;  5BR8 O;  1N34 B;  4J42 A;  4X1K A;  5EBM C;  3SPJ A;  2LW1 A;  3LSU A;  3G80 A;  1O9G A;  3QG5 A;  3RW0 A;  2HG5 C;  2Y4T A;  2LFR A;  1AI4 A;  1Q5O A;  5DM6 V;  2AHZ A;  1VEW A;  1THZ A;  2XTA A;  3AG3 B;  1F4M A;  4DV5 B;  4UCO A;  2N05 A;  1FFX A;  2BTQ B;  3W7S A;  1VQ7 V;  1MSD A;  4QE7 A;  3ETE A;  2ZNJ A;  3VBB A;  4PDR A;  1WJZ A;  4JYA B;  2DYS C;  2E76 B;  2W6J G;  4KUM A;  1JFF B;  2ZE5 A;  4FLX A;  1KP2 A;  5KAI Z;  2DOS A;  2EIK B;  5EIB D;  5IDJ A;  1ZAU A;  3PJS K;  2A9H A;  3A0H Z;  1M1K W;  4X1K B;  4BIU A;  2UU9 O;  4MT8 A;  2AXT Z;  3P32 A;  2YIC A;  1O9H A;  2IH3 C;  1FD9 A;  3ZN1 A;  4JI0 B;  3SPG A;  5FLX N;  1SER A;  4R50 A;  1S5L Z;  1SS3 A;  4J9Y B;  2UUB O;  2YUA A;  4JAS A;  2KB1 A;  2FYU H;  4DR3 B;  1I5X A;  2CDY A;  2YDE A;  2DYS B;  3CE2 A;  3HKE A;  4UVC A;  2B5U A;  1Y74 A;  1AJN A;  4NXN B;  4MSW C;  4DO2 A;  5KMG A;  1J5E O;  3R65 A;  3T1Y O;  1PPJ H;  3NR7 A;  3VQV A;  2YIB D;  3RBZ A;  1TUB A;  1IBL O;  4EB6 A;  3WB2 A;  1S72 V;  5BR8 B;  2YEV A;  4X1Y A;  1B06 A;  1KKC A;  3AG4 B;  3OAA G;  1NKD A;  1PNM A;  4MVM A;  3ABL C;  1VP7 A;  1F51 A;  3J80 N;  1GK9 A;  3BRC A;  4FZ1 A;  3AK3 A;  1XNQ O;  1XMQ O;  5EBW C;  3L75 H;  3LDC A;  2RNB A;  4J80 A;  3OEE G;  1RM1 B;  4JAU A;  2ADP A;  1FXK C;  3CB2 A;  4LH7 A;  1NJI W;  3BFR A;  4I50 A;  3ZN0 A;  1G6U A;  1GM9 A;  1FXK A;  3KCX A;  1K5S A;  2WA4 A;  2RQ6 A;  3HKE B;  1WN7 A;  3H1L H;  1Y74 B;  3WB1 A;  2CH7 B;  3ETG A;  2CGO A;  4FLU A;  4YHH O;  1AR5 A;  3G6E V;  1WLE A;  1W2B U;  1YJ9 V;  1DK1 A;  3H9V A;  2PYL A;  3MDS A;  3N2G A;  4EB6 B;  5J9P C;  4WFA V;  1B3Q A;  4P9O A;  2PYJ A;  5D5Q A;  2UU9 B;  2DYR C;  1VQ6 V;  3D36 C;  2HJD A;  4B3T O;  3ABL B;  4MVZ A;  4Z2W A;  3D36 A;  3GB7 C;  4TT3 G;  2LJ2 A;  4O2A A;  1N32 O;  1AI5 A;  4MS2 A;  1Y66 A;  3ASO C;  4WFB V;  3K5L A;  1FOU A;  4I50 B;  4R8C A;  2UUB B;  3IC7 A;  1FXK B;  5IYD O;  1VQP V;  2Q69 A;  1K73 W;  1Z5V A;  1GM8 A;  4MTX A;  5DN6 G;  3ZMT A;  1WPX A;  4B3R O;  4MVU A;  5L3C A;  3JAR A;  1AR4 A;  3KCY A;  3RYF A;  1H2N A;  3N2G B;  1R6N A;  1J5E B;  1IBK O;  2P22 C;  3T1Y B;  2OTJ V;  2CUG A;  1IBL B;  1YZB A;  4PDV A;  2DYR B;  1VMG A;  4X89 A;  1Y76 A;  4JI2 O;  4LWS A;  3ML0 A;  4QE9 A;  1F7Y A;  3HB3 B;  4X62 O;  1M90 W;  4PD4 F;  1BE3 H;  4O4I A;  2Y48 A;  4NTW A;  3ASO B;  1XNQ B;  1XMQ B;  4DV6 O;  1OCR C;  1R73 A;  2BOC C;  2ZIM A;  4JI3 O;  4TOI A;  2WAM A;  3K57 A;  3ZHV A;  1IJG A;  3UQ8 A;  1XL6 A;  3L72 H;  3STZ C;  2EIM B;  3AK2 A;  4WFE A;  5H2F Z;  3JAR B;  4F4L A;  3RYF B;  4DV4 O;  4RO2 A;  4YHH B;  2Q67 A;  2DMX A;  2Q9L A;  3JAM N;  3OMN B;  3TXS A;  1QQC A;  2ZIN A;  1VQM V;  4AQY O;  2CE4 A;  3K5O A;  2Y0P A;  1SQG A;  2HR3 A;  4LWS B;  4QPK A;  4FPP A;  4TQF A;  1FFT B;  1OCZ C;  4GZR B;  4MW8 A;  4LFA O;  3CCU V;  1JR9 A;  1SZX A;  4B3T B;  4FLV A;  1DF4 A;  2W0X A;  1N32 B;  2RCV A;  2YI8 A;  1P7B A;  5CA0 A;  2P90 A;  4DV2 O;  4FZ0 A;  1ORQ C;  1BL8 A;  3H1K H;  2PGG A;  4IGG A;  1ZX3 A;  1MZE A;  2XHB A;  4BW5 A;  2ZXW C;  1XEQ A;  2V4D A;  3K5N A;  3OR6 C;  4WBN A;  5BXZ A;  4FIP C;  4B3R B;  3AEI A;  1Y4M A;  3JD2 A;  3ETQ A;  2Q7G A;  1NVP B;  1QNM A;  1H5W A;  2EBO A;  3CPW U;  3KDR A;  1JMK C;  1IBK B;  3FYI B;  1MG1 A;  4CH6 A;  3UT5 B;  1KQS U;  5EC1 C;  1HWY A;  4NYK A;  4J11 A;  1HNZ O;  4AI8 A;  3JAL B;  4JI2 B;  4PI2 A;  1A32 A;  1OCZ B;  3CWB H;  3SGI A;  4J7Z A;  4X20 A;  2O57 A;  3FFQ A;  4X62 B;  5H9C A;  3CCR V;  2QR4 A;  4LC1 A;  2D2C B;  5CA0 B;  3IAY A;  2ATK C;  3S3X A;  4UB8 Z;  4DV6 B;  1NR1 A;  5H6Q A;  4JI3 B;  1JQ0 A;  3M99 B;  2ZXW B;  2P4V A;  4TSF G;  1JJO A;  1GTO A;  4FK5 C;  5FNV A;  1DTO A;  1EM1 A;  2QTS A;  3K0D A;  2P67 A;  1YIJ V;  4DR4 O;  1B04 A;  2CGN A;  1BHB A;  4DV4 B;  4D7S A;  2F66 C;  4AQY B;  2RDC A;  4YY3 O;  5EK0 A;  1PM9 A;  3W7T A;  3I55 V;  4JZ2 A;  4P9P A;  4X20 B;  3G71 V;  2JGD A;  1B6Q A;  1NVP D;  4ZI7 A;  4DW0 A;  4LFA B;  3N2K A;  5L3G A;  3E89 A;  3B77 A;  2IU3 A;  3PN1 A;  4H37 A;  1PL0 A;  1YI2 V;  3DTU B;  3ZHQ A;  4DV2 B;  4QNH B;  1AI6 A;  1Q6U A;  1TVK A;  2FTK A;  1ENV A;  3JAS A;  4CH3 A;  5FNV B;  1HR0 O;  1UPG A;  5HFL A;  1CPY A;  3KKY A;  3SR2 C;  1ARO P;  2F4V O;  1CXZ B;  2QGN A;  5AG2 A;  3K06 A;  4I7Z B;  4KP4 A;  1XOU A;  2HVK C;  2M7W A;  3C90 A;  1TAE A;  1YF2 A;  3K04 A;  1JX9 A;  1N8R W;  3AG1 C;  1IVS A;  2JS5 A;  2ITC C;  1QLE C;  3E22 A;  2Q6A A;  2ZR2 A;  1EFR G;  4FMT A;  2ARH A;  2OCC C;  4TUY B;  4K0K O;  3CCJ V;  4ZI7 B;  2QM4 A;  1HNZ B;  1BHA A;  3K03 A;  1BQ0 A;  2FB5 A;  4Z1M G;  1YIT V;  2QWQ B;  3APQ A;  1H2L A;  3ZRV A;  4CS2 A;  4F6E A;  5E1A C;  4L8J A;  1WB8 A;  1N36 O;  4DR1 O;  2ZKO A;  2PY5 A;  1M5I A;  1H8E G;  1TVK B;  3ZED A;  3JAS B;  5GTI Z;  1IXB A;  3ZX6 A;  2X6B A;  2VWK A;  3ABK C;  1LUW A;  5CBH A;  1N4C A;  4LR3 A;  2NLJ C;  4NKG B;  2IH1 C;  4DR4 B;  1GN2 A;  3JYC A;  2GDS A;  3CCM V;  1NZ6 A;  3AG1 B;  5TIS Z;  3A2F A;  1QLE B;  4X88 A;  2HKO A;  1KKD A;  4YY3 B;  2OCC B;  5LOV A;  2YIA A;  1H2S B;  5B1B B;  2F23 A;  1PL4 A;  1Q6I A;  2LP7 A;  1OZ0 A;  3SYC A;  2PI4 A;  3ZMV A;  1NQT A;  4JI8 O;  1SZT A;  3EVK A;  4UXN A;  4JF3 A;  2DQ3 A;  3OMA B;  5LYJ B;  2ZCE A;  2QKS A;  2LW7 A;  3TCU A;  3A8T A;  4UB6 Z;  2GUZ B;  3K5M A;  4W4K A;  1VF7 A;  3CRR A;  3ABK B;  2L6L A;  3T4D A;  4ICG A;  3CC2 V;  1TUE B;  4PA6 A;  3ZRX A;  4DR2 O;  1HR0 B;  3CEI A;  4DYL A;  2F4V B;  5F2V O;  1DF5 A;  3BA8 A;  1S0V A;  2WLH A;  5BMV A;  3T4Z A;  5LL6 Y;  4I0X A;  3M8A A;  4JI6 O;  4PV1 B;  5LOV B;  2DE0 X;  2B9Z A;  4CZZ A;  2F95 B;  4ZOL A;  2GV9 A;  2KSD A;  4K0K B;  3SJB C;  4DV7 O;  4GLX A;  3CC4 V;  4ZHQ B;  3K08 A;  4J41 A;  4Q20 A;  5KHG A;  4JI7 O;  1N36 B;  5LXT A;  2YXY A;  4UVB A;  4DR1 B;  2BTO A;  2ZDI C;  4UVA A;  3UO3 A;  5LGN A;  3HKB A;  2ZDI A;  5LHH A;  4IT5 A;  1Q86 W;  5KHI A;  1QVG U;  1XNR O;  3BAA A;  1SET A;  3JD1 A;  4NTY A;  4DW1 A;  1ZSP A;  3LDE A;  2IJK A;  2WWW A;  2A7W A;  5BMV B;  3S3W A;  3K59 A;  4LNU A;  3ZCC A;  2UXB O;  2R9A A;  4ZOL B;  1S5J A;  3T1C A;  1NT2 B;  5KHJ A;  1FFX B;  4N21 A;  5JCO C;  1G4Y B;  1HNW O;  4TV8 A;  5J2T A;  2OWO A;  5JCO A;  4LFB O;  4FLW A;  4JI8 B;  5LXT B;  1H8H G;  3THO A;  1W0K G;  2BCC H;  2WLN A;  2IJJ A;  3CCL V;  1X59 A;  1YXB A;  1YVW A;  3C3S A;  4PJ0 Z;  1AR1 B;  4TWK A;  2PTM A;  5L3E A;  1WNS A;  2DWD C;  2Q68 A;  1ZTE A;  2Q8V A;  3CCV V;  1NI8 A;  4I5S A;  5H6R A;  2K9P A;  3OTO O;  1QBZ A;  3AG2 C;  4UV8 A;  2UXD O;  4K8Z A;  4UFZ A;  4IHJ A;  3D3I A;  3UO2 A;  4CH4 A;  4JI6 B;  4X1I A;  3TGU H;  1Y67 A;  2EJ7 A;  2YS8 A;  5K1P A;  4TV8 B;  5J2T B;  4DV7 B;  5FPR A;  3M7M X;  4OPH A;  4YJ2 A;  2A79 B;  4GKK O;  2OTL V;  2FML A;  4RUF A;  4UCV A;  2A3Q A;  4JI7 B;  3ZBH A;  2BOB C;  1VQK V;  1MNG A;  5KX5 A;  3ASN C;  5KMG B;  1RPR A;  3U11 A;  5LGT A;  2VQF O;  3H1H H;  1AJP A;  1TUB B;  4DK0 A;  3QTC A;  5LP6 C;  1XNR B;  1HW7 A;  3SYP A;  1N33 O;  4B3S O;  5LP6 A;  2YEV B;  1FYJ A;  3KZI Z;  4X1Y B;  5LA6 A;  3AG2 B;  1HNX O;  2QKA A;  1FPO A;  1JNB A;  3P3N A;  4JPR A;  4DR6 O;  1GMG A;  3D3Q A;  4G28 B;  4PA4 A;  4IHJ B;  1M57 C;  3U0Z A;  4HBN A;  4X1I B;  2UXB B;  4GYC B;  1H2G A;  1BMF G;  3RN4 A;  1SF9 A;  2Q7E A;  2JVD A;  3TJT A;  1QVF U;  4YJ2 B;  3CXH F;  5L3D A;  2Q4P A;  3QF7 A;  3T2M A;  1BSM A;  3I56 V;  1R3K C;  1VIB A;  1NH2 B;  1HNW B;  3MHS C;  4JYB A;  5LHI A;  4U3J A;  4QIW F;  4EKW A;  1T5E A;  2XUM A;  3VQW A;  4LFB B;  1Q7Y W;  2PF4 E;  4DV0 O;  5JJJ B;  4E4E A;  4ZIB A;  1YDX A;  3JD4 A;  5LMN O;  4ABM A;  5KX5 B;  1K8A W;  4I55 A;  2LQT A;  4LBE C;  3ASN B;  1IUR A;  4DR7 O;  1D2D A;  1UFI A;  2NNU A;  4LF6 O;  1H2K A;  1MMM A;  5CMU A;  3CS5 A;  2IBZ H;  3FYE B;  4WF9 V;  5LP6 B;  2R72 A;  5LA6 B;  4B7E A;  1BS3 A;  4G2K A;  3W7X A;  4B3M O;  4P2Z A;  5C93 A;  3DC5 A;  3OTO B;  3CCS V;  4ASU G;  1IX9 A;  1M57 B;  3OEH G;  3L70 H;  4BWA A;  2UXD B;  1PV0 A;  1XBL A;  1K4C C;  4MVO A;  4O2A B;  1SQQ H;  1IBM O;  1TA8 A;  3IJ4 A;  4QGP A;  5B1N A;  3FB5 C;  2GTA A;  4J7K A;  1AIL A;  4XDK A;  4OX9 O;  1CP9 A;  3AG7 A;  2Z0A A;  3VOU A;  3DXR A;  4GKK B;  4OPA A;  4F6R A;  4I55 B;  1SQF A;  2KG7 A;  4DXW A;  1JA8 A;  3RYI A;  4J10 A;  5A9G A;  4GKJ O;  3CCQ V;  2X7R B;  4JZG A;  4X8A A;  1NH2 D;  2RJZ A;  5IJ0 A;  2VQF B;  3L73 H;  3B8M A;  1PKX A;  4JTD B;  3J81 N;  4I9Q A;  2OT5 A;  3JAW A;  1H2M A;  1Y76 B;  3U10 A;  1N33 B;  4B3S B;  1XMO O;  2XAQ A;  3LUT B;  4FM1 A;  1HNX B;  4XBF A;  4DR6 B;  3A0B Z;  1XL4 A;  2IU0 A;  4JI5 O;  1XUQ A;  3BA9 A;  2QWR B;  4O4I B;  1KBH A;  2ADQ B;  2IJH A;  2B1G A;  4H0L B;  3CP1 A;  5EYP A;  4I9W A;  2QEX V;  3GVM A;  3HKD A;  1E1R G;  1OCR B;  3RGB A;  2QTO A;  3CC7 V;  3DXR B;  1QCE A;  2AHY A;  1I94 O;  3G4S V;  1VQ4 V;  4UCR A;  4DV0 B;  3RYI B;  2CAZ C;  4FM0 A;  4JYY A;  3GWK C;  5LMN B;  3SJA C;  2P7T C;  1SQB H;  3K9A A;  3EFF K;  5IJ0 B;  4JI4 O;  4DR7 B;  5FL7 G;  3APO A;  3JCZ A;  3G6B A;  1BT8 A;  4LF6 B;  3JAW B;  4DV3 O;  4LCU C;  2Y69 C;  2ZQM A;  4JV5 O;  1US6 A;  2W0F C;  4B3M B;  1Q3E A;  4W4L A;  3TK1 A;  4UCU A;  1MZF A;  1MAB G;  3HKC A;  2XOK G;  5EYP B;  4FFB A;  3HKD B;  3Q4H A;  1IBM B;  3SJC C;  2N74 A;  2WLI A;  1TGO A;  1PD3 A;  4OX9 B;  2M6Y A;  1I7F A;  1MOF A;  1K7D A;  3RYC A;  1JJ2 U;  5ITZ A;  4WBN B;  1LNQ A;  1S5H C;  4GCZ A;  1K97 A;  4MTO A;  4GKJ B;  1AVM A;  4DR5 O;  2IW5 A;  3CD6 V;  1KU9 A;  5IYZ A;  2XT9 A;  4NXM O;  3K79 A;  1WPB A;  1K5Q A;  2Y69 B;  3OR7 C;  5D5P A;  1XMO B;  5J2U A;  2P4K A;  1SQV H;  3HKC B;  2AZ2 A;  4YXW G;  3CJH A;  1S3J A;  1KD1 W;  2ZIO A;  4UCT A;  2GBO A;  4JI5 B;  2WLI B;  4CS3 A;  5L3F A;  1HDJ A;  4XDL A;  4DUZ O;  4CBC A;  1M4U A;  2Q7H A;  3VQY A;  1SKV A;  3OFN G;  4TV9 A;  1L0N H;  2ZM6 O;  4X65 O;  2R9I A;  3ZRW A;  1I94 B;  4AHC A;  2ZT9 B;  4CC5 A;  4KFM A;  4JI1 O;  3K9S A;  1IDS A;  2YID A;  1EBO A;  3SDL A;  1BZK A;  1NS1 A;  2NR5 A;  1GN4 A;  5IYZ B;  5B3S C;  2EIJ C;  4JI4 B;  2P5O A;  3ZHR A;  4OXS A;  4DK1 A;  5GW7 A;  4YJ3 A;  3B4S A;  3QO7 A;  2E5L O;  4DV3 B;  2ZNI A;  3OGI B;  3CJH B;  4X66 O;  4WFG A;  4DUY O;  4JV5 B;  2JGD B;  5IYB O;  3K58 A;  3N2K B;  4MTG A;  1QHT A;  3BVO A;  5IY5 C;  1S76 D;  2VQE O;  1NR7 A;  4DRX A;  2JGU A;  4TV9 B;  4PI0 A;  4EFB A;  1WAZ A;  5JVD A;  1AB3 A;  4HNA A;  2HVJ C;  2XAF A;  4BIZ A;  3ZS8 C;  5JH7 A;  2PZS A;  5IJ9 A;  4KL1 A;  1AJQ A;  4EEQ A;  2D3O W;  1V9P A;  3ZIA G;  2EIL C;  1NTZ H;  1KP3 A;  3A0R A;  2CTQ A;  2Y0I A;  3FB8 C;  2N04 A;  4U7N A;  3R66 A;  3WG7 C;  3FB7 C;  3DSQ A;  2EIJ B;  2X0L A;  2OIG A;  4YJ3 B;  1OCO C;  4DR5 B;  4LF5 O;  2PI5 A;  5IYC O;  4QPJ A;  4NB5 A;  3EXA A;  3E22 B;  2WLJ A;  4NXM B;  1D5A A;  5KLV H;  3CRM A;  1L0L H;  4LF4 O;  3ABM C;  1RFY A;  2BSK A;  2JS3 A;  2F1M A;  2XAH A;  2ZD9 A;  3O9O A;  2K1E A;  3SYO A;  5B5E Z;  1P49 A;  5CN0 A;  2XAJ A;  5IY5 B;  1AI7 A;  2H8P C;  2YC0 A;  4DRX B;  2LFS A;  5JVD B;  2CTW A;  4DUZ B;  2CTR A;  2WLK A;  4HZ3 A;  5JJE B;  1IZ3 A;  5JH7 B;  5IJ9 B;  4DV1 O;  4MVR A;  4FLZ A;  4NR1 A;  1ZUQ A;  1M56 C;  3O65 A;  2ZM6 B;  4X65 B;  4BW9 A;  1R6K A;  3OM3 B;  3BEH A;  4Z1V A;  2ZE6 A;  2BTQ A;  4JI1 B;  3CMA V;  2HJF C;  5JQG A;  3E83 A;  1JPX A;  3IGA C;  3WU2 Z;  3OGC C;  4UV9 A;  3CME V;  2E5L B;  3ABM B;  1K34 A;  2E74 B;  4X66 B;  4DUY B;  3E8F A;  4B7K A;  3MHH C;  4CC6 A;  3LSS A;  1L8D A;  2EX3 A;  4GUN A;  3ABU A;  5E79 Z;  2VQE B;  3F5T A;  3CRC A;  4H13 B;  5EC2 C;  3ZMU A;  2E3C A;  2HP8 A;  1M56 B;  3K0G A;  2Y4U A;  1Z2G A;  2PUS A;  5H5N A;  1K33 A;  5FPO A;  4JYC A;  3RVZ A;  2OIE A;  3L71 H;  3J7A U;  3AK1 A;  2KKW A;  4PDM A;  1I5Y A;  3JAT A;  2MK3 A;  1K9M W;  3NXS A;  2YXH A;  4D7T A;  2WA3 A;  5JQG B;  3E35 A;  4I0X B;  5B1O A;  4KHP O;  3F7V C;  1FXH A;  2WSS G;  2YSU B;  3BHP A;  4LF5 B;  1N0J A;  3ZHT A;  1XI1 A;  3E8B A;  3IFX A;  3RT3 C;  5B1A C;  4X9Q A;  4LF4 B;  2X6A A;  4GT1 A;  3BY6 A;  1NU1 H;  4FFK A;  4IIJ A;  5KUM A;  4BAY A;  2IM9 A;  5CA3 A;  2UXC O;  4C7U A;  1H38 A;  3T1H O;  5JJN B;  2GTS A;  1DLB A;  4MTF A;  4LP8 A;  2XND G;  3AG4 C;  2VWJ A;  5IT9 N;  5EBL C;  3ICX A;  4K3A A;  1VQ5 V;  3RFR A;  2R9R B;  1DGS A;  3SPC A;  1MSW D;  3HKB B;  1EN5 A;  4DV1 B;  1QR9 A;  3W7W A;  3FB6 C;  2QWN B;  2GHY A;  2A0L A;  3ABT A;  3JAT B;  1RM1 C;  1U97 A;  4HAM A;  4HYO A;  1RPO A;  4RQF A;  2NN4 A;  2QKC A;  4DR2 B;  3QO5 A;  1S77 D;  1V55 C;  4LF8 O;  2DN9 A;  1FKA O;  5K1X A;  1Q81 W;  3SYA A;  1XDC A;  3WFV A;  4LNU B;  1VF5 B;  1OCC C;  2CH7 A;  1COW G;  2LGW A;  2HHH O;  4O4L A;  5B1A B;  1KYO F;  4IIJ B;  3UM7 A;  1KUQ A;  2H94 A;  1AP6 A;  4JTC B;  1K3E A;  4BR6 A;  1OV9 A;  3LNM B;  4L87 A;  4RUE A;  2JJ2 G;  2ZE7 A;  2YI9 A;  3JAK A;  4YIO A;  3OT7 A;  3SYQ A;  2VS0 A;  4O4J A;  1E1Q G;  3UKM A;  2FKX A;  4LFC O;  2JDI G;  2ZR3 A;  4O2B A;  3ETD A;  1VQN V;  5DEC A;  4GX2 A;  1UJW B;  1V55 B;  1K92 A;  3DC6 A;  2CK3 G;  3WB0 A;  2KQX A;  4CH5 A;  3FX7 A;  3JCU Z;  4PA7 A;  3B09 A;  1OCC B;  4KHP B;  1YCI A;  4O4L B;  4I4T A;  4LH6 A;  2BE3 A;  1CEZ A;  4NVP A;  4ZBM A;  1BCC H;  1PP9 H;  3H01 A;  1ZLZ A;  1AP5 A;  4IYI A;  3E2E A;  1J95 A;  4LF7 O;  2UXC B;  3T1H B;  1E79 G;  2QM8 A;  3LSQ A;  3L74 H;  5LBQ A;  3JAK B;  3FAV A;  4O4J B;  4BIO A;  1VAR A;  4H44 B;  4KXR A;  4H33 A;  4O2B B;  5EZY A;  2IJI A;  2RMK B;  4G27 B;  2QA4 V;  2AW9 A;  3HPL C;  3E8H A;  3KG2 A;  3G67 A;  1PNL A;  1SQP H;  3I5D A;  2EIM C;  3RYH A;  5HFM A;  4LF8 B;  2RN9 A;  3LDD A;  4PHZ A;  1VQL V;  1Q8I A;  4FM2 A;  4I4T B;  2P6J A;  3CRA A;  3H1J H;  3H1I H;  4O4H A;  3P3P A;  3QO8 A;  1L1F A;  3ZMZ A;  3ZHS A;  3QNE A;  5CBF A;  1MA1 A;  2HHH B;  1WB7 A;  2P06 A;  3OE7 G;  1IXM A;  3CYO A;  2ZE8 A;  3CRQ A;  1QU7 A;  2CTP A;  4U3J B;  1N0N A;  4IL6 Z;  3MAQ A;  2UXN A;  4TQD A;  5IE9 A;  3FAV B;  3N27 A;  2V7Q G;  1VQ9 V;  4E2L A;  3OTF A;  2Q0O C;  1KMI Z;  5EZY B;  2ILM A;  2HLD G;  1ROP A;  2X6C A;  2YXL A;  1M93 A;  4LFC B;  1GH6 A;  5GON A;  4Q6G A;  1QR8 A;  2Q5Z A;  1P7G A;  1FAF A;  1VQ8 V;  3RYH B;  4PEL A;  2QJ1 A;  2UUA O;  1D5N A;  1Q90 D;  4OGQ B;  4JAV A;  4PA3 A;  1OJH A;  4O4H B;  2WLL A;  4EFE A;  4FLT A;  2ITD C;  2FL4 A;  3JSN A;  2DJV A;  5KHK A; 
#chains in the Genus database with same CATH homology
 3K9S A;  1BS3 A;  3C3T A;  1BT8 A;  1IDS A;  3DC5 A;  1EN5 A;  4F6E A;  1IX9 A;  1GN4 A;  1WB8 A;  3AK2 A;  1AR5 A;  1Y67 A;  1VAR A;  3MDS A;  2QKC A;  1IXB A;  2AW9 A;  1EM1 A;  1GN3 A;  1XDC A;  1LUW A;  2CE4 A;  1EN4 A;  1I08 A;  4YIP A;  1LUV A;  1MNG A;  1GN2 A;  1JA8 A;  2GDS A;  1PM9 A;  1ZSP A;  4GUN A;  1AP6 A;  1JR9 A;  1SZX A;  1GN6 A;  5A9G A;  1MA1 A;  4JZ2 A;  4JZG A;  1WB7 A;  2CDY A;  1XIL A;  4BR6 A;  2RCV A;  2QKA A;  1N0N A;  1AVM A;  1PL4 A;  4YIO A;  3IC9 A;  3OT7 A;  3EVK A;  3AK1 A;  1AR4 A;  3QVN A;  1XRE A;  3RN4 A;  1XUQ A;  3LSU A;  3TJT A;  2P4K A;  2ADQ B;  1BSM A;  1B06 A;  1KKC A;  3DC6 A;  3KKY A;  1QNM A;  1P7G A;  1N0J A;  1I0H A;  1EN6 A;  5AG2 A;  3KDR A;  1VEW A;  4E4E A;  1D5N A;  3C3S A;  3CEI A;  3AK3 A;  4X9Q A;  1MSD A;  4FFK A;  1ZTE A;  4JYY A;  4C7U A;  1MMM A;  1ZLZ A;  2ADP A;  1AP5 A;  3BFR A;  1ZUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...