1N0NA

Catalytic and structural effects of amino-acid substitution at his30 in human manganese superoxide dismutase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKVHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Catalytic and Structural Effects of Amino-Acid Substitution at His30 in Human Manganese Superoxide Dismutase
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1n0nA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1n0nA02
1JR9A 1VEWA 3CEIA 1AVMA 2CDYA 1MMMA 1VARA 1I08A 3AK3A 1XREA 2CE4A 1I0HA 1AP6A 1BSMA 3DC5A 4YIOA 5A9GA 1JA8A 1MA1A 4JZGA 3OT7A 1AR4A 1PL4A 1B06A 1IDSA 1GN6A 4FFKA 1GN4A 3AK2A 1WB8A 1XUQA 1MNGA 1EM1A 3DC6A 3KKYA 1EN4A 1BT8A 1IXBA 1IX9A 1ZTEA 2GDSA 3AK1A 3C3TA 1D5NA 1Y67A 1KKCA 1EN5A 2ADPA 3EVKA 1AR5A 1N0NA 1ZSPA 3TJTA 1P7GA 1ZLZA 2P4KA 4C7UA 3QVNA 1EN6A 5AG2A 1ZUQA 1GN2A 1LUWA 3C3SA 1XILA 3BFRA 3K9SA 2RCVA 1LUVA 4JZ2A 3LSUA 1WB7A 1QNMA 1N0JA 4YIPA 1PM9A 1MSDA 1XDCA 1BS3A 2QKAA 4JYYA 4E4EA 2QKCA 4BR6A 1GN3A 2AW9A 3RN4A 1AP5A 3IC9A 3MDSA 4F6EA 4X9QA 1SZXA 4GUNA 2ADQB
chains in the Genus database with same CATH superfamily
1SQVH 1NR7A 1O9HA 1Y74B 1Z5VA 5B3SB 4WFFA 2LJ2A 1XNRO 4HZ3A 2GHYA 3RVZA 1FXVA 3ABKC 1CXZB 4J10A 2EZPA 1AP6A 1TVKB 4LF5B 4OX9B 1JX9A 1QLEB 1XNQO 3B8MA 3OMAB 1TUEB 3KKYA 2YICA 2EIMC 1KP3A 4J11A 4MTOA 2DMXA 3FB5C 1FPOA 5GW7A 3JCUZ 5J2UA 1XHZA 1HR0O 1HDJA 1WLEA 3BA9A 2W0XA 3T1HO 2X6CA 1R3IC 2OT5A 4LP8A 1SA0A 1AI7A 3BA8A 3DGEA 4X89A 4HYOA 3VOUA 3QG5A 4JGSA 4I50A 1EN6A 2R9IA 1N34B 1R6KA 3ZEDA 2YI9A 1GMGA 3IJ4A 3B8NA 2H3OA 1KU9A 3CC4V 1MABG 4MVQA 1CP9A 5ITZB 4OGQB 4BAYA 4DV5B 2ATKC 2PYLA 1QBZA 1I5XA 2HHHO 4K3AA 1MG1A 5FL7G 3JD1A 4PDVA 2ZR2A 4BIZA 4G28B 4FVMA 2BSKB 3CB2A 4I7ZB 2KB1A 4X1YA 2QM7A 2VWKA 2Y4UA 1AJQA 1AI5A 4UCOA 4JTAB 3UT5B 3SPIA 4G27B 4QIWF 5KHHA 1XMQO 3JAKA 1H2NA 3UKMA 2Z0AA 2ZM6B 5CBHA 3CXHF 5EBLC 1I7FA 1PNLA 3HKEB 4LFAO 4GKKB 1N33O 4FM2A 1FOUA 1VARA 1SERA 4W4LA 2HVJC 2L6LA 2HP8A 1KKDA 4BWAA 4UXNA 4MW8A 4U7OA 4B3RO 3WB2A 1PL4A 2XAQA 3MHHC 1IBKB 4W4KA 2ZE8A 3FB8C 3ZHVA 1GN6A 3B2EE 4EKWA 1TUBB 1FXKA 3HKCB 4RWUA 1M4UA 4I0XA 2Q7EA 4K0KO 1US6A 4UVBA 1IX9A 4FZ1A 3SJQC 1EBOA 2YXYA 4FLZA 4H0LB 5IJ0A 4LF9O 3HKBB 4CS4A 1HNWB 1AI6A 2KG7A 3TJTA 1NH2D 1VF6A 2RN9A 4UVCA 2ZNIA 2NLJC 2V7QG 1YXBA 3AG2B 1H2SB 3JAMN 1M9NA 3QO5A 1FD9A 2CUGA 2WSSG 4MT8A 1R1BA 3UQ8A 1BMFG 2IJIA 3L74H 5H5NA 4PHZA 5IYZA 2ZIMA 4DR1O 3QF7A 4MVZA 3EXAA 3OTOB 1YJ9V 2ZE5A 1YTFD 1RPOA 4QPJA 3ZMZA 1M56B 3ABMB 4MVOA 3G71V 4JZ2A 4IHJA 1OCCC 3ZHSA 1V54C 4I9WA 1QNMA 1HP8A 2DWDC 5KLVH 4WBNB 1CPYA 1WP8A 1WAZA 1K7DA 4BIOA 4RUEA 2QKCA 3VQVA 1UFIA 3GWOA 2BCCH 1KQSU 1BHAA 3MDSA 1IBMB 5B1AB 1NU1H 2ZDIA 1PPJH 1J5EO 3K59A 3RYIA 1AB3A 5FPRA 4I5SA 1SQBH 3T4ZA 4YJ3B 3MAQA 5KA5A 1K97A 1ZAUA 2BTQA 2ITDC 1QLNA 1XREA 4IYHA 3BABA 5CA1B 4Z1VA 4O2AA 1AR1B 1M57B 3U0ZA 3AG1B 1F7YA 1W2BU 3JCZA 4I55B 3L72H 4PV1B 3RT3C 1OCRC 4WCEV 1IZ3A 4FJCC 2ZE7A 3APQA 2H94A 1N32O 2FB5A 4D7TA 5LHIA 1Q8IA 4B3SB 1H2KA 5LYJA 3MD0A 1M93A 4JI8B 4I4TA 3JAWA 1I94O 1ENVA 4BW9A 4LFBO 3OAAG 1AR5A 3M7MX 4PA4A 1S5JA 1WP7A 2OIEA 2Q67A 1BE3H 3K0DA 2OTLV 1V55C 4GKJO 3SJCC 3BAAA 5IYBO 2DN9A 5EYPA 3TXQA 5LXTA 4R8CA 3C3SA 1KYOF 2B9ZA 1WB7A 4MVUA 1YJNV 1S72V 1KB9F 4P9PA 4UB8Z 3I5DA 4K35A 4FM0A 2UUBO 5L3FA 3H9VA 4DR6O 1IBLB 2QWPB 3OW2U 4MVMA 5K1XA 1G6UA 3T4DA 5CBGA 2W6IG 4KHPO 4LF8O 5LMUB 4HNAA 5IY5C 1Y74A 4WFAV 3W7TA 1Q82W 2Q69A 3VQXA 2JEUA 1VQ9V 1JCHA 1GO3F 2E76B 5EK0A 1YCIA 3JARB 2XOKG 5DN6G 3HB3B 5A2QN 4DK1A 1ZL8B 3RGBA 3ZHQA 1TVKA 3R65A 4LC1A 3WB1A 1HNXO 3F7VC 1M1KW 2IH3C 4L87A 2NR5A 5EIBC 4DV7O 2N05A 1EN4A 1BT8A 3I56V 3ABTA 4JYAB 3K5OA 4KL1A 4LFCO 5CMUA 4JF3A 4HAMA 2EIKB 1Q7YW 1Q3EA 3CRRA 4EB6A 4OX9O 4XDLA 3SPHA 2IW5A 3R66A 4N21A 4C7UA 2VQEB 3F5TA 5GTHZ 2D2CB 4NXMO 2IJJA 1H8HG 4X66B 1Y76B 3G6EV 4DR4O 1X59A 4DR5B 3HR0A 4FIPC 4GX5A 3SJBC 1XILA 3WG7C 2WA4A 4NB5A 1PP9H 5ITZA 2ARHA 4H37A 4K8XA 1FXKC 3LSUA 4H33A 3E22B 3K0GA 5J2TB 3CMAV 4ZI7B 2F23A 2UXCB 4O4HB 1OV9A 2MW2B 1MSWD 2BSKA 2Q73A 4LNUB 3SJAC 3CMEV 4WF9V 5LP6B 4F4LA 1ZX3A 4CC6A 1VQ5V 4JI7B 1N34O 3EFFK 1SKVA 1VF6C 3RN4A 2YC0A 1GM9A 1F4MA 1S76D 4ZHQB 1Z5WA 3UO2A 2DYRC 1SZXA 1KECA 4QNHB 5KA6A 1S5LZ 2HJDA 4MVRA 2PF4E 1QHTA 1OZ0A 1P4RA 3HKEA 3B77A 4FZ0A 4GCZA 1F51A 1NI8A 2EILB 2OIGA 4AI8A 2YIBD 3JASB 3E2EA 3TGUH 5KHIA 3M8AA 4QE9A 1MOFA 1U97A 4DV6B 5C8YA 1AR4A 4U7NA 1SC5B 5KHKA 5C93A 4TV8B 1B3QA 4YJ2A 2UXXA 2OTJV 1KP2A 2VQFB 1TUBA 3HKCA 3DXRB 1NTZH 2EBOA 3ZS8C 4GX2A 3KDRA 2JJ2G 1MZFA 3TXSA 2ADPA 2WLMA 3HKBA 4O2BA 5KUKA 3CRCA 3HKDB 4LF7B 1P7GA 3E8FA 1HNZB 1RP3B 2GTAA 3P3NA 1GM7A 2F93B 5TISZ 2ZR3A 4DV0O 1XMOB 2WLHA 2ZE6A 3ABLC 5B66Z 1IXMA 3RYFB 2RDCA 2Y0PA 1FFTB 2R9RB 2GV9A 3P32A 4DUZO 1QVGU 2HFEC 4G2KA 1R6NA 3HPLC 3H1LH 4UV9A 1OCOB 4PI0A 3BEHA 5KUMA 2PI5A 2B1GA 3CCUV 2XHBA 3BCCH 1JJOA 4DRXA 4X9QA 3THOA 2Z5UA 1MZEA 2WLIB 2YIBA 1PNKA 1VEWA 3LNMB 3ZRWB 1JMKC 4TSFG 4DW1A 5IYDO 4JI0B 4YY3B 2UUCB 4X20B 2UXDB 1QR8A 2ITCC 5BR8B 3ASOB 3CP1A 5IJ9B 1BCCH 4AHCA 3W7SA 2V4DA 4YIOA 1RSOA 4X1IB 1NR1A 2AGAA 3FAVB 5CA1A 2DOSA 4ZOLA 4DV4O 4AILC 1IDSA 1YF2A 1H38A 4I55A 4RAIA 4GX1A 3AK2A 1XUQA 4JI4O 1MNGA 2CTPA 2XAFA 1VQ7V 2JGDB 3BRCA 2QDOA 4JI3O 3S3XA 4X65O 2XUMA 1VF5B 3ABKB 2ZQMA 4FLTA 2JS3A 2CGNA 2YIAA 5JWPA 1YI2V 3BVOA 5KHJA 1L8DA 2ZXWB 2D3OW 2R70A 2ZD9A 5BZBA 1Q5OA 1JNBA 1GN2A 2GUZA 2JJ1G 4B7KA 2YUAA 4ASUG 2EIMB 4F6RB 2ILMA 5L3BA 4MTFA 4WFGA 4CS3A 1RM1C 4JI8O 3CCSV 1TGOA 3CCLV 1QLEC 4FM1A 4FLYA 1OHHG 2FYUH 3A0BZ 3BPZA 1Q6UA 2CH7B 3LNNA 3ASNC 4MTGA 5IYCO 5JQGB 2Y69C 2Y48A 4DV2B 3OUFA 5JVDB 4JAAA 1NQTA 3G67A 2ADQB 2UXBB 1NT2B 4ZKIA 2Z3YA 3W7XA 2N74A 4U3JB 4NXNB 2JDIG 5CBFA 3RYHB 1QU7A 3CS5A 1IBLO 5HFMA 1MA1A 2YDEA 3K08A 2CTQA 4JZGA 2EZOA 3I55V 4UUJC 5LA6A 1PD3A 4X62O 1G1XB 2P4VA 1E79G 2ZCEA 2AHYA 1R3LC 4LF6O 5DM6V 5LOVB 3AG3B 2IJHA 1VQNV 2F66C 3CYOA 3L73H 3E35A 2UUAB 2XTAA 2KKWA 2QA4V 3EHBB 1URFA 5FNVB 1XHXA 1KBHA 3DSQA 3VQYA 1ORQC 3ZMUA 4FK5C 1K5SA 3PJSK 3ZN0A 1Y76A 2FTKA 2R72A 4PA3A 4ICGA 4LCUC 4GT1A 4JYAO 5KMGB 4JTDB 4AQYB 3P30A 4DXWA 1M90W 2Q7HA 4LBEC 2Q5ZA 3E22A 4MTXA 4IIJA 2QM4A 3ZN1A 4X64O 2DYSB 4TV9B 2VQEO 4O4HA 3B4SA 5EC2C 4J80A 4LNUA 3LDDA 2HG5C 3T1YB 1GN3A 4DR5O 3SYAA 3J80N 2G38A 4OPHA 1GAXA 3IC9A 2WLNA 5LL6Y 4ZHQA 2LQTA 1DF4A 2E75B 1S77D 4UCSA 1OCCB 3FFQA 1YHQV 4DR7B 2UXCO 2AHZA 2A0LA 1M56C 3ABMC 1VQPV 5CB4B 4JI7O 1FXHA 3JASA 1F23A 2GSMB 1JOYA 4RO2A 3CE2A 2FMLA 4J42A 4KUMA 2AXTZ 3UO3A 1AILA 4YHHB 1GN4A 2X0LA 2OYQA 3K5NA 1H2MA 3OE7G 3JSLA 4DK0A 4LR3A 4CH6A 5KAIZ 2N04A 1Q6HA 3AK1A 3TK1A 5FLXN 3ZRVA 2ZKOA 3SYCA 5IWAB 3BY6A 4JV5B 1P84F 3SPGA 2HR3A 1XEQA 4DV6O 3K57A 1XOUA 3HKDA 2P6JA 1FFXA 2CTRA 2A79B 5AG2A 3BHPA 3KCXA 4Z1MG 1LUWA 5KHGA 4J7KA 4JYBA 3N2KB 1N4CA 4L8JA 3O9OA 1UPGA 3X2QC 3K5MA 3ETEA 3O65A 3A0HZ 1HNZO 2WPDG 1VQLV 2R9AA 2YS8A 3JALB 4JYYA 4GYCB 2IH1C 1T5EA 4JI5O 1U96A 5GTIZ 4DV1B 1V55B 2QR4A 1HR0B 5IE9A 3LDEA 2P7TC 1EZVH 1OCZC 2XAJA 4O4LA 1VQ6V 2Y0IA 3CEIA 3ZRWA 3E89A 5JJNB 3D36A 4X20A 5EBMC 4A5UB 1NKDA 4JI1O 1RFYA 2KQXA 5IJ9A 3N27A 1GRJA 3K03A 3DC5A 4R6ZA 3ZMVA 3K5LA 2O57A 2XAGA 1QCEA 1VQKV 2YXHA 1PNMA 3CCEV 1JVMA 3W7WA 3JATA 1DGSA 2IU3A 5DECA 3DC6A 4DUYO 2UUCO 3H1IH 2UXDO 1IXBA 3AG7A 1VQMV 2GDSA 2HEPA 3B09A 3OGCC 4DR2B 3RYCB 1XMQB 1CEZA 3C3TA 4UCUA 5H2FZ 1A32A 2K1EA 2OCCC 1DF5A 3AG4C 4CH3A 3T2MA 2QTOA 3OR6C 5B1BC 3ML0A 1NTMH 4B3RB 1SQPH 4P30A 3JAKB 3G6BA 3RVYA 5LHHA 4F6RA 2EIJC 3QTCA 2F4VB 4TWKA 3ICXA 4JTCB 4Z2WA 4LF5O 3QO8A 4H13B 4K0KB 3QNEA 2QE7G 5BMVB 3CJHB 2YXLA 3W7UA 4UCRA 1KUQA 4LF9B 4UB6Z 4O4JB 4UFZA 1W0KG 3VQWA 4KFMA 4HBNA 1NS1A 2HKOA 2Q6AA 1L1FA 4F6EA 3RW0A 5JVDA 4BIUA 1FXKB 2IM9A 5KX5B 4I0XB 5HFLA 4DR1B 1FS0G 1K33A 1D5AA 1DLBA 3OGIB 5IJ0B 3CCRV 2Q0OC 3T1CA 3UT5A 3RYHA 2Q4PA 4B3MB 1SZTA 3OT7A 5B1OA 3D3QA 4DV2O 4NYKA 4NKGB 4DV5O 2PGGA 2QWNB 1B06A 3RWRD 5D5QA 2EULA 3KG2A 3ZMSA 2DYRB 1HW7A 4E2LA 1WB8A 2UXBO 5IYZB 1K34A 3CCVV 3H1KH 4N23A 4PJ0Z 5BXZA 3L70H 4UVAA 3JSNA 5H9CA 4MVSA 4NXNO 3H1JH 4PDRA 4X1KB 1EFRG 2F95B 3EVKA 2PZSA 3L9DA 3OD4A 4NR1A 4PELA 5EZYB 3SYOA 2QWOB 1K5QA 2ZM6O 2EILC 3CXCU 3QVNA 5L3EA 1R73A 4D6TH 4Q6GA 3PN1A 4GKKO 1E1RG 1K73W 1TA8A 2ZDIC 4WFHA 3LDCA 4LH7A 2RCVA 3P3PA 1WN7A 1Y4MA 5KMGA 3RYIB 4WFBV 5EC1C 2UUAO 2ETNA 1IBKO 1N32B 1MSDA 2F1MA 4FFBB 4O4IB 2V1DA 4RQFA 4TV9A 2DQ0A 3OM3B 1GH6A 1Y6XA 3FD9A 5H6QA 2PUSA 1I94B 1NBMG 2JRIA 4LFBB 3ABLB 4OPAA 4PA9A 4GUNA 4AQYO 1HNWO 3SR2C 2HJFC 2AZ0A 1FAFA 1QR9A 1R3KC 1K3EA 2JK5C 2WA3A 2CDYA 4WBNA 2ODMA 1QQCA 2RQ6A 4PDLA 5JCOA 4I4TB 1S5HC 3JAWB 5A9GA 1BSMA 4PI2A 1E1QG 4B08A 3OTOO 3APOA 3LUTB 4R50A 1JFFB 1W59A 5H6RA 2YIDA 4EFEA 3ZJZA 4CC5A 1UJWB 4Q20A 4X8AA 1COWG 1GM8A 4LWSB 4NTYA 1BZKA 4IL6Z 3ETDA 1EM1A 1SQFA 4KXRA 5E1AC 4DR7O 4YJ3A 2K9PA 5LXTB 1ZTEA 2UU9B 1NTKH 2QJ1A 3NXSA 2EINC 2QKSA 1F4NA 4FLVA 3STZC 2IU0A 2QWRB 3D36C 3G80A 1IBMO 1Q43A 3KZIZ 5DEDA 1SF9A 1H5WA 2LFSA 3SGIA 4YHHO 1WJZA 3CRQA 1AJPA 3CSXA 4J9ZB 1SESA 3GB7C 3CC7V 4XDJA 4NTXA 4PA7A 1D2DA 2DJVA 5LMNB 1HNXB 3NR7A 4MW3A 2A3QA 2W0FC 4H44B 4HNAB 2P67A 3ZRXA 5B3SC 5IWAO 4JV5O 2LGWA 1H2LA 3SPCA 3F5WC 4DV7B 1OJHA 3FYEB 5EIBD 4QGPA 3JALA 1XQ8A 3D8CA 2WLLB 4LFCB 3FKSG 3FX7A 2BOCC 4B3SO 2Y4TA 2HLDG 1RPRA 4DW0A 2ZXWC 1RM1B 5BY1A 3JYCA 1JR9A 4P2ZA 4TUYB 4NXMB 2EJRA 1B6QA 4DR4B 2YEVB 1AVMA 2VWJA 3G4SV 1MMMA 3N2GB 1N36B 1K8AW 3ASNB 2YSUB 1L0NH 3IAYA 1I0HA 4DV1O 1VP7A 4RUFA 4TOIA 4CS2A 4EB6B 2Y69B 2WLKA 1H8EG 5B1NA 3CCJV 1FKAO 5FPOA 2QWQB 2M6YA 2X7RB 4DR3B 4DV3B 4GX0A 5L3DA 4B3TB 3M99B 3OFNG 2E5LB 3JARA 4ZIBA 3RYCA 1YEWA 2QGNA 3K04A 2PTMA 1ZL8A 1N0NA 2P06A 1G8MA 4CH4A 1XBLA 1NVPB 5LMUO 5JH7B 4LF4B 4LH6A 4DO2A 1B04A 2PI4A 3C90A 2A06H 1BQ0A 3K9SA 4DR2O 1J95A 1LUVA 2Q68A 1VMGA 3Q4HB 3CWBH 2E74B 1I5YA 4BW5A 1H2GA 4JI6B 4WFEA 2QKAA 3E86A 1Y66A 3AG3C 3WFVA 4FLWA 5BMVA 3CJHA 2LO1A 3JD3A 2P90A 1Q90D 5C8YB 4O4JA 2X6AA 4XDKA 5J9PC 2GTSA 4YJ2B 2F4VO 2DE0X 4DV0B 1M5IA 5J2TA 3A8TA 4ZI7A 1FJGB 5KX5A 2RJZA 5GONB 1IVSA 4X66O 1JPXA 1K4CC 5LP6A 3WU2Z 3STLC 2CE4A 3RBZA 4O2BB 4EEQA 2JEXA 1JA8A 1SS3A 1Z2GA 5E79Z 5LGUA 4FPPA 4DUZB 2FL4A 2DYSC 3AG2C 2KSDA 2RNBA 1V54B 3WB0A 2XASA 3U10A 3ZMTA 1N8RW 2L35A 2CTWA 4TT3G 1Y67A 1BHBA 1KKCA 3OMIB 1YIJV 2WWWA 4X1KA 1L0LH 1R3JC 4B3MO 3IFXA 4PDMA 2QEXV 1Q6IA 1X4TA 2P4KA 3OEHG 3OR7C 3CCQV 4JI2B 1NZ6A 1HWYA 4TV8A 5JCOC 2X6BA 3AEIA 5EZYA 4J41A 3DXRA 5CA0B 1YVWA 4J7JA 4JAVA 3L71H 2OCHA 3GVMA 3BFRA 5B1AC 4DRXB 4DV4B 2BE3A 2WAMA 3CHXA 1BGYH 2A9HA 3ETQA 4JI4B 1XNRB 1XDCA 3LSQA 5D5PA 4FFBA 4GZRB 4JPRA 4IGGA 4O4IA 3H1HH 4X65B 3ETGA 4JI3B 1WA8B 1OCRB 3K06A 2VQFO 3SPJA 4NVPA 1RSOB 3CRMA 1M57C 3AG1C 3E8HA 4J9YB 4ZOLB 2RMKB 2FKXA 2ZIOA 3RYFA 1XNQB 3LSSA 4LF7O 2F43G 3X2QB 4MS2A 1YJWV 1DTOA 4JYCA 2CGOA 3OEEG 3AK3A 1XMOO 3U11A 3CD6V 3TETA 3T1HB 4PD4F 5K1PA 1OCZB 4OXSA 1JFFA 2ZINA 1GTOA 3K79A 1XI1A 1Q86W 1WNSA 2WLIA 2Q9LA 3JD0A 4LWSA 2GUZB 2LW7A 4JASA 3ZCCA 2Q7GA 3QO7A 1SQQH 5J2UB 3OMNB 2HHHB 1SETA 4CBCA 2YI8A 5F2VO 4FLUA 4X1IA 5IDJA 3FAVA 1ZSPA 1NJIW 1R6TA 2EX3A 1SA0B 3VBBA 4KP4A 4FMTA 4IYIA 2DW4A 4U3FH 3SYQA 1SQGA 4I50B 2ZNJA 3ABUA 3ZHRA 2LGQA 4JI0O 5IY5B 1BL8A 4YY3O 2DQ3A 4X88A 2WLJA 5BR8O 1S3JA 2JGDA 5LHGA 2A7WA 2UU9O 3OTFA 2P5OA 1LNQA 2HVKC 1NVPD 4X62B 1KC8W 2B1IA 1YZBA 1LR1A 3FB7C 4YIPA 1WPXA 4LFAB 1PM9A 1YSCA 1XL6A 1N33B 1BQZA 2OCCB 4X1YB 3UCSC 1P7BA 3A2FA 1O9GA 2VRZA 3AG4B 4LF6B 2BTOA 5KAFZ 3ZHUA 2XT9A 2C2AA 2WLLA 4J7ZA 5B1BB 1FYJA 1SQXH 5LA6B 4QJFB 5LMNO 3KCYA 2EIJB 3UM7A 1S0VA 1VQOV 4TUYA 3F7YC 3ZX6A 1IURA 2YEVA 2JVDA 2VS0A 2CH7A 1ZWIC 3FB6C 2PYJA 3A0RA 3N2GA 2EIKC 5JQGA 3GWKC 4RQEA 2E3CA 1PKXA 3D3IA 3WG7B 2EJ7A 5LGTA 4X64B 1GKFA 5B5EZ 4FFKA 4K8ZA 3OUSA 3IGAC 4ZBMA 3FYIB 4U3JA 1K4DC 2IJKA 1N36O 1VIBA 2GBOA 1JQ0A 2PY5A 1YDXA 2KG7B 4R7CA 3S3WA 4IIJB 4TQDA 2CK3G 4YXWG 2NN4A 4QPKA 4PA6A 1VF7A 5LP6C 3SDLA 5JH7A 2AZ2A 4DR3O 4P9OA 4MSWC 5CA3A 1P49A 5LOVA 3ZBHA 4DV3O 2M7WA 4B3TO 4IHJB 1SRYA 2E5LO 4D7SA 3E8BA 3L75H 1J5EB 3J7AU 1AROP 3Q4HA 1BS3A 1THZA 5FNVA 2NNUA 1JJ2U 3DTUB 4DYLA 1ROPA 4NTWA 2IBZH 4LF4O 1V9PA 5LBQA 4BR6A 2ZT9B 2Q8VA 1AI4A 2LW1A 2QM8A 1GK9A 4EFBA 3SYPA 3K9AA 3ZIAG 4UCVA 1KD1W 2H8PC 2BOBC 4JI6O 3CCMV 4JAUA 1AJNA 1KMIZ 5GONA 4GLXA 3K58A 2BTQB 1I08A 3CPWU 3JD4A 1W0JG 3E83A 1G4YB 4O2AB 5JJJB 2XNDG 2QTSA 2JIZG 4XBFA 3CC2V 2MK3A 3MHSC 1K9MW 2W6JG 2B5UA 5EBWC 1FFXB 2XAHA 4JI5B 2DWEC 4GKJB 1DK1A 1NH2B 3ZHTA 3CX5F 1FJGO 5LGNA 2LP7A 3JD2A 3H01A 5LYJB 3J81N 2UXNA 1PL0A 4FLXA 1D5NA 3T1YO 4I9QA 2CAZC 1EN5A 5CB4A 2QSAA 1Q81W 2P22C 5L3CA 1YTFB 1EZJA 1ZLZA 3K3WA 3B40A 2UUBB 4JI1B 1OCOC 4ABMA 1VQ4V 1YITV 1QVFU 4IT5A 4DR6B 4UCTA 4CZZA 1ZUQA 5EYPB 2OWOA 1PV0A 5CA0A 2JGUA 5JJEB 3ZRSA 4CH5A 4KHPB 2EINB 4O4LB 3CRAA 5IT9N 4LF8B 4UV8A 1VQ8V 1N0JA 1TAEA 5CN0A 3RFRA 2LFRA 4DUYB 1WPBA 5L3GA 4JI2O 3ASOC 2JS5A 4E4EA 1XL4A 3E8GA 3IC7A 1WA8A 4TQFA 4B7EA 2AW9A 1AP5A 2Q0AA 1IJGA 3N2KA 4QE7A 3TCUA 1K92A 3JATB
chains in the Genus database with same CATH topology
1JR9A 1VEWA 3CEIA 1AVMA 2CDYA 1MMMA 1VARA 1I08A 3AK3A 1XREA 2CE4A 1I0HA 1AP6A 1BSMA 3DC5A 4YIOA 5A9GA 1JA8A 1MA1A 4JZGA 3OT7A 1AR4A 1PL4A 1B06A 1IDSA 1GN6A 4FFKA 1GN4A 3AK2A 1WB8A 1XUQA 1MNGA 1EM1A 3DC6A 3KKYA 1EN4A 1BT8A 1IXBA 1IX9A 1ZTEA 2GDSA 3KDRA 3AK1A 3C3TA 1D5NA 1Y67A 1KKCA 1EN5A 2ADPA 3EVKA 1AR5A 1N0NA 1ZSPA 3TJTA 1P7GA 1ZLZA 2P4KA 4C7UA 3QVNA 1EN6A 5AG2A 1ZUQA 1GN2A 1LUWA 3C3SA 1XILA 3BFRA 3K9SA 2RCVA 1LUVA 4JZ2A 3LSUA 1WB7A 1QNMA 1N0JA 4YIPA 1PM9A 1MSDA 1XDCA 1BS3A 2QKAA 4JYYA 4E4EA 2QKCA 4BR6A 1GN3A 2AW9A 3RN4A 1AP5A 3IC9A 3MDSA 4F6EA 4X9QA 1SZXA 4GUNA 2ADQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR9 A;  1VEW A;  3CEI A;  1AVM A;  2CDY A;  1MMM A;  1VAR A;  1I08 A;  3AK3 A;  1XRE A;  2CE4 A;  1I0H A;  1AP6 A;  1BSM A;  3DC5 A;  4YIO A;  5A9G A;  1JA8 A;  1MA1 A;  4JZG A;  3OT7 A;  1AR4 A;  1PL4 A;  1B06 A;  1IDS A;  1GN6 A;  4FFK A;  1GN4 A;  3AK2 A;  1WB8 A;  1XUQ A;  1MNG A;  1EM1 A;  3DC6 A;  3KKY A;  1EN4 A;  1BT8 A;  1IXB A;  1IX9 A;  1ZTE A;  2GDS A;  3AK1 A;  3C3T A;  1D5N A;  1Y67 A;  1KKC A;  1EN5 A;  2ADP A;  3EVK A;  1AR5 A;  1N0N A;  1ZSP A;  3TJT A;  1P7G A;  1ZLZ A;  2P4K A;  4C7U A;  3QVN A;  1EN6 A;  5AG2 A;  1ZUQ A;  1GN2 A;  1LUW A;  3C3S A;  1XIL A;  3BFR A;  3K9S A;  2RCV A;  1LUV A;  4JZ2 A;  3LSU A;  1WB7 A;  1QNM A;  1N0J A;  4YIP A;  1PM9 A;  1MSD A;  1XDC A;  1BS3 A;  2QKA A;  4JYY A;  4E4E A;  2QKC A;  4BR6 A;  1GN3 A;  2AW9 A;  3RN4 A;  1AP5 A;  3IC9 A;  3MDS A;  4F6E A;  4X9Q A;  1SZX A;  4GUN A;  2ADQ B; 
#chains in the Genus database with same CATH topology
 1SQV H;  1NR7 A;  1O9H A;  1Y74 B;  1Z5V A;  5B3S B;  4WFF A;  2LJ2 A;  1XNR O;  4HZ3 A;  2GHY A;  3RVZ A;  1FXV A;  3ABK C;  1CXZ B;  4J10 A;  2EZP A;  1AP6 A;  1TVK B;  4LF5 B;  4OX9 B;  1JX9 A;  1QLE B;  1XNQ O;  3B8M A;  3OMA B;  1TUE B;  3KKY A;  2YIC A;  2EIM C;  1KP3 A;  4J11 A;  4MTO A;  2DMX A;  3FB5 C;  1FPO A;  5GW7 A;  3JCU Z;  5J2U A;  1XHZ A;  1HR0 O;  1HDJ A;  1WLE A;  3BA9 A;  2W0X A;  3T1H O;  2X6C A;  1R3I C;  2OT5 A;  4LP8 A;  1SA0 A;  1AI7 A;  3BA8 A;  3DGE A;  4X89 A;  4HYO A;  3VOU A;  3QG5 A;  4JGS A;  4I50 A;  1EN6 A;  2R9I A;  1N34 B;  1R6K A;  3ZED A;  2YI9 A;  1GMG A;  3IJ4 A;  3B8N A;  2H3O A;  1KU9 A;  3CC4 V;  1MAB G;  4MVQ A;  1CP9 A;  5ITZ B;  4OGQ B;  4BAY A;  4DV5 B;  2ATK C;  2PYL A;  1QBZ A;  1I5X A;  2HHH O;  4K3A A;  1MG1 A;  5FL7 G;  3JD1 A;  4PDV A;  2ZR2 A;  4BIZ A;  4G28 B;  4FVM A;  2BSK B;  3CB2 A;  4I7Z B;  2KB1 A;  4X1Y A;  2QM7 A;  2VWK A;  2Y4U A;  1AJQ A;  1AI5 A;  4UCO A;  4JTA B;  3UT5 B;  3SPI A;  4G27 B;  4QIW F;  5KHH A;  1XMQ O;  3JAK A;  1H2N A;  3UKM A;  2Z0A A;  2ZM6 B;  5CBH A;  3CXH F;  5EBL C;  1I7F A;  1PNL A;  3HKE B;  4LFA O;  4GKK B;  1N33 O;  4FM2 A;  1FOU A;  1VAR A;  1SER A;  4W4L A;  2HVJ C;  2L6L A;  2HP8 A;  1KKD A;  4BWA A;  4UXN A;  4MW8 A;  4U7O A;  4B3R O;  3WB2 A;  1PL4 A;  2XAQ A;  3MHH C;  1IBK B;  4W4K A;  2ZE8 A;  3FB8 C;  3ZHV A;  1GN6 A;  3B2E E;  4EKW A;  1TUB B;  1FXK A;  3HKC B;  4RWU A;  1M4U A;  4I0X A;  2Q7E A;  4K0K O;  1US6 A;  4UVB A;  1IX9 A;  4FZ1 A;  3SJQ C;  1EBO A;  2YXY A;  4FLZ A;  4H0L B;  5IJ0 A;  4LF9 O;  3HKB B;  4CS4 A;  1HNW B;  1AI6 A;  2KG7 A;  3TJT A;  1NH2 D;  1VF6 A;  2RN9 A;  4UVC A;  2ZNI A;  2NLJ C;  2V7Q G;  1YXB A;  3AG2 B;  1H2S B;  3JAM N;  1M9N A;  3QO5 A;  1FD9 A;  2CUG A;  2WSS G;  4MT8 A;  1R1B A;  3UQ8 A;  1BMF G;  2IJI A;  3L74 H;  5H5N A;  4PHZ A;  5IYZ A;  2ZIM A;  4DR1 O;  3QF7 A;  4MVZ A;  3EXA A;  3OTO B;  1YJ9 V;  2ZE5 A;  1YTF D;  1RPO A;  4QPJ A;  3ZMZ A;  1M56 B;  3ABM B;  4MVO A;  3G71 V;  4JZ2 A;  4IHJ A;  1OCC C;  3ZHS A;  1V54 C;  4I9W A;  1QNM A;  1HP8 A;  2DWD C;  5KLV H;  4WBN B;  1CPY A;  1WP8 A;  1WAZ A;  1K7D A;  4BIO A;  4RUE A;  2QKC A;  3VQV A;  1UFI A;  3GWO A;  2BCC H;  1KQS U;  1BHA A;  3MDS A;  1IBM B;  5B1A B;  1NU1 H;  2ZDI A;  1PPJ H;  1J5E O;  3K59 A;  3RYI A;  1AB3 A;  5FPR A;  4I5S A;  1SQB H;  3T4Z A;  4YJ3 B;  3MAQ A;  5KA5 A;  1K97 A;  1ZAU A;  2BTQ A;  2ITD C;  1QLN A;  1XRE A;  4IYH A;  3BAB A;  5CA1 B;  4Z1V A;  4O2A A;  1AR1 B;  1M57 B;  3U0Z A;  3AG1 B;  1F7Y A;  1W2B U;  3JCZ A;  4I55 B;  3L72 H;  4PV1 B;  3RT3 C;  1OCR C;  4WCE V;  1IZ3 A;  4FJC C;  2ZE7 A;  3APQ A;  2H94 A;  1N32 O;  2FB5 A;  4D7T A;  5LHI A;  1Q8I A;  4B3S B;  1H2K A;  5LYJ A;  3MD0 A;  1M93 A;  4JI8 B;  4I4T A;  3JAW A;  1I94 O;  1ENV A;  4BW9 A;  4LFB O;  3OAA G;  1AR5 A;  3M7M X;  4PA4 A;  1S5J A;  1WP7 A;  2OIE A;  2Q67 A;  1BE3 H;  3K0D A;  2OTL V;  1V55 C;  4GKJ O;  3SJC C;  3BAA A;  5IYB O;  2DN9 A;  5EYP A;  3TXQ A;  5LXT A;  4R8C A;  3C3S A;  1KYO F;  2B9Z A;  1WB7 A;  4MVU A;  1YJN V;  1S72 V;  1KB9 F;  4P9P A;  4UB8 Z;  3I5D A;  4K35 A;  4FM0 A;  2UUB O;  5L3F A;  3H9V A;  4DR6 O;  1IBL B;  2QWP B;  3OW2 U;  4MVM A;  5K1X A;  1G6U A;  3T4D A;  5CBG A;  2W6I G;  4KHP O;  4LF8 O;  5LMU B;  4HNA A;  5IY5 C;  1Y74 A;  4WFA V;  3W7T A;  1Q82 W;  2Q69 A;  3VQX A;  2JEU A;  1VQ9 V;  1JCH A;  1GO3 F;  2E76 B;  5EK0 A;  1YCI A;  3JAR B;  2XOK G;  5DN6 G;  3HB3 B;  5A2Q N;  4DK1 A;  1ZL8 B;  3RGB A;  3ZHQ A;  1TVK A;  3R65 A;  4LC1 A;  3WB1 A;  1HNX O;  3F7V C;  1M1K W;  2IH3 C;  4L87 A;  2NR5 A;  5EIB C;  4DV7 O;  2N05 A;  1EN4 A;  1BT8 A;  3I56 V;  3ABT A;  4JYA B;  3K5O A;  4KL1 A;  4LFC O;  5CMU A;  4JF3 A;  4HAM A;  2EIK B;  1Q7Y W;  1Q3E A;  3CRR A;  4EB6 A;  4OX9 O;  4XDL A;  3SPH A;  2IW5 A;  3R66 A;  4N21 A;  4C7U A;  2VQE B;  3F5T A;  5GTH Z;  2D2C B;  4NXM O;  2IJJ A;  1H8H G;  4X66 B;  1Y76 B;  3G6E V;  4DR4 O;  1X59 A;  4DR5 B;  3HR0 A;  4FIP C;  4GX5 A;  3SJB C;  1XIL A;  3WG7 C;  2WA4 A;  4NB5 A;  1PP9 H;  5ITZ A;  2ARH A;  4H37 A;  4K8X A;  1FXK C;  3LSU A;  4H33 A;  3E22 B;  3K0G A;  5J2T B;  3CMA V;  4ZI7 B;  2F23 A;  2UXC B;  4O4H B;  1OV9 A;  2MW2 B;  1MSW D;  2BSK A;  2Q73 A;  4LNU B;  3SJA C;  3CME V;  4WF9 V;  5LP6 B;  4F4L A;  1ZX3 A;  4CC6 A;  1VQ5 V;  4JI7 B;  1N34 O;  3EFF K;  1SKV A;  1VF6 C;  3RN4 A;  2YC0 A;  1GM9 A;  1F4M A;  1S76 D;  4ZHQ B;  1Z5W A;  3UO2 A;  2DYR C;  1SZX A;  1KEC A;  4QNH B;  5KA6 A;  1S5L Z;  2HJD A;  4MVR A;  2PF4 E;  1QHT A;  1OZ0 A;  1P4R A;  3HKE A;  3B77 A;  4FZ0 A;  4GCZ A;  1F51 A;  1NI8 A;  2EIL B;  2OIG A;  4AI8 A;  2YIB D;  3JAS B;  3E2E A;  3TGU H;  5KHI A;  3M8A A;  4QE9 A;  1MOF A;  1U97 A;  4DV6 B;  5C8Y A;  1AR4 A;  4U7N A;  1SC5 B;  5KHK A;  5C93 A;  4TV8 B;  1B3Q A;  4YJ2 A;  2UXX A;  2OTJ V;  1KP2 A;  2VQF B;  1TUB A;  3HKC A;  3DXR B;  1NTZ H;  2EBO A;  3ZS8 C;  4GX2 A;  3KDR A;  2JJ2 G;  1MZF A;  3TXS A;  2ADP A;  2WLM A;  3HKB A;  4O2B A;  5KUK A;  3CRC A;  3HKD B;  4LF7 B;  1P7G A;  3E8F A;  1HNZ B;  1RP3 B;  2GTA A;  3P3N A;  1GM7 A;  2F93 B;  5TIS Z;  2ZR3 A;  4DV0 O;  1XMO B;  2WLH A;  2ZE6 A;  3ABL C;  5B66 Z;  1IXM A;  3RYF B;  2RDC A;  2Y0P A;  1FFT B;  2R9R B;  2GV9 A;  3P32 A;  4DUZ O;  1QVG U;  2HFE C;  4G2K A;  1R6N A;  3HPL C;  3H1L H;  4UV9 A;  1OCO B;  4PI0 A;  3BEH A;  5KUM A;  2PI5 A;  2B1G A;  3CCU V;  2XHB A;  3BCC H;  1JJO A;  4DRX A;  4X9Q A;  3THO A;  2Z5U A;  1MZE A;  2WLI B;  2YIB A;  1PNK A;  1VEW A;  3LNM B;  3ZRW B;  1JMK C;  4TSF G;  4DW1 A;  5IYD O;  4JI0 B;  4YY3 B;  2UUC B;  4X20 B;  2UXD B;  1QR8 A;  2ITC C;  5BR8 B;  3ASO B;  3CP1 A;  5IJ9 B;  1BCC H;  4AHC A;  3W7S A;  2V4D A;  4YIO A;  1RSO A;  4X1I B;  1NR1 A;  2AGA A;  3FAV B;  5CA1 A;  2DOS A;  4ZOL A;  4DV4 O;  4AIL C;  1IDS A;  1YF2 A;  1H38 A;  4I55 A;  4RAI A;  4GX1 A;  3AK2 A;  1XUQ A;  4JI4 O;  1MNG A;  2CTP A;  2XAF A;  1VQ7 V;  2JGD B;  3BRC A;  2QDO A;  4JI3 O;  3S3X A;  4X65 O;  2XUM A;  1VF5 B;  3ABK B;  2ZQM A;  4FLT A;  2JS3 A;  2CGN A;  2YIA A;  5JWP A;  1YI2 V;  3BVO A;  5KHJ A;  1L8D A;  2ZXW B;  2D3O W;  2R70 A;  2ZD9 A;  5BZB A;  1Q5O A;  1JNB A;  1GN2 A;  2GUZ A;  2JJ1 G;  4B7K A;  2YUA A;  4ASU G;  2EIM B;  4F6R B;  2ILM A;  5L3B A;  4MTF A;  4WFG A;  4CS3 A;  1RM1 C;  4JI8 O;  3CCS V;  1TGO A;  3CCL V;  1QLE C;  4FM1 A;  4FLY A;  1OHH G;  2FYU H;  3A0B Z;  3BPZ A;  1Q6U A;  2CH7 B;  3LNN A;  3ASN C;  4MTG A;  5IYC O;  5JQG B;  2Y69 C;  2Y48 A;  4DV2 B;  3OUF A;  5JVD B;  4JAA A;  1NQT A;  3G67 A;  2ADQ B;  2UXB B;  1NT2 B;  4ZKI A;  2Z3Y A;  3W7X A;  2N74 A;  4U3J B;  4NXN B;  2JDI G;  5CBF A;  3RYH B;  1QU7 A;  3CS5 A;  1IBL O;  5HFM A;  1MA1 A;  2YDE A;  3K08 A;  2CTQ A;  4JZG A;  2EZO A;  3I55 V;  4UUJ C;  5LA6 A;  1PD3 A;  4X62 O;  1G1X B;  2P4V A;  1E79 G;  2ZCE A;  2AHY A;  1R3L C;  4LF6 O;  5DM6 V;  5LOV B;  3AG3 B;  2IJH A;  1VQN V;  2F66 C;  3CYO A;  3L73 H;  3E35 A;  2UUA B;  2XTA A;  2KKW A;  2QA4 V;  3EHB B;  1URF A;  5FNV B;  1XHX A;  1KBH A;  3DSQ A;  3VQY A;  1ORQ C;  3ZMU A;  4FK5 C;  1K5S A;  3PJS K;  3ZN0 A;  1Y76 A;  2FTK A;  2R72 A;  4PA3 A;  4ICG A;  4LCU C;  4GT1 A;  4JYA O;  5KMG B;  4JTD B;  4AQY B;  3P30 A;  4DXW A;  1M90 W;  2Q7H A;  4LBE C;  2Q5Z A;  3E22 A;  4MTX A;  4IIJ A;  2QM4 A;  3ZN1 A;  4X64 O;  2DYS B;  4TV9 B;  2VQE O;  4O4H A;  3B4S A;  5EC2 C;  4J80 A;  4LNU A;  3LDD A;  2HG5 C;  3T1Y B;  1GN3 A;  4DR5 O;  3SYA A;  3J80 N;  2G38 A;  4OPH A;  1GAX A;  3IC9 A;  2WLN A;  5LL6 Y;  4ZHQ A;  2LQT A;  1DF4 A;  2E75 B;  1S77 D;  4UCS A;  1OCC B;  3FFQ A;  1YHQ V;  4DR7 B;  2UXC O;  2AHZ A;  2A0L A;  1M56 C;  3ABM C;  1VQP V;  5CB4 B;  4JI7 O;  1FXH A;  3JAS A;  1F23 A;  2GSM B;  1JOY A;  4RO2 A;  3CE2 A;  2FML A;  4J42 A;  4KUM A;  2AXT Z;  3UO3 A;  1AIL A;  4YHH B;  1GN4 A;  2X0L A;  2OYQ A;  3K5N A;  1H2M A;  3OE7 G;  3JSL A;  4DK0 A;  4LR3 A;  4CH6 A;  5KAI Z;  2N04 A;  1Q6H A;  3AK1 A;  3TK1 A;  5FLX N;  3ZRV A;  2ZKO A;  3SYC A;  5IWA B;  3BY6 A;  4JV5 B;  1P84 F;  3SPG A;  2HR3 A;  1XEQ A;  4DV6 O;  3K57 A;  1XOU A;  3HKD A;  2P6J A;  1FFX A;  2CTR A;  2A79 B;  5AG2 A;  3BHP A;  3KCX A;  4Z1M G;  1LUW A;  5KHG A;  4J7K A;  4JYB A;  3N2K B;  1N4C A;  4L8J A;  3O9O A;  1UPG A;  3X2Q C;  3K5M A;  3ETE A;  3O65 A;  3A0H Z;  1HNZ O;  2WPD G;  1VQL V;  2R9A A;  2YS8 A;  3JAL B;  4JYY A;  4GYC B;  2IH1 C;  1T5E A;  4JI5 O;  1U96 A;  5GTI Z;  4DV1 B;  1V55 B;  2QR4 A;  1HR0 B;  5IE9 A;  3LDE A;  2P7T C;  1EZV H;  1OCZ C;  2XAJ A;  4O4L A;  1VQ6 V;  2Y0I A;  3CEI A;  3ZRW A;  3E89 A;  5JJN B;  3D36 A;  4X20 A;  5EBM C;  4A5U B;  1NKD A;  4JI1 O;  1RFY A;  2KQX A;  5IJ9 A;  3N27 A;  1GRJ A;  3K03 A;  3DC5 A;  4R6Z A;  3ZMV A;  3K5L A;  2O57 A;  2XAG A;  1QCE A;  1VQK V;  2YXH A;  1PNM A;  3CCE V;  1JVM A;  3W7W A;  3JAT A;  1DGS A;  2IU3 A;  5DEC A;  3DC6 A;  4DUY O;  2UUC O;  3H1I H;  2UXD O;  1IXB A;  3AG7 A;  1VQM V;  2GDS A;  2HEP A;  3B09 A;  3OGC C;  4DR2 B;  3RYC B;  1XMQ B;  1CEZ A;  3C3T A;  4UCU A;  5H2F Z;  1A32 A;  2K1E A;  2OCC C;  1DF5 A;  3AG4 C;  4CH3 A;  3T2M A;  2QTO A;  3OR6 C;  5B1B C;  3ML0 A;  1NTM H;  4B3R B;  1SQP H;  4P30 A;  3JAK B;  3G6B A;  3RVY A;  5LHH A;  4F6R A;  2EIJ C;  3QTC A;  2F4V B;  4TWK A;  3ICX A;  4JTC B;  4Z2W A;  4LF5 O;  3QO8 A;  4H13 B;  4K0K B;  3QNE A;  2QE7 G;  5BMV B;  3CJH B;  2YXL A;  3W7U A;  4UCR A;  1KUQ A;  4LF9 B;  4UB6 Z;  4O4J B;  4UFZ A;  1W0K G;  3VQW A;  4KFM A;  4HBN A;  1NS1 A;  2HKO A;  2Q6A A;  1L1F A;  4F6E A;  3RW0 A;  5JVD A;  4BIU A;  1FXK B;  2IM9 A;  5KX5 B;  4I0X B;  5HFL A;  4DR1 B;  1FS0 G;  1K33 A;  1D5A A;  1DLB A;  3OGI B;  5IJ0 B;  3CCR V;  2Q0O C;  3T1C A;  3UT5 A;  3RYH A;  2Q4P A;  4B3M B;  1SZT A;  3OT7 A;  5B1O A;  3D3Q A;  4DV2 O;  4NYK A;  4NKG B;  4DV5 O;  2PGG A;  2QWN B;  1B06 A;  3RWR D;  5D5Q A;  2EUL A;  3KG2 A;  3ZMS A;  2DYR B;  1HW7 A;  4E2L A;  1WB8 A;  2UXB O;  5IYZ B;  1K34 A;  3CCV V;  3H1K H;  4N23 A;  4PJ0 Z;  5BXZ A;  3L70 H;  4UVA A;  3JSN A;  5H9C A;  4MVS A;  4NXN O;  3H1J H;  4PDR A;  4X1K B;  1EFR G;  2F95 B;  3EVK A;  2PZS A;  3L9D A;  3OD4 A;  4NR1 A;  4PEL A;  5EZY B;  3SYO A;  2QWO B;  1K5Q A;  2ZM6 O;  2EIL C;  3CXC U;  3QVN A;  5L3E A;  1R73 A;  4D6T H;  4Q6G A;  3PN1 A;  4GKK O;  1E1R G;  1K73 W;  1TA8 A;  2ZDI C;  4WFH A;  3LDC A;  4LH7 A;  2RCV A;  3P3P A;  1WN7 A;  1Y4M A;  5KMG A;  3RYI B;  4WFB V;  5EC1 C;  2UUA O;  2ETN A;  1IBK O;  1N32 B;  1MSD A;  2F1M A;  4FFB B;  4O4I B;  2V1D A;  4RQF A;  4TV9 A;  2DQ0 A;  3OM3 B;  1GH6 A;  1Y6X A;  3FD9 A;  5H6Q A;  2PUS A;  1I94 B;  1NBM G;  2JRI A;  4LFB B;  3ABL B;  4OPA A;  4PA9 A;  4GUN A;  4AQY O;  1HNW O;  3SR2 C;  2HJF C;  2AZ0 A;  1FAF A;  1QR9 A;  1R3K C;  1K3E A;  2JK5 C;  2WA3 A;  2CDY A;  4WBN A;  2ODM A;  1QQC A;  2RQ6 A;  4PDL A;  5JCO A;  4I4T B;  1S5H C;  3JAW B;  5A9G A;  1BSM A;  4PI2 A;  1E1Q G;  4B08 A;  3OTO O;  3APO A;  3LUT B;  4R50 A;  1JFF B;  1W59 A;  5H6R A;  2YID A;  4EFE A;  3ZJZ A;  4CC5 A;  1UJW B;  4Q20 A;  4X8A A;  1COW G;  1GM8 A;  4LWS B;  4NTY A;  1BZK A;  4IL6 Z;  3ETD A;  1EM1 A;  1SQF A;  4KXR A;  5E1A C;  4DR7 O;  4YJ3 A;  2K9P A;  5LXT B;  1ZTE A;  2UU9 B;  1NTK H;  2QJ1 A;  3NXS A;  2EIN C;  2QKS A;  1F4N A;  4FLV A;  3STZ C;  2IU0 A;  2QWR B;  3D36 C;  3G80 A;  1IBM O;  1Q43 A;  3KZI Z;  5DED A;  1SF9 A;  1H5W A;  2LFS A;  3SGI A;  4YHH O;  1WJZ A;  3CRQ A;  1AJP A;  3CSX A;  4J9Z B;  1SES A;  3GB7 C;  3CC7 V;  4XDJ A;  4NTX A;  4PA7 A;  1D2D A;  2DJV A;  5LMN B;  1HNX B;  3NR7 A;  4MW3 A;  2A3Q A;  2W0F C;  4H44 B;  4HNA B;  2P67 A;  3ZRX A;  5B3S C;  5IWA O;  4JV5 O;  2LGW A;  1H2L A;  3SPC A;  3F5W C;  4DV7 B;  1OJH A;  3FYE B;  5EIB D;  4QGP A;  3JAL A;  1XQ8 A;  3D8C A;  2WLL B;  4LFC B;  3FKS G;  3FX7 A;  2BOC C;  4B3S O;  2Y4T A;  2HLD G;  1RPR A;  4DW0 A;  2ZXW C;  1RM1 B;  5BY1 A;  3JYC A;  1JR9 A;  4P2Z A;  4TUY B;  4NXM B;  2EJR A;  1B6Q A;  4DR4 B;  2YEV B;  1AVM A;  2VWJ A;  3G4S V;  1MMM A;  3N2G B;  1N36 B;  1K8A W;  3ASN B;  2YSU B;  1L0N H;  3IAY A;  1I0H A;  4DV1 O;  1VP7 A;  4RUF A;  4TOI A;  4CS2 A;  4EB6 B;  2Y69 B;  2WLK A;  1H8E G;  5B1N A;  3CCJ V;  1FKA O;  5FPO A;  2QWQ B;  2M6Y A;  2X7R B;  4DR3 B;  4DV3 B;  4GX0 A;  5L3D A;  4B3T B;  3M99 B;  3OFN G;  2E5L B;  3JAR A;  4ZIB A;  3RYC A;  1YEW A;  2QGN A;  3K04 A;  2PTM A;  1ZL8 A;  1N0N A;  2P06 A;  1G8M A;  4CH4 A;  1XBL A;  1NVP B;  5LMU O;  5JH7 B;  4LF4 B;  4LH6 A;  4DO2 A;  1B04 A;  2PI4 A;  3C90 A;  2A06 H;  1BQ0 A;  3K9S A;  4DR2 O;  1J95 A;  1LUV A;  2Q68 A;  1VMG A;  3Q4H B;  3CWB H;  2E74 B;  1I5Y A;  4BW5 A;  1H2G A;  4JI6 B;  4WFE A;  2QKA A;  3E86 A;  1Y66 A;  3AG3 C;  3WFV A;  4FLW A;  5BMV A;  3CJH A;  2LO1 A;  3JD3 A;  2P90 A;  1Q90 D;  5C8Y B;  4O4J A;  2X6A A;  4XDK A;  5J9P C;  2GTS A;  4YJ2 B;  2F4V O;  2DE0 X;  4DV0 B;  1M5I A;  5J2T A;  3A8T A;  4ZI7 A;  1FJG B;  5KX5 A;  2RJZ A;  5GON B;  1IVS A;  4X66 O;  1JPX A;  1K4C C;  5LP6 A;  3WU2 Z;  3STL C;  2CE4 A;  3RBZ A;  4O2B B;  4EEQ A;  2JEX A;  1JA8 A;  1SS3 A;  1Z2G A;  5E79 Z;  5LGU A;  4FPP A;  4DUZ B;  2FL4 A;  2DYS C;  3AG2 C;  2KSD A;  2RNB A;  1V54 B;  3WB0 A;  2XAS A;  3U10 A;  3ZMT A;  1N8R W;  2L35 A;  2CTW A;  4TT3 G;  1Y67 A;  1BHB A;  1KKC A;  3OMI B;  1YIJ V;  2WWW A;  4X1K A;  1L0L H;  1R3J C;  4B3M O;  3IFX A;  4PDM A;  2QEX V;  1Q6I A;  1X4T A;  2P4K A;  3OEH G;  3OR7 C;  3CCQ V;  4JI2 B;  1NZ6 A;  1HWY A;  4TV8 A;  5JCO C;  2X6B A;  3AEI A;  5EZY A;  4J41 A;  3DXR A;  5CA0 B;  1YVW A;  4J7J A;  4JAV A;  3L71 H;  2OCH A;  3GVM A;  3BFR A;  5B1A C;  4DRX B;  4DV4 B;  2BE3 A;  2WAM A;  3CHX A;  1BGY H;  2A9H A;  3ETQ A;  4JI4 B;  1XNR B;  1XDC A;  3LSQ A;  5D5P A;  4FFB A;  4GZR B;  4JPR A;  4IGG A;  4O4I A;  3H1H H;  4X65 B;  3ETG A;  4JI3 B;  1WA8 B;  1OCR B;  3K06 A;  2VQF O;  3SPJ A;  4NVP A;  1RSO B;  3CRM A;  1M57 C;  3AG1 C;  3E8H A;  4J9Y B;  4ZOL B;  2RMK B;  2FKX A;  2ZIO A;  3RYF A;  1XNQ B;  3LSS A;  4LF7 O;  2F43 G;  3X2Q B;  4MS2 A;  1YJW V;  1DTO A;  4JYC A;  2CGO A;  3OEE G;  3AK3 A;  1XMO O;  3U11 A;  3CD6 V;  3TET A;  3T1H B;  4PD4 F;  5K1P A;  1OCZ B;  4OXS A;  1JFF A;  2ZIN A;  1GTO A;  3K79 A;  1XI1 A;  1Q86 W;  1WNS A;  2WLI A;  2Q9L A;  3JD0 A;  4LWS A;  2GUZ B;  2LW7 A;  4JAS A;  3ZCC A;  2Q7G A;  3QO7 A;  1SQQ H;  5J2U B;  3OMN B;  2HHH B;  1SET A;  4CBC A;  2YI8 A;  5F2V O;  4FLU A;  4X1I A;  5IDJ A;  3FAV A;  1ZSP A;  1NJI W;  1R6T A;  2EX3 A;  1SA0 B;  3VBB A;  4KP4 A;  4FMT A;  4IYI A;  2DW4 A;  4U3F H;  3SYQ A;  1SQG A;  4I50 B;  2ZNJ A;  3ABU A;  3ZHR A;  2LGQ A;  4JI0 O;  5IY5 B;  1BL8 A;  4YY3 O;  2DQ3 A;  4X88 A;  2WLJ A;  5BR8 O;  1S3J A;  2JGD A;  5LHG A;  2A7W A;  2UU9 O;  3OTF A;  2P5O A;  1LNQ A;  2HVK C;  1NVP D;  4X62 B;  1KC8 W;  2B1I A;  1YZB A;  1LR1 A;  3FB7 C;  4YIP A;  1WPX A;  4LFA B;  1PM9 A;  1YSC A;  1XL6 A;  1N33 B;  1BQZ A;  2OCC B;  4X1Y B;  3UCS C;  1P7B A;  3A2F A;  1O9G A;  2VRZ A;  3AG4 B;  4LF6 B;  2BTO A;  5KAF Z;  3ZHU A;  2XT9 A;  2C2A A;  2WLL A;  4J7Z A;  5B1B B;  1FYJ A;  1SQX H;  5LA6 B;  4QJF B;  5LMN O;  3KCY A;  2EIJ B;  3UM7 A;  1S0V A;  1VQO V;  4TUY A;  3F7Y C;  3ZX6 A;  1IUR A;  2YEV A;  2JVD A;  2VS0 A;  2CH7 A;  1ZWI C;  3FB6 C;  2PYJ A;  3A0R A;  3N2G A;  2EIK C;  5JQG A;  3GWK C;  4RQE A;  2E3C A;  1PKX A;  3D3I A;  3WG7 B;  2EJ7 A;  5LGT A;  4X64 B;  1GKF A;  5B5E Z;  4FFK A;  4K8Z A;  3OUS A;  3IGA C;  4ZBM A;  3FYI B;  4U3J A;  1K4D C;  2IJK A;  1N36 O;  1VIB A;  2GBO A;  1JQ0 A;  2PY5 A;  1YDX A;  2KG7 B;  4R7C A;  3S3W A;  4IIJ B;  4TQD A;  2CK3 G;  4YXW G;  2NN4 A;  4QPK A;  4PA6 A;  1VF7 A;  5LP6 C;  3SDL A;  5JH7 A;  2AZ2 A;  4DR3 O;  4P9O A;  4MSW C;  5CA3 A;  1P49 A;  5LOV A;  3ZBH A;  4DV3 O;  2M7W A;  4B3T O;  4IHJ B;  1SRY A;  2E5L O;  4D7S A;  3E8B A;  3L75 H;  1J5E B;  3J7A U;  1ARO P;  3Q4H A;  1BS3 A;  1THZ A;  5FNV A;  2NNU A;  1JJ2 U;  3DTU B;  4DYL A;  1ROP A;  4NTW A;  2IBZ H;  4LF4 O;  1V9P A;  5LBQ A;  4BR6 A;  2ZT9 B;  2Q8V A;  1AI4 A;  2LW1 A;  2QM8 A;  1GK9 A;  4EFB A;  3SYP A;  3K9A A;  3ZIA G;  4UCV A;  1KD1 W;  2H8P C;  2BOB C;  4JI6 O;  3CCM V;  4JAU A;  1AJN A;  1KMI Z;  5GON A;  4GLX A;  3K58 A;  2BTQ B;  1I08 A;  3CPW U;  3JD4 A;  1W0J G;  3E83 A;  1G4Y B;  4O2A B;  5JJJ B;  2XND G;  2QTS A;  2JIZ G;  4XBF A;  3CC2 V;  2MK3 A;  3MHS C;  1K9M W;  2W6J G;  2B5U A;  5EBW C;  1FFX B;  2XAH A;  4JI5 B;  2DWE C;  4GKJ B;  1DK1 A;  1NH2 B;  3ZHT A;  3CX5 F;  1FJG O;  5LGN A;  2LP7 A;  3JD2 A;  3H01 A;  5LYJ B;  3J81 N;  2UXN A;  1PL0 A;  4FLX A;  1D5N A;  3T1Y O;  4I9Q A;  2CAZ C;  1EN5 A;  5CB4 A;  2QSA A;  1Q81 W;  2P22 C;  5L3C A;  1YTF B;  1EZJ A;  1ZLZ A;  3K3W A;  3B40 A;  2UUB B;  4JI1 B;  1OCO C;  4ABM A;  1VQ4 V;  1YIT V;  1QVF U;  4IT5 A;  4DR6 B;  4UCT A;  4CZZ A;  1ZUQ A;  5EYP B;  2OWO A;  1PV0 A;  5CA0 A;  2JGU A;  5JJE B;  3ZRS A;  4CH5 A;  4KHP B;  2EIN B;  4O4L B;  3CRA A;  5IT9 N;  4LF8 B;  4UV8 A;  1VQ8 V;  1N0J A;  1TAE A;  5CN0 A;  3RFR A;  2LFR A;  4DUY B;  1WPB A;  5L3G A;  4JI2 O;  3ASO C;  2JS5 A;  4E4E A;  1XL4 A;  3E8G A;  3IC7 A;  1WA8 A;  4TQF A;  4B7E A;  2AW9 A;  1AP5 A;  2Q0A A;  1IJG A;  3N2K A;  4QE7 A;  3TCU A;  1K92 A;  3JAT B; 
#chains in the Genus database with same CATH homology
 1JR9 A;  1VEW A;  3CEI A;  1AVM A;  2CDY A;  1MMM A;  1VAR A;  1I08 A;  3AK3 A;  1XRE A;  2CE4 A;  1I0H A;  1AP6 A;  1BSM A;  3DC5 A;  4YIO A;  5A9G A;  1JA8 A;  1MA1 A;  4JZG A;  3OT7 A;  1AR4 A;  1PL4 A;  1B06 A;  1IDS A;  1GN6 A;  4FFK A;  1GN4 A;  3AK2 A;  1WB8 A;  1XUQ A;  1MNG A;  1EM1 A;  3DC6 A;  3KKY A;  1EN4 A;  1BT8 A;  1IXB A;  1IX9 A;  1ZTE A;  2GDS A;  3KDR A;  3AK1 A;  3C3T A;  1D5N A;  1Y67 A;  1KKC A;  1EN5 A;  2ADP A;  3EVK A;  1AR5 A;  1N0N A;  1ZSP A;  3TJT A;  1P7G A;  1ZLZ A;  2P4K A;  4C7U A;  3QVN A;  1EN6 A;  5AG2 A;  1ZUQ A;  1GN2 A;  1LUW A;  3C3S A;  1XIL A;  3BFR A;  3K9S A;  2RCV A;  1LUV A;  4JZ2 A;  3LSU A;  1WB7 A;  1QNM A;  1N0J A;  4YIP A;  1PM9 A;  1MSD A;  1XDC A;  1BS3 A;  2QKA A;  4JYY A;  4E4E A;  2QKC A;  4BR6 A;  1GN3 A;  2AW9 A;  3RN4 A;  1AP5 A;  3IC9 A;  3MDS A;  4F6E A;  4X9Q A;  1SZX A;  4GUN A;  2ADQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...