3AK1A

Superoxide dismutase from aeropyrum pernix k1, apo-form
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
MVSFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAVMRDFSFNYAGHIMHTIFWPNMAPPGKGGGTPGGRVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDPLTEELRILQVEKHNVLMTAGLVPILVIDVWEHAYYLQYKNDRGSYVENWWNVVNWDDVEKRLEQALNNAKPLYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn/Fe]
publication title Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 - insights into the enzyme mechanism and stability
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 76
structure length 212
sequence length 212
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ak1A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ak1A02
4FFKA 4C7UA 2GDSA 1EN4A 2CE4A 1JR9A 1GN2A 5AG2A 4JZ2A 5A9GA 1WB7A 1N0NA 1IDSA 1ZUQA 4BR6A 1SZXA 1XDCA 1BT8A 3C3TA 1QNMA 1ZSPA 1AVMA 1AR4A 3DC6A 1I0HA 3K9SA 1MSDA 1LUWA 1VARA 3BFRA 4JZGA 3TJTA 4E4EA 3MDSA 1LUVA 3OT7A 1PM9A 1EN5A 1WB8A 3DC5A 1PL4A 1VEWA 1GN4A 1EN6A 1KKCA 2RCVA 3CEIA 1IXBA 1XUQA 4X9QA 1I08A 1IX9A 1XREA 3KKYA 1ZTEA 1Y67A 4JYYA 3AK1A 3EVKA 1AR5A 1N0JA 4YIPA 1P7GA 3LSUA 1BS3A 4YIOA 1MNGA 3AK3A 3IC9A 1XILA 3RN4A 1JA8A 1GN6A 1AP5A 4GUNA 2QKCA 2AW9A 2CDYA 3C3SA 2QKAA 1B06A 2ADPA 1EM1A 1GN3A 3AK2A 1ZLZA 2P4KA 2ADQB 1MMMA 1MA1A 1D5NA 4F6EA 1BSMA 3QVNA 1AP6A
chains in the Genus database with same CATH superfamily
1U97A 3H1LH 4J9ZB 4X88A 3ZX6A 1NQTA 4MSWC 1M90W 5FNVA 2V1DA 1X4TA 2IJJA 3T1YO 2VQEO 3Q4HA 5L3GA 2P90A 1FFTB 3FAVA 2CAZC 2DYRC 4EB6A 2XAQA 4X66O 5JQGA 1M56C 3CE2A 2V4DA 2OT5A 1H8HG 5IJ0B 3VQVA 1SERA 3T1HB 3TJTA 1XMOB 5BY1A 2Q67A 4MT8A 2WA4A 4GKKB 1IBMB 2UU9O 4DV2O 1FXKA 4B3RO 4W4LA 2PI5A 2UXNA 5JJJB 2BSKB 3RYHA 1NZ6A 4P30A 2YXYA 2EZOA 1Q6UA 3KZIZ 4J7KA 3LSUA 4BW5A 2C2AA 3CMEV 5JJEB 1HWYA 4PDMA 4I7ZB 3OW2U 1IBKB 1L0NH 3HKCB 3CRRA 4GX5A 1M9NA 2JDIG 1XILA 1JQ0A 4ZBMA 2NN4A 1P7BA 5IJ9B 3QO8A 2YIAA 4LR3A 4B3SB 1MZEA 4PA4A 3CCVV 3H1HH 4EEQA 1B06A 3HKBB 2JJ1G 4D7SA 1QLEC 2Q9LA 4NTWA 1VQ7V 4DR5O 5L3EA 4KUMA 3WB2A 4DR1O 2P4VA 3ASOC 4LF8B 1FPOA 4LF7O 4JASA 5KA5A 1QVFU 4AILC 4FJCC 1JNBA 3QVNA 4QE9A 4I4TA 4LF6B 3ZMVA 1R6KA 3RT3C 1NVPD 2K9PA 1HR0B 1YZBA 5EIBD 4HBNA 3ZBHA 2CE4A 3MHHC 2Q7HA 4EFEA 2ZQMA 5A9GA 5IWAO 3CRMA 5KAIZ 2YDEA 4KP4A 3UCSC 1QU7A 1N32O 4JYBA 2YIBD 4O4JA 2JGDB 2EIMC 3X2QC 1I0HA 4J7ZA 5CA1B 2R9RB 4B3TB 3AG2C 5EBLC 4PI0A 3RBZA 1W0JG 4JAVA 4DV4O 1EN5A 4X1IB 2E5LO 3BVOA 4IHJA 1COWG 5IYDO 1AROP 4PI2A 2EIJC 2JRIA 1B04A 3IJ4A 5EC2C 3RFRA 4K8XA 1PD3A 3FKSG 1H2MA 3SYAA 1AI7A 1P84F 1P7GA 2ZE6A 3E8GA 1UJWB 1K34A 4HYOA 4TUYA 1MOFA 4NVPA 4UCSA 1YITV 3FD9A 1F4NA 4CBCA 4AQYB 1HW7A 4LF5B 3B40A 4JI0O 2UUBO 2ZXWB 3ABTA 4P9PA 4WFAV 3UKMA 2EINC 5LHIA 3UQ8A 2ZNIA 1MMMA 1I5YA 2M7WA 2YEVA 5CA0B 3G67A 4B7EA 2HFEC 3DXRB 1WP7A 3NXSA 3C90A 4JI6O 5J2UA 2GDSA 1NVPB 4MTFA 1GN2A 1SQFA 3OTOO 5BR8B 1IJGA 4X62O 1BGYH 2YXLA 1K73W 3BPZA 1BHBA 2VS0A 3UT5B 2BE3A 4ZHQB 1AR4A 1O9GA 3JSNA 4YHHB 5B1BB 1D2DA 1SA0B 2CGOA 1AILA 2ZD9A 2AZ0A 3OMNB 4DV3O 1H2SB 5L3BA 1R6TA 1Z2GA 2LGWA 3KKYA 3OUSA 4DV7O 3AK1A 1TVKA 1N8RW 3B8MA 3AG1C 5JH7A 4TT3G 3M7MX 2P22C 1JPXA 4LNUA 1FD9A 4W4KA 2WLHA 3JAWB 1SF9A 1RM1C 3CRQA 1KD1W 4H44B 1NTMH 3SJAC 2KG7B 5IDJA 4HNAB 5LMUO 1K4DC 2ILMA 5EBWC 4N23A 1QHTA 1M93A 1Q86W 3E8BA 4FPPA 3JAKA 3E8FA 3LNNA 3OEEG 1YTFD 4UCOA 2G38A 2DYRB 3IC7A 2PUSA 3ZHTA 3ZHSA 2CK3G 1M5IA 1M56B 3EHBB 5KA6A 3VQXA 5JCOA 2PYJA 4R6ZA 3D3IA 3CC7V 2UUAO 5LP6C 1KBHA 2DWDC 2OTLV 5FNVB 1SS3A 3P3PA 5CBGA 3ZRVA 1L8DA 3Q4HB 2LP7A 2L6LA 2VRZA 3FAVB 4KHPO 4LFBB 4EB6B 5EC1C 3K0GA 3B77A 1S77D 1AVMA 3SPIA 4AI8A 2GHYA 5JQGB 3IGAC 4WBNA 3UO3A 2QEXV 1UFIA 5JCOC 3FB5C 1LUWA 4DV1B 4X1YB 2XT9A 2UXDB 5BZBA 3ABKB 4E4EA 1PM9A 5E79Z 3DC5A 3N2KA 4FLZA 1E1QG 2HP8A 4ICGA 4DV0O 1HNXB 3CPWU 1SQPH 3RWRD 5ITZA 1FXKB 4LFAO 1YJ9V 1NU1H 5HFLA 1ZTEA 5IYCO 4WFBV 1FXVA 3RYHB 4G28B 4O4LA 4JGSA 4D6TH 2ZR2A 3FB7C 3R65A 4IGGA 3K5NA 3CMAV 1KP3A 1IURA 1GN6A 2UUCB 1T5EA 2QDOA 2XASA 4X1KA 4PDRA 3G80A 3E89A 5KHJA 4JI8B 2QSAA 4Q20A 4FLVA 1GN3A 1ZLZA 5L3CA 2CTQA 2Y69C 3S3WA 2EZPA 5BMVA 3E8HA 2ADQB 2WAMA 2F23A 2CTPA 1NH2D 3ZRSA 4B3MB 1Q3EA 1XI1A 1TUBA 4U7OA 2CH7A 4FFKA 4X64O 2EIMB 3SYCA 3X2QB 5LYJA 4I9WA 1ORQC 1S3JA 2H3OA 5DM6V 3WB1A 3H1IH 2FL4A 2JEUA 1XHXA 2DW4A 3RVYA 4X8AA 5AG2A 2X0LA 2B1GA 1WB7A 1SZTA 3CCUV 2EIJB 2D2CB 3PJSK 2AHYA 5E1AC 3H1KH 3H01A 1FJGB 4DUYO 3CXHF 1XL4A 2ZXWC 3QNEA 3I55V 3DC6A 4O4JB 4JI2B 3BFRA 1SESA 4JI1O 1WP8A 4DV5B 4O4IA 3OM3B 3OFNG 2NNUA 4Z1VA 1J5EO 2OIGA 5LMNO 2BOCC 1YI2V 4BIOA 3TETA 1KKCA 1BE3H 1VQPV 4GLXA 4CH3A 1I94O 3IFXA 2JJ2G 2DQ3A 3UM7A 2IU0A 3HKEB 1DF5A 3LSSA 3P32A 2EINB 4UVBA 1KMIZ 3D36A 1VF7A 3CB2A 4FIPC 1K97A 1XQ8A 4KXRA 4YJ2A 4UFZA 5B1AC 4GX1A 5LOVB 1US6A 4TUYB 3BA9A 2UXCB 5EZYA 4MTGA 2PI4A 4JV5O 4U3FH 2ADPA 4MVOA 5LGNA 5B1BC 4GKJO 3AK2A 2P67A 3CYOA 3ZMSA 1KQSU 3JATA 1Q5OA 3A0RA 5DN6G 4NXMB 2RNBA 4FM1A 1SC5B 3WFVA 2AGAA 3AG3C 1NH2B 4TQFA 2YEVB 3JCUZ 3RYFA 2ODMA 3EFFK 1Y66A 4JTDB 3W7UA 4TOIA 4GYCB 5J2UB 3LDCA 1JFFA 2LFRA 1PL0A 1VQKV 1PNMA 4R7CA 2YICA 1JR9A 4UCUA 2AZ2A 3KCYA 1MZFA 4MTOA 4PJ0Z 2YUAA 1KYOF 1SQXH 1IXMA 3T1HO 5H6QA 1M57B 1FYJA 4ABMA 3CC4V 1XMOO 2QM7A 2YIDA 1WPXA 4GKKO 4XDJA 1IBMO 3W7XA 3L9DA 3CCMV 3J7AU 4RQFA 3AG1B 3MDSA 4GCZA 1W0KG 4OGQB 2WPDG 2JVDA 5LHHA 3AG4C 1V54C 3CJHA 3ZRXA 5IYBO 1RM1B 2Q73A 3ICXA 2UXBB 1IBKO 4MVUA 5D5QA 2E76B 1Q82W 3ML0A 4B3SO 4CS2A 1HNWB 1PPJH 3KCXA 2HG5C 1Y74A 1XNQB 1MG1A 1OZ0A 1Q81W 4LNUB 2MK3A 1SQVH 4EKWA 3BCCH 2O57A 1JOYA 4LF8O 2QWNB 2GV9A 5C8YA 4LF6O 5LP6B 3ABKC 4JI3B 3FB6C 4B08A 5CBHA 1HR0O 3JAKB 2B1IA 4LWSB 3SYQA 4L8JA 2W6IG 2HHHB 1OHHG 1NTKH 4FLXA 2XNDG 5HFMA 1EN4A 1FXKC 4JI5B 1YJNV 2YXHA 2ZE8A 2GUZA 4I50A 2YC0A 3K04A 2XUMA 4UCTA 2B5UA 3ZHUA 4B3TO 4EFBA 1VQOV 2CTWA 3K5MA 5J9PC 1Q6HA 1QNMA 4NR1A 1BHAA 1L1FA 3JASB 5JWPA 1GM8A 4WBNB 4JI4B 1D5AA 1R3LC 2CGNA 2QJ1A 1YVWA 1ZWIC 1CPYA 5LL6Y 1K9MW 1XBLA 1WB8A 2XAHA 5CN0A 1AJNA 1GN4A 3BA8A 1RPRA 3ABMB 2X6CA 1X59A 2BTQA 3U0ZA 3N2KB 2Q69A 3BABA 3CEIA 1GH6A 1XUQA 3FYEB 1N36B 4AQYO 2IW5A 4LF5O 1JJ2U 4QGPA 4F6RB 1MNGA 2Y69B 4TV9A 4GX2A 1KKDA 2BCCH 3DTUB 3RN4A 5KMGA 3ABLC 3B4SA 4RAIA 2VWKA 4QPJA 2OCHA 4F4LA 3ZIAG 4X1KB 3CRCA 3K08A 1VQ4V 1O9HA 4CH5A 2ZM6B 4DW0A 1AI5A 1YHQV 4UV9A 1NTZH 5GONA 4CH6A 4CC5A 4UXNA 1AP6A 4CH4A 4MVZA 3L71H 1F7YA 2OWOA 1M4UA 1TUBB 2CH7B 5BR8O 3J80N 3O65A 1VQ6V 4MTXA 2FMLA 4O2AA 2IH1C 1KUQA 5LYJB 2ZIOA 1SQBH 1N34B 1B3QA 2X6AA 5L3DA 2Q6AA 1N33B 1BMFG 4PD4F 1VQMV 2F4VB 3ETEA 3CCRV 4YHHO 4O4HA 4UUJC 2V7QG 5LA6A 1ZSPA 3RYIB 3ZRWA 2ZINA 3SPJA 1VF6A 4YJ3B 1GK9A 3G4SV 4DW1A 1AJQA 4H37A 3W7SA 3OT7A 2QWRB 3CRAA 5IYZB 4O4IB 3VQYA 1EN6A 2DWEC 3T4DA 1H2GA 5B1AB 3E35A 4X65B 2QWOB 1R6NA 4PA6A 4IT5A 4X9QA 2E3CA 4LF9B 1IX9A 3CSXA 1Y67A 3FB8C 2N74A 3J81N 4LF4B 1QR9A 4CC6A 3ABUA 4FK5C 4J11A 4FVMA 4FM0A 5L3FA 2XHBA 4UVAA 1E79G 4DUZB 4GT1A 3IC9A 1M57C 2A06H 4JYAB 3AG3B 4PDLA 4FLUA 4FZ0A 2A3QA 4DR2B 1FKAO 4FMTA 3QO5A 4WFGA 4DR6B 5EZYB 4XBFA 1R3KC 4MS2A 3AG7A 3K79A 2CUGA 1CP9A 1A32A 1R3JC 1MA1A 1D5NA 3JATB 2VQFB 3OMAB 1EZJA 1SETA 3U10A 2N05A 1BQZA 4L87A 1BZKA 4LP8A 4XDLA 4LFBO 1H2KA 3RYFB 1KC8W 1XOUA 4JZ2A 1JFFB 2YSUB 1N0NA 3AG4B 1KB9F 1IDSA 2VWJA 1V54B 4DV1O 4J7JA 1AB3A 1XDCA 1IBLB 3GWKC 2UXDO 3PN1A 3JD0A 3JYCA 5LHGA 4JI7B 2IU3A 3F7VC 2ETNA 2F93B 3K0DA 4DV6B 2ITDC 3ZMUA 4UVCA 3TXSA 2QTSA 1VARA 2RQ6A 3L73H 1ZAUA 4JAUA 3RW0A 5JVDA 1HNXO 5IE9A 1Y76A 1W2BU 4K3AA 2DQ0A 3K3WA 3K5LA 1Q8IA 1VEWA 3K58A 1URFA 4RWUA 3CJHB 3L75H 3FFQA 2Y0PA 1H2NA 3STZC 4MVRA 3L72H 2YI8A 4RUEA 2XAFA 2Y48A 3ZHRA 5KHHA 2UUCO 1S5LZ 5B5EZ 2QWPB 3NR7A 2ZR3A 1HDJA 1JJOA 1R1BA 1E1RG 3F7YC 4QIWF 4JI8O 1EZVH 1Y74B 1TUEB 3U11A 4X89A 1BCCH 4GUNA 4RUFA 1WA8A 1NBMG 4P2ZA 4B3MO 2W0FC 3BEHA 1CXZB 1WN7A 2Q0OC 3K03A 2BTOA 5C8YB 2F1MA 5H6RA 2XAGA 3OGCC 2WA3A 1DF4A 5JJNB 3ABMC 2L35A 4BIUA 3WG7C 1WAZA 1UPGA 3GB7C 3FX7A 2QKSA 3ZJZA 5CB4A 3A8TA 2DYSB 4DR3B 3ZCCA 1FJGO 5GTHZ 2GUZB 4BR6A 4I50B 4JI2O 2ZNJA 3TK1A 2FB5A 3LSQA 4DV5O 1VQLV 2ARHA 2ZDIA 4G2KA 4YY3B 1SQGA 4I4TB 2EILC 4R8CA 2F43G 3LUTB 3MD0A 4TV8A 2IH3C 3E83A 1OCRB 4WFFA 2Q4PA 1DK1A 1YXBA 3UO2A 3JAMN 4PV1B 1FFXA 1R3IC 2QTOA 2FYUH 3JD2A 4DRXA 3ABLB 3S3XA 4OX9B 2ZDIC 3N2GA 1IXBA 3A0HZ 2A79B 3L70H 1I7FA 3P3NA 2WLJA 4JYYA 4PHZA 1MABG 3QO7A 4YXWG 4B7KA 3CS5A 2UXCO 1JVMA 4DR7B 5KLVH 3H1JH 3ETDA 1Q43A 3CC2V 3KG2A 1VQNV 4HZ3A 3M99B 4TV9B 3RYCA 3JALA 1AP5A 4JTAB 4J9YB 4IHJB 1NT2B 5KMGB 2AW9A 1R73A 2FKXA 2QKAA 1Y4MA 2WSSG 1PP9H 2HJFC 4NXMO 3JD1A 3DGEA 5H5NA 4I9QA 1YEWA 4IYIA 4FM2A 5B3SC 2P06A 3K5OA 1QBZA 4X20A 2MW2B 3VOUA 4UB8Z 1GO3F 1H2LA 4JF3A 5CMUA 3EXAA 4FLTA 4O2AB 3APOA 1AJPA 1KP2A 1HNZB 1N4CA 4MVMA 5D5PA 3D36C 1WLEA 2OTJV 4O4HB 4CS4A 3K57A 5LA6B 4U7NA 3T1CA 3CP1A 2QM8A 1GAXA 3K59A 1WJZA 5LBQA 3T2MA 3JAWA 1FOUA 3LDEA 4J42A 1XMQB 4WCEV 2UXBO 2KG7A 4ZIBA 4HNAA 4N21A 3D3QA 2ZE5A 3JSLA 4NXNB 3D8CA 2LQTA 1HNWO 4WFHA 2GSMB 1I5XA 4K8ZA 1XNQO 2DE0X 2H8PC 4H13B 2WLIA 4QJFB 2P6JA 2Q5ZA 4QPKA 1PNLA 1OCOC 3HKDA 1BQ0A 3OD4A 3OR6C 3CCSV 5IY5C 4LBEC 3IAYA 4LFCB 4JI3O 1KECA 2EJRA 3CX5F 3CCLV 1GMGA 3C3SA 2LW1A 3THOA 3ZMTA 4K0KB 1VIBA 1EFRG 3OMIB 4U3JA 1G4YB 2HHHO 2P5OA 1VP7A 3MAQA 1B6QA 1TVKB 2EIKC 1LR1A 5JH7B 4JI5O 4PA9A 2DN9A 4DR4B 2PTMA 1OJHA 4JYCA 5KX5A 5FL7G 4X1YA 1L0LH 1RSOA 1G1XB 3A0BZ 2HR3A 1CEZA 1XNRB 3W7TA 1RFYA 3F5TA 3CCJV 1GM9A 4OPHA 5BXZA 4IYHA 3B8NA 3ZS8C 4JI4O 1SZXA 3SPGA 1VMGA 2HVKC 4TQDA 3T1YB 2VQEB 1K7DA 1IVSA 4BAYA 4O2BA 4X66B 4JZGA 3LDDA 3KDRA 3JARA 5CA3A 3SPHA 4HAMA 5JVDB 1Y76B 1PL4A 5A2QN 1N36O 2ITCC 2QM4A 1PV0A 4NTYA 2DJVA 5DEDA 1GRJA 5KUKA 1XREA 2UU9B 4DXWA 5IT9N 4DV2B 1AR5A 1PKXA 2DYSC 4YIPA 1AI4A 4B3RB 2RJZA 4G27B 1VQ9V 3SGIA 3ZHQA 2ZM6O 2R70A 3WG7B 2R72A 5KHKA 2Y4UA 4ZI7A 3G6EV 5LXTA 1WA8B 3VBBA 1ENVA 5FPRA 5ITZB 5EYPA 1OCRC 2Q7EA 4IIJA 2WLLA 1V55C 5C93A 3QG5A 3JD3A 4KFMA 4O4LB 1FAFA 4DR5B 4FLWA 2GTAA 3SJBC 1N34O 1TAEA 4DR1B 2RN9A 1K3EA 2Y0IA 1RP3B 1N33O 2F4VO 2EILB 4LF7B 4GZRB 1DTOA 4PA7A 3ZN1A 2R9AA 3ASNB 3BRCA 5CB4B 2EULA 4FZ1A 3APQA 3QTCA 1XHZA 1ZUQA 3B2EE 3R66A 2KQXA 3JD4A 1BT8A 3CXCU 5BMVB 1F51A 3CWBH 2AHZA 1RPOA 4ZOLA 4CZZA 5IWAB 3VQWA 1Z5WA 3HKEA 1VF5B 3K9SA 1JMKC 4OXSA 3SPCA 4X65O 1F23A 3K9AA 1N32B 1Z5VA 1LUVA 1OCZC 4MVSA 4TV8B 3JCZA 1ZL8A 5LOVA 4E2LA 1YIJV 3E2EA 4LF9O 4NKGB 4PDVA 2JK5C 4DO2A 1FFXB 4LF4O 1K33A 2QR4A 4DV4B 2YS8A 2CTRA 4DRXB 2B9ZA 2E5LB 4I55A 4ZKIA 4DUZO 3N2GB 4JPRA 4FFBA 3OTFA 4JYAO 2YI9A 5CBFA 4FLYA 3GVMA 1DLBA 1F4MA 4YIOA 4DR2O 4DR6O 4DK0A 1TA8A 3A2FA 2JGUA 5KHIA 5B3SB 4OPAA 2QGNA 4CS3A 2BOBC 5B1NA 4Z2WA 3RYCB 3JALB 4I0XA 3M8AA 4PELA 3RVZA 5J2TA 2PY5A 4IL6Z 4J10A 3TCUA 4BWAA 2VQFO 4WFEA 3E22A 1VF6C 2RDCA 4P9OA 2UUBB 4JI0B 1OV9A 2FTKA 1OCCC 1BSMA 1NR1A 2LW7A 5H2FZ 5DECA 2HLDG 1K8AW 2OCCC 4LC1A 4MW8A 1G6UA 4QE7A 2IJKA 4YJ2B 4C7UA 5TISZ 4X20B 1IBLO 4NB5A 3I56V 3BAAA 2HVJC 2WLMA 1YSCA 4JI7O 4DV6O 1YF2A 1ROPA 1VQ8V 4JI6B 1S76D 1U96A 2EJ7A 3T4ZA 5IJ0A 3P30A 2WWWA 4J41A 3OTOB 1TGOA 4X62B 2IJIA 1IZ3A 1OCOB 1NJIW 1Q7YW 1WPBA 5KHGA 1KU9A 5IY5B 3QF7A 2IM9A 4NYKA 2GBOA 3SJQC 4H33A 2EX3A 3E86A 2BSKA 2JS3A 2RCVA 4LH6A 5LGTA 3WU2Z 3B09A 5LP6A 1I08A 3WB0A 1YJWV 2Z5UA 4Z1MG 4DV3B 2ZE7A 2PF4E 4I5SA 1EBOA 2WLIB 1H38A 3EVKA 1N0JA 3HKCA 2ZIMA 2A0LA 4XDKA 4LWSA 2KSDA 3AK3A 3HKDB 5IJ9A 2EIKB 1NKDA 4DV7B 4NTXA 1JA8A 1S72V 3HKBA 2F95B 2F66C 3DSQA 4H0LB 5K1PA 4A5UB 1H8EG 2A9HA 3ZMZA 4DYLA 2PGGA 2Q7GA 3ETQA 5LMUB 2D3OW 3CCQV 3HPLC 2JEXA 2P4KA 2EBOA 4U3JB 3OGIB 2Q8VA 3OAAG 3ZHVA 2HKOA 3JASA 1H5WA 4DR3O 2Q0AA 4BW9A 5KX5B 1THZA 2LO1A 2QA4V 1ZX3A 1RSOB 2OIEA 3I5DA 3ETGA 4YY3O 2KB1A 2XAJA 3G71V 4DK1A 1MSWD 2UUAB 2HJDA 2Z3YA 2JGDA 4UB6Z 1XEQA 3OE7G 1XL6A 1S0VA 5CA1A 2JS5A 5GTIZ 4Q6GA 1P4RA 1QLEB 4KHPB 4F6RA 1GTOA 4X1IA 2RMKB 2E74B 3BHPA 2Q68A 4R50A 2XTAA 5H9CA 4O2BB 4RQEA 3ASOB 4OX9O 1Y6XA 5EBMC 3JARB 1V9PA 2WLKA 3HR0A 3OEHG 3SYOA 1JCHA 1Q6IA 4DR7O 5EK0A 4MVQA 1K92A 1K4CC 3AEIA 3W7WA 2X6BA 4KL1A 2WLNA 1JX9A 2NR5A 2K1EA 2UXXA 4DV0B 3ASNC 3TGUH 2XOKG 3RGBA 3OR7C 4LH7A 2ZKOA 1V55B 4ASUG 1YTFB 1QCEA 4LFAB 3ZN0A 3GWOA 4LCUC 1DGSA 3STLC 2QKCA 5B1OA 4K35A 2CDYA 3SJCC 3OUFA 1NS1A 2BTQB 1G8MA 2P7TC 4GX0A 1K5SA 1J95A 4ZI7B 1YDXA 4JTCB 1EM1A 2GTSA 3AG2B 2PZSA 2W0XA 5LXTB 2AXTZ 5EYPB 5CA0A 4JAAA 3RYIA 4IIJB 2H94A 2WLLB 2A7WA 1S5HC 3DXRA 1K5QA 2W6JG 4RO2A 3LNMB 4QNHB 4YJ3A 3HB3B 2Y4TA 1QLNA 1Q90D 4D7TA 1HNZO 5IYZA 2LFSA 2ZCEA 2KKWA 3BY6A 2DMXA 3TXQA 1QQCA 5FLXN 1FS0G 1OCZB 1W59A 4X64B 2JIZG 5LGUA 3UT5A 3K06A 2HEPA 4ZHQA 3F5WC 5GONB 3C3TA 1XMQO 4UV8A 2YIBA 3G6BA 4PA3A 5K1XA 1S5JA 3CHXA 3L74H 4ZOLB 1MSDA 1GM7A 5FPOA 1SA0A 3SR2C 4NXNO 3SDLA 2R9IA 1M1KW 4TSFG 5EIBC 2QE7G 4DUYB 2ZT9B 2DOSA 3ZEDA 4BIZA 2N04A 5KAFZ 1ZL8B 2E75B 2Z0AA 2NLJC 5F2VO 1LNQA 4JI1B 1SQQH 3CCEV 1QR8A 1HP8A 1SKVA 2LGQA 3MHSC 3N27A 5B66Z 1J5EB 3H9VA 5KUMA 5LMNB 3ZRWB 4LFCO 2LJ2A 4I55B 2X7RB 1BS3A 1I94B 1VQ5V 4FFBB 3FYIB 2PYLA 1QVGU 1P49A 1OCCB 4TWKA 4K0KO 4WF9V 2IJHA 4AHCA 2OCCB 1FXHA 4UCRA 1BL8A 4UCVA 3CD6V 2IBZH 5GW7A 4I0XB 4DR4O 5J2TB 1AI6A 1PNKA 2OYQA 1YCIA 1GKFA 4J80A 2ATKC 2M6YA 2QWQB 3O9OA 3E22B 4JV5B 1SRYA 4MW3A 4F6EA 1XNRO 1WNSA 3SYPA 1AR1B 1NR7A 1NI8A 4GKJB
chains in the Genus database with same CATH topology
4FFKA 4C7UA 2GDSA 1EN4A 2CE4A 1JR9A 1GN2A 5AG2A 4JZ2A 5A9GA 1WB7A 1N0NA 1IDSA 1ZUQA 4BR6A 1SZXA 1XDCA 1BT8A 3C3TA 1QNMA 1ZSPA 1AVMA 1AR4A 3DC6A 1I0HA 3K9SA 1MSDA 1LUWA 1VARA 3BFRA 4JZGA 3TJTA 4E4EA 3MDSA 1LUVA 3OT7A 1PM9A 3KDRA 1EN5A 1WB8A 3DC5A 1PL4A 1VEWA 1GN4A 1EN6A 1KKCA 2RCVA 3CEIA 1IXBA 1XUQA 4X9QA 1I08A 1IX9A 1XREA 3KKYA 1ZTEA 1Y67A 4JYYA 3AK1A 3EVKA 1AR5A 1N0JA 4YIPA 1P7GA 3LSUA 1BS3A 4YIOA 1MNGA 3AK3A 3IC9A 1XILA 3RN4A 1JA8A 1GN6A 1AP5A 4GUNA 2QKCA 2AW9A 2CDYA 3C3SA 2QKAA 1B06A 2ADPA 1EM1A 1GN3A 3AK2A 1ZLZA 2P4KA 2ADQB 1MMMA 1MA1A 1D5NA 4F6EA 1BSMA 3QVNA 1AP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FFK A;  4C7U A;  2GDS A;  1EN4 A;  2CE4 A;  1JR9 A;  1GN2 A;  5AG2 A;  4JZ2 A;  5A9G A;  1WB7 A;  1N0N A;  1IDS A;  1ZUQ A;  4BR6 A;  1SZX A;  1XDC A;  1BT8 A;  3C3T A;  1QNM A;  1ZSP A;  1AVM A;  1AR4 A;  3DC6 A;  1I0H A;  3K9S A;  1MSD A;  1LUW A;  1VAR A;  3BFR A;  4JZG A;  3TJT A;  4E4E A;  3MDS A;  1LUV A;  3OT7 A;  1PM9 A;  1EN5 A;  1WB8 A;  3DC5 A;  1PL4 A;  1VEW A;  1GN4 A;  1EN6 A;  1KKC A;  2RCV A;  3CEI A;  1IXB A;  1XUQ A;  4X9Q A;  1I08 A;  1IX9 A;  1XRE A;  3KKY A;  1ZTE A;  1Y67 A;  4JYY A;  3AK1 A;  3EVK A;  1AR5 A;  1N0J A;  4YIP A;  1P7G A;  3LSU A;  1BS3 A;  4YIO A;  1MNG A;  3AK3 A;  3IC9 A;  1XIL A;  3RN4 A;  1JA8 A;  1GN6 A;  1AP5 A;  4GUN A;  2QKC A;  2AW9 A;  2CDY A;  3C3S A;  2QKA A;  1B06 A;  2ADP A;  1EM1 A;  1GN3 A;  3AK2 A;  1ZLZ A;  2P4K A;  2ADQ B;  1MMM A;  1MA1 A;  1D5N A;  4F6E A;  1BSM A;  3QVN A;  1AP6 A; 
#chains in the Genus database with same CATH topology
 1U97 A;  3H1L H;  4J9Z B;  4X88 A;  3ZX6 A;  1NQT A;  4MSW C;  1M90 W;  5FNV A;  2V1D A;  1X4T A;  2IJJ A;  3T1Y O;  2VQE O;  3Q4H A;  5L3G A;  2P90 A;  1FFT B;  3FAV A;  2CAZ C;  2DYR C;  4EB6 A;  2XAQ A;  4X66 O;  5JQG A;  1M56 C;  3CE2 A;  2V4D A;  2OT5 A;  1H8H G;  5IJ0 B;  3VQV A;  1SER A;  3T1H B;  3TJT A;  1XMO B;  5BY1 A;  2Q67 A;  4MT8 A;  2WA4 A;  4GKK B;  1IBM B;  2UU9 O;  4DV2 O;  1FXK A;  4B3R O;  4W4L A;  2PI5 A;  2UXN A;  5JJJ B;  2BSK B;  3RYH A;  1NZ6 A;  4P30 A;  2YXY A;  2EZO A;  1Q6U A;  3KZI Z;  4J7K A;  3LSU A;  4BW5 A;  2C2A A;  3CME V;  5JJE B;  1HWY A;  4PDM A;  4I7Z B;  3OW2 U;  1IBK B;  1L0N H;  3HKC B;  3CRR A;  4GX5 A;  1M9N A;  2JDI G;  1XIL A;  1JQ0 A;  4ZBM A;  2NN4 A;  1P7B A;  5IJ9 B;  3QO8 A;  2YIA A;  4LR3 A;  4B3S B;  1MZE A;  4PA4 A;  3CCV V;  3H1H H;  4EEQ A;  1B06 A;  3HKB B;  2JJ1 G;  4D7S A;  1QLE C;  2Q9L A;  4NTW A;  1VQ7 V;  4DR5 O;  5L3E A;  4KUM A;  3WB2 A;  4DR1 O;  2P4V A;  3ASO C;  4LF8 B;  1FPO A;  4LF7 O;  4JAS A;  5KA5 A;  1QVF U;  4AIL C;  4FJC C;  1JNB A;  3QVN A;  4QE9 A;  4I4T A;  4LF6 B;  3ZMV A;  1R6K A;  3RT3 C;  1NVP D;  2K9P A;  1HR0 B;  1YZB A;  5EIB D;  4HBN A;  3ZBH A;  2CE4 A;  3MHH C;  2Q7H A;  4EFE A;  2ZQM A;  5A9G A;  5IWA O;  3CRM A;  5KAI Z;  2YDE A;  4KP4 A;  3UCS C;  1QU7 A;  1N32 O;  4JYB A;  2YIB D;  4O4J A;  2JGD B;  2EIM C;  3X2Q C;  1I0H A;  4J7Z A;  5CA1 B;  2R9R B;  4B3T B;  3AG2 C;  5EBL C;  4PI0 A;  3RBZ A;  1W0J G;  4JAV A;  4DV4 O;  1EN5 A;  4X1I B;  2E5L O;  3BVO A;  4IHJ A;  1COW G;  5IYD O;  1ARO P;  4PI2 A;  2EIJ C;  2JRI A;  1B04 A;  3IJ4 A;  5EC2 C;  3RFR A;  4K8X A;  1PD3 A;  3FKS G;  1H2M A;  3SYA A;  1AI7 A;  1P84 F;  1P7G A;  2ZE6 A;  3E8G A;  1UJW B;  1K34 A;  4HYO A;  4TUY A;  1MOF A;  4NVP A;  4UCS A;  1YIT V;  3FD9 A;  1F4N A;  4CBC A;  4AQY B;  1HW7 A;  4LF5 B;  3B40 A;  4JI0 O;  2UUB O;  2ZXW B;  3ABT A;  4P9P A;  4WFA V;  3UKM A;  2EIN C;  5LHI A;  3UQ8 A;  2ZNI A;  1MMM A;  1I5Y A;  2M7W A;  2YEV A;  5CA0 B;  3G67 A;  4B7E A;  2HFE C;  3DXR B;  1WP7 A;  3NXS A;  3C90 A;  4JI6 O;  5J2U A;  2GDS A;  1NVP B;  4MTF A;  1GN2 A;  1SQF A;  3OTO O;  5BR8 B;  1IJG A;  4X62 O;  1BGY H;  2YXL A;  1K73 W;  3BPZ A;  1BHB A;  2VS0 A;  3UT5 B;  2BE3 A;  4ZHQ B;  1AR4 A;  1O9G A;  3JSN A;  4YHH B;  5B1B B;  1D2D A;  1SA0 B;  2CGO A;  1AIL A;  2ZD9 A;  2AZ0 A;  3OMN B;  4DV3 O;  1H2S B;  5L3B A;  1R6T A;  1Z2G A;  2LGW A;  3KKY A;  3OUS A;  4DV7 O;  3AK1 A;  1TVK A;  1N8R W;  3B8M A;  3AG1 C;  5JH7 A;  4TT3 G;  3M7M X;  2P22 C;  1JPX A;  4LNU A;  1FD9 A;  4W4K A;  2WLH A;  3JAW B;  1SF9 A;  1RM1 C;  3CRQ A;  1KD1 W;  4H44 B;  1NTM H;  3SJA C;  2KG7 B;  5IDJ A;  4HNA B;  5LMU O;  1K4D C;  2ILM A;  5EBW C;  4N23 A;  1QHT A;  1M93 A;  1Q86 W;  3E8B A;  4FPP A;  3JAK A;  3E8F A;  3LNN A;  3OEE G;  1YTF D;  4UCO A;  2G38 A;  2DYR B;  3IC7 A;  2PUS A;  3ZHT A;  3ZHS A;  2CK3 G;  1M5I A;  1M56 B;  3EHB B;  5KA6 A;  3VQX A;  5JCO A;  2PYJ A;  4R6Z A;  3D3I A;  3CC7 V;  2UUA O;  5LP6 C;  1KBH A;  2DWD C;  2OTL V;  5FNV B;  1SS3 A;  3P3P A;  5CBG A;  3ZRV A;  1L8D A;  3Q4H B;  2LP7 A;  2L6L A;  2VRZ A;  3FAV B;  4KHP O;  4LFB B;  4EB6 B;  5EC1 C;  3K0G A;  3B77 A;  1S77 D;  1AVM A;  3SPI A;  4AI8 A;  2GHY A;  5JQG B;  3IGA C;  4WBN A;  3UO3 A;  2QEX V;  1UFI A;  5JCO C;  3FB5 C;  1LUW A;  4DV1 B;  4X1Y B;  2XT9 A;  2UXD B;  5BZB A;  3ABK B;  4E4E A;  1PM9 A;  5E79 Z;  3DC5 A;  3N2K A;  4FLZ A;  1E1Q G;  2HP8 A;  4ICG A;  4DV0 O;  1HNX B;  3CPW U;  1SQP H;  3RWR D;  5ITZ A;  1FXK B;  4LFA O;  1YJ9 V;  1NU1 H;  5HFL A;  1ZTE A;  5IYC O;  4WFB V;  1FXV A;  3RYH B;  4G28 B;  4O4L A;  4JGS A;  4D6T H;  2ZR2 A;  3FB7 C;  3R65 A;  4IGG A;  3K5N A;  3CMA V;  1KP3 A;  1IUR A;  1GN6 A;  2UUC B;  1T5E A;  2QDO A;  2XAS A;  4X1K A;  4PDR A;  3G80 A;  3E89 A;  5KHJ A;  4JI8 B;  2QSA A;  4Q20 A;  4FLV A;  1GN3 A;  1ZLZ A;  5L3C A;  2CTQ A;  2Y69 C;  3S3W A;  2EZP A;  5BMV A;  3E8H A;  2ADQ B;  2WAM A;  2F23 A;  2CTP A;  1NH2 D;  3ZRS A;  4B3M B;  1Q3E A;  1XI1 A;  1TUB A;  4U7O A;  2CH7 A;  4FFK A;  4X64 O;  2EIM B;  3SYC A;  3X2Q B;  5LYJ A;  4I9W A;  1ORQ C;  1S3J A;  2H3O A;  5DM6 V;  3WB1 A;  3H1I H;  2FL4 A;  2JEU A;  1XHX A;  2DW4 A;  3RVY A;  4X8A A;  5AG2 A;  2X0L A;  2B1G A;  1WB7 A;  1SZT A;  3CCU V;  2EIJ B;  2D2C B;  3PJS K;  2AHY A;  5E1A C;  3H1K H;  3H01 A;  1FJG B;  4DUY O;  3CXH F;  1XL4 A;  2ZXW C;  3QNE A;  3I55 V;  3DC6 A;  4O4J B;  4JI2 B;  3BFR A;  1SES A;  4JI1 O;  1WP8 A;  4DV5 B;  4O4I A;  3OM3 B;  3OFN G;  2NNU A;  4Z1V A;  1J5E O;  2OIG A;  5LMN O;  2BOC C;  1YI2 V;  4BIO A;  3TET A;  1KKC A;  1BE3 H;  1VQP V;  4GLX A;  4CH3 A;  1I94 O;  3IFX A;  2JJ2 G;  2DQ3 A;  3UM7 A;  2IU0 A;  3HKE B;  1DF5 A;  3LSS A;  3P32 A;  2EIN B;  4UVB A;  1KMI Z;  3D36 A;  1VF7 A;  3CB2 A;  4FIP C;  1K97 A;  1XQ8 A;  4KXR A;  4YJ2 A;  4UFZ A;  5B1A C;  4GX1 A;  5LOV B;  1US6 A;  4TUY B;  3BA9 A;  2UXC B;  5EZY A;  4MTG A;  2PI4 A;  4JV5 O;  4U3F H;  2ADP A;  4MVO A;  5LGN A;  5B1B C;  4GKJ O;  3AK2 A;  2P67 A;  3CYO A;  3ZMS A;  1KQS U;  3JAT A;  1Q5O A;  3A0R A;  5DN6 G;  4NXM B;  2RNB A;  4FM1 A;  1SC5 B;  3WFV A;  2AGA A;  3AG3 C;  1NH2 B;  4TQF A;  2YEV B;  3JCU Z;  3RYF A;  2ODM A;  3EFF K;  1Y66 A;  4JTD B;  3W7U A;  4TOI A;  4GYC B;  5J2U B;  3LDC A;  1JFF A;  2LFR A;  1PL0 A;  1VQK V;  1PNM A;  4R7C A;  2YIC A;  1JR9 A;  4UCU A;  2AZ2 A;  3KCY A;  1MZF A;  4MTO A;  4PJ0 Z;  2YUA A;  1KYO F;  1SQX H;  1IXM A;  3T1H O;  5H6Q A;  1M57 B;  1FYJ A;  4ABM A;  3CC4 V;  1XMO O;  2QM7 A;  2YID A;  1WPX A;  4GKK O;  4XDJ A;  1IBM O;  3W7X A;  3L9D A;  3CCM V;  3J7A U;  4RQF A;  3AG1 B;  3MDS A;  4GCZ A;  1W0K G;  4OGQ B;  2WPD G;  2JVD A;  5LHH A;  3AG4 C;  1V54 C;  3CJH A;  3ZRX A;  5IYB O;  1RM1 B;  2Q73 A;  3ICX A;  2UXB B;  1IBK O;  4MVU A;  5D5Q A;  2E76 B;  1Q82 W;  3ML0 A;  4B3S O;  4CS2 A;  1HNW B;  1PPJ H;  3KCX A;  2HG5 C;  1Y74 A;  1XNQ B;  1MG1 A;  1OZ0 A;  1Q81 W;  4LNU B;  2MK3 A;  1SQV H;  4EKW A;  3BCC H;  2O57 A;  1JOY A;  4LF8 O;  2QWN B;  2GV9 A;  5C8Y A;  4LF6 O;  5LP6 B;  3ABK C;  4JI3 B;  3FB6 C;  4B08 A;  5CBH A;  1HR0 O;  3JAK B;  2B1I A;  4LWS B;  3SYQ A;  4L8J A;  2W6I G;  2HHH B;  1OHH G;  1NTK H;  4FLX A;  2XND G;  5HFM A;  1EN4 A;  1FXK C;  4JI5 B;  1YJN V;  2YXH A;  2ZE8 A;  2GUZ A;  4I50 A;  2YC0 A;  3K04 A;  2XUM A;  4UCT A;  2B5U A;  3ZHU A;  4B3T O;  4EFB A;  1VQO V;  2CTW A;  3K5M A;  5J9P C;  1Q6H A;  1QNM A;  4NR1 A;  1BHA A;  1L1F A;  3JAS B;  5JWP A;  1GM8 A;  4WBN B;  4JI4 B;  1D5A A;  1R3L C;  2CGN A;  2QJ1 A;  1YVW A;  1ZWI C;  1CPY A;  5LL6 Y;  1K9M W;  1XBL A;  1WB8 A;  2XAH A;  5CN0 A;  1AJN A;  1GN4 A;  3BA8 A;  1RPR A;  3ABM B;  2X6C A;  1X59 A;  2BTQ A;  3U0Z A;  3N2K B;  2Q69 A;  3BAB A;  3CEI A;  1GH6 A;  1XUQ A;  3FYE B;  1N36 B;  4AQY O;  2IW5 A;  4LF5 O;  1JJ2 U;  4QGP A;  4F6R B;  1MNG A;  2Y69 B;  4TV9 A;  4GX2 A;  1KKD A;  2BCC H;  3DTU B;  3RN4 A;  5KMG A;  3ABL C;  3B4S A;  4RAI A;  2VWK A;  4QPJ A;  2OCH A;  4F4L A;  3ZIA G;  4X1K B;  3CRC A;  3K08 A;  1VQ4 V;  1O9H A;  4CH5 A;  2ZM6 B;  4DW0 A;  1AI5 A;  1YHQ V;  4UV9 A;  1NTZ H;  5GON A;  4CH6 A;  4CC5 A;  4UXN A;  1AP6 A;  4CH4 A;  4MVZ A;  3L71 H;  1F7Y A;  2OWO A;  1M4U A;  1TUB B;  2CH7 B;  5BR8 O;  3J80 N;  3O65 A;  1VQ6 V;  4MTX A;  2FML A;  4O2A A;  2IH1 C;  1KUQ A;  5LYJ B;  2ZIO A;  1SQB H;  1N34 B;  1B3Q A;  2X6A A;  5L3D A;  2Q6A A;  1N33 B;  1BMF G;  4PD4 F;  1VQM V;  2F4V B;  3ETE A;  3CCR V;  4YHH O;  4O4H A;  4UUJ C;  2V7Q G;  5LA6 A;  1ZSP A;  3RYI B;  3ZRW A;  2ZIN A;  3SPJ A;  1VF6 A;  4YJ3 B;  1GK9 A;  3G4S V;  4DW1 A;  1AJQ A;  4H37 A;  3W7S A;  3OT7 A;  2QWR B;  3CRA A;  5IYZ B;  4O4I B;  3VQY A;  1EN6 A;  2DWE C;  3T4D A;  1H2G A;  5B1A B;  3E35 A;  4X65 B;  2QWO B;  1R6N A;  4PA6 A;  4IT5 A;  4X9Q A;  2E3C A;  4LF9 B;  1IX9 A;  3CSX A;  1Y67 A;  3FB8 C;  2N74 A;  3J81 N;  4LF4 B;  1QR9 A;  4CC6 A;  3ABU A;  4FK5 C;  4J11 A;  4FVM A;  4FM0 A;  5L3F A;  2XHB A;  4UVA A;  1E79 G;  4DUZ B;  4GT1 A;  3IC9 A;  1M57 C;  2A06 H;  4JYA B;  3AG3 B;  4PDL A;  4FLU A;  4FZ0 A;  2A3Q A;  4DR2 B;  1FKA O;  4FMT A;  3QO5 A;  4WFG A;  4DR6 B;  5EZY B;  4XBF A;  1R3K C;  4MS2 A;  3AG7 A;  3K79 A;  2CUG A;  1CP9 A;  1A32 A;  1R3J C;  1MA1 A;  1D5N A;  3JAT B;  2VQF B;  3OMA B;  1EZJ A;  1SET A;  3U10 A;  2N05 A;  1BQZ A;  4L87 A;  1BZK A;  4LP8 A;  4XDL A;  4LFB O;  1H2K A;  3RYF B;  1KC8 W;  1XOU A;  4JZ2 A;  1JFF B;  2YSU B;  1N0N A;  3AG4 B;  1KB9 F;  1IDS A;  2VWJ A;  1V54 B;  4DV1 O;  4J7J A;  1AB3 A;  1XDC A;  1IBL B;  3GWK C;  2UXD O;  3PN1 A;  3JD0 A;  3JYC A;  5LHG A;  4JI7 B;  2IU3 A;  3F7V C;  2ETN A;  2F93 B;  3K0D A;  4DV6 B;  2ITD C;  3ZMU A;  4UVC A;  3TXS A;  2QTS A;  1VAR A;  2RQ6 A;  3L73 H;  1ZAU A;  4JAU A;  3RW0 A;  5JVD A;  1HNX O;  5IE9 A;  1Y76 A;  1W2B U;  4K3A A;  2DQ0 A;  3K3W A;  3K5L A;  1Q8I A;  1VEW A;  3K58 A;  1URF A;  4RWU A;  3CJH B;  3L75 H;  3FFQ A;  2Y0P A;  1H2N A;  3STZ C;  4MVR A;  3L72 H;  2YI8 A;  4RUE A;  2XAF A;  2Y48 A;  3ZHR A;  5KHH A;  2UUC O;  1S5L Z;  5B5E Z;  2QWP B;  3NR7 A;  2ZR3 A;  1HDJ A;  1JJO A;  1R1B A;  1E1R G;  3F7Y C;  4QIW F;  4JI8 O;  1EZV H;  1Y74 B;  1TUE B;  3U11 A;  4X89 A;  1BCC H;  4GUN A;  4RUF A;  1WA8 A;  1NBM G;  4P2Z A;  4B3M O;  2W0F C;  3BEH A;  1CXZ B;  1WN7 A;  2Q0O C;  3K03 A;  2BTO A;  5C8Y B;  2F1M A;  5H6R A;  2XAG A;  3OGC C;  2WA3 A;  1DF4 A;  5JJN B;  3ABM C;  2L35 A;  4BIU A;  3WG7 C;  1WAZ A;  1UPG A;  3GB7 C;  3FX7 A;  2QKS A;  3ZJZ A;  5CB4 A;  3A8T A;  2DYS B;  4DR3 B;  3ZCC A;  1FJG O;  5GTH Z;  2GUZ B;  4BR6 A;  4I50 B;  4JI2 O;  2ZNJ A;  3TK1 A;  2FB5 A;  3LSQ A;  4DV5 O;  1VQL V;  2ARH A;  2ZDI A;  4G2K A;  4YY3 B;  1SQG A;  4I4T B;  2EIL C;  4R8C A;  2F43 G;  3LUT B;  3MD0 A;  4TV8 A;  2IH3 C;  3E83 A;  1OCR B;  4WFF A;  2Q4P A;  1DK1 A;  1YXB A;  3UO2 A;  3JAM N;  4PV1 B;  1FFX A;  1R3I C;  2QTO A;  2FYU H;  3JD2 A;  4DRX A;  3ABL B;  3S3X A;  4OX9 B;  2ZDI C;  3N2G A;  1IXB A;  3A0H Z;  2A79 B;  3L70 H;  1I7F A;  3P3N A;  2WLJ A;  4JYY A;  4PHZ A;  1MAB G;  3QO7 A;  4YXW G;  4B7K A;  3CS5 A;  2UXC O;  1JVM A;  4DR7 B;  5KLV H;  3H1J H;  3ETD A;  1Q43 A;  3CC2 V;  3KG2 A;  1VQN V;  4HZ3 A;  3M99 B;  4TV9 B;  3RYC A;  3JAL A;  1AP5 A;  4JTA B;  4J9Y B;  4IHJ B;  1NT2 B;  5KMG B;  2AW9 A;  1R73 A;  2FKX A;  2QKA A;  1Y4M A;  2WSS G;  1PP9 H;  2HJF C;  4NXM O;  3JD1 A;  3DGE A;  5H5N A;  4I9Q A;  1YEW A;  4IYI A;  4FM2 A;  5B3S C;  2P06 A;  3K5O A;  1QBZ A;  4X20 A;  2MW2 B;  3VOU A;  4UB8 Z;  1GO3 F;  1H2L A;  4JF3 A;  5CMU A;  3EXA A;  4FLT A;  4O2A B;  3APO A;  1AJP A;  1KP2 A;  1HNZ B;  1N4C A;  4MVM A;  5D5P A;  3D36 C;  1WLE A;  2OTJ V;  4O4H B;  4CS4 A;  3K57 A;  5LA6 B;  4U7N A;  3T1C A;  3CP1 A;  2QM8 A;  1GAX A;  3K59 A;  1WJZ A;  5LBQ A;  3T2M A;  3JAW A;  1FOU A;  3LDE A;  4J42 A;  1XMQ B;  4WCE V;  2UXB O;  2KG7 A;  4ZIB A;  4HNA A;  4N21 A;  3D3Q A;  2ZE5 A;  3JSL A;  4NXN B;  3D8C A;  2LQT A;  1HNW O;  4WFH A;  2GSM B;  1I5X A;  4K8Z A;  1XNQ O;  2DE0 X;  2H8P C;  4H13 B;  2WLI A;  4QJF B;  2P6J A;  2Q5Z A;  4QPK A;  1PNL A;  1OCO C;  3HKD A;  1BQ0 A;  3OD4 A;  3OR6 C;  3CCS V;  5IY5 C;  4LBE C;  3IAY A;  4LFC B;  4JI3 O;  1KEC A;  2EJR A;  3CX5 F;  3CCL V;  1GMG A;  3C3S A;  2LW1 A;  3THO A;  3ZMT A;  4K0K B;  1VIB A;  1EFR G;  3OMI B;  4U3J A;  1G4Y B;  2HHH O;  2P5O A;  1VP7 A;  3MAQ A;  1B6Q A;  1TVK B;  2EIK C;  1LR1 A;  5JH7 B;  4JI5 O;  4PA9 A;  2DN9 A;  4DR4 B;  2PTM A;  1OJH A;  4JYC A;  5KX5 A;  5FL7 G;  4X1Y A;  1L0L H;  1RSO A;  1G1X B;  3A0B Z;  2HR3 A;  1CEZ A;  1XNR B;  3W7T A;  1RFY A;  3F5T A;  3CCJ V;  1GM9 A;  4OPH A;  5BXZ A;  4IYH A;  3B8N A;  3ZS8 C;  4JI4 O;  1SZX A;  3SPG A;  1VMG A;  2HVK C;  4TQD A;  3T1Y B;  2VQE B;  1K7D A;  1IVS A;  4BAY A;  4O2B A;  4X66 B;  4JZG A;  3LDD A;  3KDR A;  3JAR A;  5CA3 A;  3SPH A;  4HAM A;  5JVD B;  1Y76 B;  1PL4 A;  5A2Q N;  1N36 O;  2ITC C;  2QM4 A;  1PV0 A;  4NTY A;  2DJV A;  5DED A;  1GRJ A;  5KUK A;  1XRE A;  2UU9 B;  4DXW A;  5IT9 N;  4DV2 B;  1AR5 A;  1PKX A;  2DYS C;  4YIP A;  1AI4 A;  4B3R B;  2RJZ A;  4G27 B;  1VQ9 V;  3SGI A;  3ZHQ A;  2ZM6 O;  2R70 A;  3WG7 B;  2R72 A;  5KHK A;  2Y4U A;  4ZI7 A;  3G6E V;  5LXT A;  1WA8 B;  3VBB A;  1ENV A;  5FPR A;  5ITZ B;  5EYP A;  1OCR C;  2Q7E A;  4IIJ A;  2WLL A;  1V55 C;  5C93 A;  3QG5 A;  3JD3 A;  4KFM A;  4O4L B;  1FAF A;  4DR5 B;  4FLW A;  2GTA A;  3SJB C;  1N34 O;  1TAE A;  4DR1 B;  2RN9 A;  1K3E A;  2Y0I A;  1RP3 B;  1N33 O;  2F4V O;  2EIL B;  4LF7 B;  4GZR B;  1DTO A;  4PA7 A;  3ZN1 A;  2R9A A;  3ASN B;  3BRC A;  5CB4 B;  2EUL A;  4FZ1 A;  3APQ A;  3QTC A;  1XHZ A;  1ZUQ A;  3B2E E;  3R66 A;  2KQX A;  3JD4 A;  1BT8 A;  3CXC U;  5BMV B;  1F51 A;  3CWB H;  2AHZ A;  1RPO A;  4ZOL A;  4CZZ A;  5IWA B;  3VQW A;  1Z5W A;  3HKE A;  1VF5 B;  3K9S A;  1JMK C;  4OXS A;  3SPC A;  4X65 O;  1F23 A;  3K9A A;  1N32 B;  1Z5V A;  1LUV A;  1OCZ C;  4MVS A;  4TV8 B;  3JCZ A;  1ZL8 A;  5LOV A;  4E2L A;  1YIJ V;  3E2E A;  4LF9 O;  4NKG B;  4PDV A;  2JK5 C;  4DO2 A;  1FFX B;  4LF4 O;  1K33 A;  2QR4 A;  4DV4 B;  2YS8 A;  2CTR A;  4DRX B;  2B9Z A;  2E5L B;  4I55 A;  4ZKI A;  4DUZ O;  3N2G B;  4JPR A;  4FFB A;  3OTF A;  4JYA O;  2YI9 A;  5CBF A;  4FLY A;  3GVM A;  1DLB A;  1F4M A;  4YIO A;  4DR2 O;  4DR6 O;  4DK0 A;  1TA8 A;  3A2F A;  2JGU A;  5KHI A;  5B3S B;  4OPA A;  2QGN A;  4CS3 A;  2BOB C;  5B1N A;  4Z2W A;  3RYC B;  3JAL B;  4I0X A;  3M8A A;  4PEL A;  3RVZ A;  5J2T A;  2PY5 A;  4IL6 Z;  4J10 A;  3TCU A;  4BWA A;  2VQF O;  4WFE A;  3E22 A;  1VF6 C;  2RDC A;  4P9O A;  2UUB B;  4JI0 B;  1OV9 A;  2FTK A;  1OCC C;  1BSM A;  1NR1 A;  2LW7 A;  5H2F Z;  5DEC A;  2HLD G;  1K8A W;  2OCC C;  4LC1 A;  4MW8 A;  1G6U A;  4QE7 A;  2IJK A;  4YJ2 B;  4C7U A;  5TIS Z;  4X20 B;  1IBL O;  4NB5 A;  3I56 V;  3BAA A;  2HVJ C;  2WLM A;  1YSC A;  4JI7 O;  4DV6 O;  1YF2 A;  1ROP A;  1VQ8 V;  4JI6 B;  1S76 D;  1U96 A;  2EJ7 A;  3T4Z A;  5IJ0 A;  3P30 A;  2WWW A;  4J41 A;  3OTO B;  1TGO A;  4X62 B;  2IJI A;  1IZ3 A;  1OCO B;  1NJI W;  1Q7Y W;  1WPB A;  5KHG A;  1KU9 A;  5IY5 B;  3QF7 A;  2IM9 A;  4NYK A;  2GBO A;  3SJQ C;  4H33 A;  2EX3 A;  3E86 A;  2BSK A;  2JS3 A;  2RCV A;  4LH6 A;  5LGT A;  3WU2 Z;  3B09 A;  5LP6 A;  1I08 A;  3WB0 A;  1YJW V;  2Z5U A;  4Z1M G;  4DV3 B;  2ZE7 A;  2PF4 E;  4I5S A;  1EBO A;  2WLI B;  1H38 A;  3EVK A;  1N0J A;  3HKC A;  2ZIM A;  2A0L A;  4XDK A;  4LWS A;  2KSD A;  3AK3 A;  3HKD B;  5IJ9 A;  2EIK B;  1NKD A;  4DV7 B;  4NTX A;  1JA8 A;  1S72 V;  3HKB A;  2F95 B;  2F66 C;  3DSQ A;  4H0L B;  5K1P A;  4A5U B;  1H8E G;  2A9H A;  3ZMZ A;  4DYL A;  2PGG A;  2Q7G A;  3ETQ A;  5LMU B;  2D3O W;  3CCQ V;  3HPL C;  2JEX A;  2P4K A;  2EBO A;  4U3J B;  3OGI B;  2Q8V A;  3OAA G;  3ZHV A;  2HKO A;  3JAS A;  1H5W A;  4DR3 O;  2Q0A A;  4BW9 A;  5KX5 B;  1THZ A;  2LO1 A;  2QA4 V;  1ZX3 A;  1RSO B;  2OIE A;  3I5D A;  3ETG A;  4YY3 O;  2KB1 A;  2XAJ A;  3G71 V;  4DK1 A;  1MSW D;  2UUA B;  2HJD A;  2Z3Y A;  2JGD A;  4UB6 Z;  1XEQ A;  3OE7 G;  1XL6 A;  1S0V A;  5CA1 A;  2JS5 A;  5GTI Z;  4Q6G A;  1P4R A;  1QLE B;  4KHP B;  4F6R A;  1GTO A;  4X1I A;  2RMK B;  2E74 B;  3BHP A;  2Q68 A;  4R50 A;  2XTA A;  5H9C A;  4O2B B;  4RQE A;  3ASO B;  4OX9 O;  1Y6X A;  5EBM C;  3JAR B;  1V9P A;  2WLK A;  3HR0 A;  3OEH G;  3SYO A;  1JCH A;  1Q6I A;  4DR7 O;  5EK0 A;  4MVQ A;  1K92 A;  1K4C C;  3AEI A;  3W7W A;  2X6B A;  4KL1 A;  2WLN A;  1JX9 A;  2NR5 A;  2K1E A;  2UXX A;  4DV0 B;  3ASN C;  3TGU H;  2XOK G;  3RGB A;  3OR7 C;  4LH7 A;  2ZKO A;  1V55 B;  4ASU G;  1YTF B;  1QCE A;  4LFA B;  3ZN0 A;  3GWO A;  4LCU C;  1DGS A;  3STL C;  2QKC A;  5B1O A;  4K35 A;  2CDY A;  3SJC C;  3OUF A;  1NS1 A;  2BTQ B;  1G8M A;  2P7T C;  4GX0 A;  1K5S A;  1J95 A;  4ZI7 B;  1YDX A;  4JTC B;  1EM1 A;  2GTS A;  3AG2 B;  2PZS A;  2W0X A;  5LXT B;  2AXT Z;  5EYP B;  5CA0 A;  4JAA A;  3RYI A;  4IIJ B;  2H94 A;  2WLL B;  2A7W A;  1S5H C;  3DXR A;  1K5Q A;  2W6J G;  4RO2 A;  3LNM B;  4QNH B;  4YJ3 A;  3HB3 B;  2Y4T A;  1QLN A;  1Q90 D;  4D7T A;  1HNZ O;  5IYZ A;  2LFS A;  2ZCE A;  2KKW A;  3BY6 A;  2DMX A;  3TXQ A;  1QQC A;  5FLX N;  1FS0 G;  1OCZ B;  1W59 A;  4X64 B;  2JIZ G;  5LGU A;  3UT5 A;  3K06 A;  2HEP A;  4ZHQ A;  3F5W C;  5GON B;  3C3T A;  1XMQ O;  4UV8 A;  2YIB A;  3G6B A;  4PA3 A;  5K1X A;  1S5J A;  3CHX A;  3L74 H;  4ZOL B;  1MSD A;  1GM7 A;  5FPO A;  1SA0 A;  3SR2 C;  4NXN O;  3SDL A;  2R9I A;  1M1K W;  4TSF G;  5EIB C;  2QE7 G;  4DUY B;  2ZT9 B;  2DOS A;  3ZED A;  4BIZ A;  2N04 A;  5KAF Z;  1ZL8 B;  2E75 B;  2Z0A A;  2NLJ C;  5F2V O;  1LNQ A;  4JI1 B;  1SQQ H;  3CCE V;  1QR8 A;  1HP8 A;  1SKV A;  2LGQ A;  3MHS C;  3N27 A;  5B66 Z;  1J5E B;  3H9V A;  5KUM A;  5LMN B;  3ZRW B;  4LFC O;  2LJ2 A;  4I55 B;  2X7R B;  1BS3 A;  1I94 B;  1VQ5 V;  4FFB B;  3FYI B;  2PYL A;  1QVG U;  1P49 A;  1OCC B;  4TWK A;  4K0K O;  4WF9 V;  2IJH A;  4AHC A;  2OCC B;  1FXH A;  4UCR A;  1BL8 A;  4UCV A;  3CD6 V;  2IBZ H;  5GW7 A;  4I0X B;  4DR4 O;  5J2T B;  1AI6 A;  1PNK A;  2OYQ A;  1YCI A;  1GKF A;  4J80 A;  2ATK C;  2M6Y A;  2QWQ B;  3O9O A;  3E22 B;  4JV5 B;  1SRY A;  4MW3 A;  4F6E A;  1XNR O;  1WNS A;  3SYP A;  1AR1 B;  1NR7 A;  1NI8 A;  4GKJ B; 
#chains in the Genus database with same CATH homology
 4FFK A;  4C7U A;  2GDS A;  1EN4 A;  2CE4 A;  1JR9 A;  1GN2 A;  5AG2 A;  4JZ2 A;  5A9G A;  1WB7 A;  1N0N A;  1IDS A;  1ZUQ A;  4BR6 A;  1SZX A;  1XDC A;  1BT8 A;  3C3T A;  1QNM A;  1ZSP A;  1AVM A;  1AR4 A;  3DC6 A;  1I0H A;  3K9S A;  1MSD A;  1LUW A;  1VAR A;  3BFR A;  4JZG A;  3TJT A;  4E4E A;  3MDS A;  1LUV A;  3OT7 A;  1PM9 A;  3KDR A;  1EN5 A;  1WB8 A;  3DC5 A;  1PL4 A;  1VEW A;  1GN4 A;  1EN6 A;  1KKC A;  2RCV A;  3CEI A;  1IXB A;  1XUQ A;  4X9Q A;  1I08 A;  1IX9 A;  1XRE A;  3KKY A;  1ZTE A;  1Y67 A;  4JYY A;  3AK1 A;  3EVK A;  1AR5 A;  1N0J A;  4YIP A;  1P7G A;  3LSU A;  1BS3 A;  4YIO A;  1MNG A;  3AK3 A;  3IC9 A;  1XIL A;  3RN4 A;  1JA8 A;  1GN6 A;  1AP5 A;  4GUN A;  2QKC A;  2AW9 A;  2CDY A;  3C3S A;  2QKA A;  1B06 A;  2ADP A;  1EM1 A;  1GN3 A;  3AK2 A;  1ZLZ A;  2P4K A;  2ADQ B;  1MMM A;  1MA1 A;  1D5N A;  4F6E A;  1BSM A;  3QVN A;  1AP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...