1N0NA

Catalytic and structural effects of amino-acid substitution at his30 in human manganese superoxide dismutase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKVHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
publication title Catalytic and Structural Effects of Amino-Acid Substitution at His30 in Human Manganese Superoxide Dismutase
rcsb
source organism Homo sapiens
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1n0nA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1n0nA02
1VARA 4FFKA 3AK1A 1EN4A 1EM1A 1D5NA 4JZGA 1AR4A 1LUWA 3MDSA 1MA1A 3DC6A 1KKCA 4YIOA 3LSUA 1WB8A 2RCVA 3DC5A 1AP5A 1EN5A 3EVKA 2AW9A 3IC9A 1GN2A 2CE4A 4GUNA 1GN6A 1MSDA 4C7UA 2QKAA 1BSMA 3TJTA 3AK3A 4YIPA 4F6EA 1B06A 1XREA 3AK2A 1SZXA 2QKCA 1ZTEA 1IX9A 1ZLZA 4JZ2A 3CEIA 1PL4A 1BT8A 4X9QA 1IDSA 1I08A 1I0HA 1P7GA 2ADPA 1MMMA 2P4KA 1IXBA 1N0JA 1AVMA 1LUVA 4BR6A 3KKYA 1XUQA 1N0NA 1XILA 1Y67A 1PM9A 1GN3A 1JA8A 5A9GA 1BS3A 1QNMA 3C3SA 1MNGA 1ZSPA 1JR9A 4E4EA 3RN4A 1WB7A 3QVNA 1VEWA 1ZUQA 3C3TA 1AP6A 2GDSA 3BFRA 4JYYA 3K9SA 5AG2A 2ADQB 1AR5A 1GN4A 3OT7A 1EN6A 1XDCA 2CDYA
chains in the Genus database with same CATH superfamily
5B3SB 2AZ2A 3AG4B 4H37A 3L9DA 1JVMA 3JYCA 1XMQB 5EZYA 3OTOO 5FNVB 2CTWA 5B66Z 2Q7HA 1AR4A 1I5YA 3HKDA 3IAYA 3ASNB 2ARHA 2RCVA 2NR5A 2ZDIA 1HP8A 3N2GB 4CH5A 3WB1A 4FLXA 4HNAA 1GN6A 1CPYA 1H8HG 1FYJA 5LP6C 1I5XA 1V55C 1N32O 3N2KB 5GTIZ 4J10A 4JYCA 1OV9A 3IC7A 3OUFA 4BAYA 1BT8A 3JCUZ 1JJ2U 3UO2A 4N23A 5B1BB 1HR0O 3OR7C 3FYEB 1VQ9V 3RYFB 2FB5A 2L35A 4X1IB 5JH7B 1RP3B 3SPHA 3T4DA 1WLEA 1M90W 2Q9LA 2EIMB 2ZE6A 2UXDB 2ZQMA 2WLMA 3OD4A 1N4CA 1FS0G 1BS3A 4X1YB 2W0FC 2VQFB 1M57C 4UUJC 2MW2B 4FMTA 3C90A 4UCVA 3L73H 1DF5A 1S72V 3ZMSA 3SPJA 5C8YA 3K79A 1BQ0A 1FXKB 1ZL8A 1H2LA 2Q67A 1AJQA 1NI8A 2A7WA 4MTGA 3ZBHA 1R3JC 1WA8A 2R9RB 3H9VA 1N36O 1K7DA 2QA4V 5LMNO 1NVPB 5LGTA 2Z5UA 3MHHC 1AI6A 3BAAA 1K97A 1GN4A 3SR2C 1XL6A 3G6EV 1X59A 3LNMB 2UXBB 3UO3A 2CH7A 4IYHA 4ICGA 1XNQO 4TV8B 3AG7A 3ZHQA 4LH6A 5J2TA 5KUKA 3CE2A 4DR2O 2KSDA 4MVZA 3WB0A 2Q69A 5JQGB 2F1MA 2YIDA 5LOVB 1AR1B 5BY1A 3ML0A 1NTZH 3CSXA 3ZCCA 3VBBA 4WFAV 1V54B 3AG2B 3JD2A 1QVFU 3KZIZ 1AI5A 3EVKA 3QO5A 1XL4A 1LR1A 1H2KA 2Y69B 1R3LC 3K5OA 1WPXA 3U0ZA 5KLVH 3HKCB 3ZRWB 3K5NA 4TWKA 2ZKOA 1RSOA 4I9WA 1AI4A 1I08A 1P7GA 2ZE5A 4CC6A 4K0KO 3J80N 1QU7A 1MZEA 1ZX3A 2IJKA 4LFBB 4DR6B 1SQQH 2PUSA 4MTOA 1L8DA 3TXSA 1N0NA 1WN7A 1MG1A 2PYLA 4DUYB 1XHXA 4X20A 2VQFO 4RUEA 1D2DA 1JR9A 1BE3H 3P32A 3H1KH 4AI8A 4DV1B 3UKMA 1VF6C 4TV9B 4AHCA 1XNRO 5J2UA 3HKBA 4E2LA 2GHYA 4IHJB 5LGNA 1H5WA 1SKVA 4DV4O 4FZ0A 3WFVA 1PKXA 3A0RA 4PI2A 4DV0O 3A0BZ 3P30A 1XI1A 1Y6XA 2L6LA 5LMUO 1Q43A 5CBGA 4FFKA 2UXBO 4IGGA 4BW5A 2EZPA 1EM1A 2Y48A 4J11A 4G28B 4I5SA 2IU0A 2E75B 1BHAA 2GBOA 4UFZA 3B8MA 4LP8A 3RYIA 1EBOA 2XTAA 4JZGA 5B1OA 4JV5B 5CA1A 2XASA 3CXHF 1KU9A 4X64B 4JI8O 1KKCA 3LSUA 4P9PA 2UU9O 2AW9A 3JAWB 1H38A 4PA4A 4IYIA 3K9AA 4I0XA 4QNHB 4C7UA 3CP1A 3T1HO 1O9GA 2P6JA 1HW7A 1R1BA 3ABKC 4B3SB 1S0VA 4XDJA 3ETDA 2BTOA 1YIJV 4IIJA 2JIZG 1ZLZA 2HP8A 4O4HA 5E79Z 1RPRA 1HNXB 1HNZO 1IBMO 2Z0AA 3LDEA 1PNLA 4NXMB 1IXBA 1SS3A 2IJJA 5IYBO 4H33A 4PHZA 1MABG 4DR7B 5LA6B 1M4UA 1WNSA 5A9GA 2IH3C 2A3QA 1SRYA 3CCUV 2PI4A 2MK3A 4O2AB 2GUZA 1OCOB 4I50B 1NJIW 3QVNA 1KECA 4YJ3B 1VEWA 2BE3A 2HVKC 3CCJV 3JAMN 3ZHTA 4WFHA 3FD9A 5ITZB 4N21A 4DV3B 3JD4A 4LF5O 2OIEA 4F4LA 3ETQA 3K04A 2WLLA 1Y4MA 1KD1W 2W6IG 2LW1A 5JJNB 3D36A 5CA0B 5GW7A 2JRIA 1BCCH 2HJFC 4LF4O 3CCLV 1K73W 3ABMB 3UT5A 3OEHG 4JI6B 1D5NA 1GKFA 1VQ6V 2UXXA 3SJAC 2EJRA 2QWOB 4LFAO 3ETGA 4X64O 2JGUA 3ZRVA 4LF9B 4ZHQA 5FL7G 1VQLV 3RGBA 3R66A 1S5JA 2P4VA 2YIAA 4D7SA 4EKWA 2EIJB 3MAQA 3AK2A 1SZXA 2OCHA 1ZTEA 1EFRG 4YY3O 4QE9A 2JGDA 5GONA 4JI7B 2OCCC 1FFXA 4NXMO 5KX5B 3RFRA 2WPDG 1JQ0A 1YCIA 1PNKA 4JTDB 3L75H 1XILA 4ASUG 1YJNV 4JI3O 4PDMA 3HKEB 3STZC 2DYRC 2QSAA 4OPHA 4DV2B 1ZSPA 2D2CB 3MHSC 3JARB 2ZM6O 4FLTA 2PYJA 1TUEB 4E4EA 1QVGU 1R6TA 1COWG 2PZSA 1EZVH 3SYPA 3JD1A 3CRRA 1JFFA 1VQKV 3FB7C 1K9MW 5EZYB 4B3TO 1MZFA 2ETNA 3RYCA 1SA0A 3CJHA 3K9SA 3H1IH 3SPIA 3HKDB 4LF7B 2N74A 3IFXA 1Z5WA 1SQGA 3ZN0A 4UCOA 4X66B 1VF6A 3D8CA 4DV6O 2EULA 4EB6A 3SDLA 4U7NA 2UXNA 1EN4A 2W0XA 4TQDA 3BY6A 5KAIZ 3CCRV 1XMOO 1I94B 4JI6O 1PD3A 4B3RB 4FM0A 1ZAUA 3G67A 2OTLV 2NNUA 3CXCU 3G6BA 1FFTB 3OEEG 2W6JG 3DC5A 5EC1C 5EIBD 4CS3A 4LF9O 1S77D 3IC9A 1JPXA 2ZCEA 4GUNA 1VQOV 4ABMA 3OFNG 5B1AC 4G27B 3VQYA 3JD3A 3H1LH 3I55V 2QDOA 2BSKA 3TGUH 3F7YC 1K4DC 1TVKB 3ASOB 1OCZC 5DEDA 4JI7O 3ZHSA 4GX1A 3Q4HA 1N34O 4Z1MG 1MMMA 4DR5O 1AVMA 1O9HA 5C8YB 3K58A 2KKWA 4WFFA 3EXAA 2E5LO 2WA3A 3L74H 3S3XA 1ZL8B 1M56C 1OJHA 1ENVA 1GN3A 4MT8A 1WA8B 2VWKA 2FYUH 4ZKIA 3JATA 3E89A 5KHJA 3AG1C 4P9OA 3M99B 1N33B 1T5EA 2VQEO 1YDXA 1HR0B 5B3SC 3AG4C 2RQ6A 2CH7B 5IE9A 1H8EG 3EHBB 5J2TB 2YI9A 1AJNA 4UVCA 1W59A 1NVPD 1TA8A 2LQTA 3KCYA 3BPZA 3ASNC 4MS2A 3BA9A 4H13B 3A2FA 4PI0A 5EIBC 2RNBA 3JSNA 4UV8A 3DTUB 5IWAO 2OWOA 4DK1A 4I55A 1I94O 3IGAC 3L71H 1N36B 3JD0A 5LMNB 2OYQA 5C93A 4FPPA 1MA1A 2R72A 3ZS8C 1RSOB 2JJ2G 4K3AA 5B1BC 4HYOA 2XAGA 2A06H 1S5HC 4J9YB 1MSDA 4NXNO 4I4TA 1XNQB 4KUMA 2EIMC 2Q4PA 2UUCB 1JNBA 2X6CA 5CB4A 4DR2B 3SYOA 4X20B 3OMIB 5CA3A 4NTYA 3BEHA 1WPBA 2QTOA 4DRXB 2K9PA 3ETEA 1FXKC 3RWRD 3F5WC 5J2UB 3HKBB 1NH2D 1L0LH 3OGIB 1F7YA 1Y67A 3KDRA 1XOUA 4QIWF 5EBWC 2UUAB 2H94A 3W7SA 1K8AW 2QJ1A 3ZMZA 1N33O 1R3IC 4KFMA 5BZBA 2HHHO 4K0KB 1UPGA 1E79G 5IY5B 4O2BA 3CX5F 4LC1A 1LNQA 4RUFA 2Q5ZA 4GYCB 3RYIB 3VOUA 1TVKA 3ZEDA 2KG7A 2LP7A 1YZBA 2YIBD 4MVOA 1AR5A 1NR7A 4IT5A 3FYIB 1Q7YW 5CA1B 4JYBA 2O57A 1V54C 2PGGA 2XAJA 1Q5OA 1H2GA 4DO2A 1E1QG 4XDKA 1U96A 1XNRB 4I0XB 1FD9A 4BIOA 1SF9A 1Q6IA 3G80A 3HB3B 2WLHA 3RVZA 3RW0A 3X2QB 1Q8IA 4IIJB 4DV4B 3WU2Z 2ZR3A 4O4HB 4DV0B 2DQ0A 1YEWA 2Q68A 2RDCA 5LMUB 1I7FA 2YS8A 3K5MA 2JK5C 1NU1H 1VQNV 2QR4A 4KL1A 1SZTA 2UUCO 5F2VO 5KA5A 4DR4O 5FPRA 3ZMTA 1TAEA 2BOCC 4DR1O 2Q0AA 4DUZO 2P7TC 4H44B 4J7ZA 4P2ZA 4JI8B 1R3KC 2GUZB 1H2SB 1N0JA 5BXZA 2ZD9A 1YF2A 3W7XA 1B6QA 2UU9B 2ATKC 3ZRXA 2PF4E 1F4NA 3T1HB 3CMAV 1PM9A 2YXYA 3UCSC 2UUAO 2X0LA 1QNMA 2F95B 3C3SA 1M57B 1KP3A 1HNZB 1IBMB 3K3WA 1NTMH 1TUBA 2FKXA 1M93A 2PY5A 3RN4A 2WLLB 2ZNIA 4O4LA 2DYSC 3UT5B 4X62O 1IJGA 3GWKC 4CC5A 1KKDA 5AG2A 1JCHA 4J7KA 1PL0A 2Z3YA 4UB6Z 1EN6A 2FL4A 2XOKG 1VQ7V 4GZRB 4ZHQB 4DRXA 3N27A 2AZ0A 1Q86W 4GKKB 2ITCC 4X89A 4ZBMA 2ITDC 3CC4V 5E1AC 4MVUA 4ZOLA 2Q7EA 4JAAA 4I9QA 2JGDB 3LSQA 5GONB 4LF5B 2F4VO 1FFXB 1IBLO 1WB8A 1AP5A 2FTKA 4B08A 5LYJA 2CE4A 5CMUA 1G4YB 1VMGA 3TJTA 1BSMA 1YJ9V 4JI5O 4LF4B 5CN0A 1H2MA 1Q90D 1XBLA 1VQ5V 2B9ZA 4L8JA 4JZ2A 3CEIA 4CS2A 5IT9N 1PL4A 2DWDC 4IL6Z 4QJFB 4OX9O 4FFBA 4LFAB 4OXSA 1FAFA 1OCOC 4KHPO 3ABLC 3PN1A 4GT1A 1LUVA 3CRCA 1JFFB 1QHTA 2CTRA 5KMGA 1DK1A 5L3FA 3A8TA 3JCZA 2CTPA 4FLZA 3OMAB 3RYCB 1KUQA 1SA0B 3CJHB 2GTSA 1SC5B 4YY3B 3STLC 3VQVA 4D7TA 3K59A 2Y4TA 1MNGA 1P4RA 3I56V 4PV1B 4FLUA 2WLIA 3BABA 4FM1A 3L70H 3SPCA 1M1KW 2QM4A 4CS4A 4EB6B 4J9ZB 1FJGO 2DJVA 3IJ4A 1G1XB 5LP6A 3ABMC 2H8PC 4GX0A 4TOIA 1K3EA 2JDIG 4PDLA 4JYYA 4JI3B 2YI8A 4X88A 4FM2A 2ZT9B 3CD6V 1VQPV 1NTKH 3OAAG 3AG3C 5H9CA 5HFLA 2LW7A 2ZM6B 1THZA 4X1KA 2YICA 1MSWD 1GM7A 4J41A 4GKKO 2EIJC 4B3TB 4Z1VA 2G38A 4OPAA 2BSKB 5H2FZ 4CH4A 2Y4UA 3THOA 3Q4HB 2V1DA 1AB3A 5FPOA 2CAZC 2OIGA 4DV6B 4BIUA 1KBHA 4BWAA 1HNWO 1DTOA 3JAKA 3AK3A 1Y66A 4D6TH 1Q81W 4FJCC 2EILB 2Q6AA 3WG7B 2X6AA 2P5OA 1XMOB 4UVAA 4LNUA 1IX9A 3SYQA 3B4SA 2PTMA 3ZMUA 4JYAO 3JATB 3SYAA 4JI2O 2FMLA 4WBNA 3T4ZA 3KKYA 2R9AA 2F66C 3A0HZ 4F6RA 1SQVH 2F23A 2DWEC 5LXTA 2EIKB 1L0NH 3E2EA 2LFRA 2RN9A 2E76B 1N34B 3H01A 1DGSA 2LGQA 3SPGA 1P84F 4U7OA 4DR5B 2WWWA 4NVPA 4HBNA 3FAVB 2E5LB 3E35A 4XBFA 4AQYO 4G2KA 1VIBA 1VF7A 4TQFA 4I55B 1AP6A 1PPJH 1A32A 3B8NA 3K06A 3JASA 2M7WA 3B40A 2P67A 4LFCO 2VQEB 1B04A 2QWRB 3WB2A 1OCRB 4JI4B 4R50A 2F43G 1SESA 3TXQA 4I4TB 3UM7A 2YEVA 5KAFZ 3JSLA 2JS5A 4PA3A 2M6YA 4MVMA 1QLEB 1NQTA 3ASOC 1IURA 1NKDA 5CB4B 3R65A 1W0JG 5D5QA 4UCTA 2YXLA 4K35A 2HLDG 5JVDA 4FIPC 2HVJC 4NTWA 3OMNB 1YHQV 4R6ZA 2DN9A 1XHZA 4MTXA 4CBCA 3BHPA 2JEUA 2EBOA 4HZ3A 3T2MA 3AEIA 2QKAA 5IWAB 1J5EO 4ZI7A 2E3CA 2Q73A 3ABTA 4O4JA 1ZWIC 4EFBA 2WLKA 4U3JA 2UXCO 1OCCB 4B7KA 4PA6A 3U11A 1NT2B 4X9QA 3F7VC 4XDLA 1WP8A 2DW4A 2Q0OC 4MW8A 3E22A 5BMVA 4NXNB 4O2BB 3CCSV 4Z2WA 3JALB 1QR9A 3G71V 2YDEA 1BGYH 2KG7B 3FX7A 2DYRB 5EC2C 1MOFA 2WLNA 4DR3O 4ZIBA 4HAMA 1K5QA 2WLJA 4EFEA 1R6NA 2OT5A 1YJWV 1GM9A 4FLVA 2OTJV 1JJOA 2RJZA 1AROP 2VWJA 1ZUQA 2HG5C 3J7AU 1OHHG 3OGCC 2ZXWB 2B1IA 4J7JA 5JCOC 4TT3G 4WF9V 5B1NA 4MTFA 4MVQA 2HHHB 4JI4O 2RMKB 1QBZA 5L3BA 1NS1A 1PV0A 1Z2GA 1K92A 1GH6A 2ZIOA 2DOSA 2C2AA 3DC6A 4J42A 1YVWA 4JASA 4LWSA 1DLBA 3TETA 1DF4A 3E8BA 3FAVA 3O9OA 4WFEA 4LH7A 1QLNA 3CRQA 3CCQV 1YTFB 3I5DA 3LUTB 5KHIA 4F6EA 3F5TA 3RBZA 4DV7O 5IYCO 5FLXN 1OCZB 2XT9A 4DW0A 1IBKB 2NN4A 3CC7V 4H0LB 2EINB 1Z5VA 1TUBB 5H6RA 2B1GA 2HJDA 5EBLC 5H6QA 3QTCA 2ZE8A 4UV9A 4O4LB 4LBEC 4PDVA 1XQ8A 5IY5C 2LFSA 3B09A 1XUQA 2QKSA 2IM9A 4DR4B 3NXSA 4DR1B 5B5EZ 2Y0PA 3NR7A 1Y74A 1Q6HA 4DUZB 2CTQA 1SQBH 4DK0A 1S76D 2GSMB 3ZHUA 5K1PA 1GRJA 3BCCH 4X65O 2YXHA 4GKJB 3L72H 2B5UA 4JF3A 4ZOLB 1F51A 3E8FA 3W7UA 3C3TA 1RFYA 2GDSA 1E1RG 3X2QC 1BQZA 1RM1B 4FVMA 2QE7G 2JS3A 2LGWA 3W7TA 4GLXA 1GAXA 2Q7GA 1XEQA 5IJ0A 1K5SA 2CDYA 3UQ8A 3T1YO 1Y76A 5LYJB 3CRMA 4JTCB 2DMXA 4QGPA 3JALA 2EZOA 5L3GA 4X62B 2P06A 3T1CA 4FLWA 4LF8O 3CPWU 4FFBB 5GTHZ 2A9HA 3AG2C 2ZR2A 2JVDA 1FPOA 1Q82W 1GN2A 5KMGB 1QCEA 1YXBA 4BIZA 2Y69C 5H5NA 4EEQA 2IU3A 2QKCA 4LF6B 5BR8O 2LJ2A 1IBKO 2ODMA 1G6UA 3ZX6A 5CBFA 3H1HH 1S5LZ 5CBHA 4DV5O 2F4VB 3B2EE 1I0HA 2WLIB 1PP9H 1IBLB 2P4KA 2AXTZ 5IJ9A 2AHYA 2PI5A 3D36C 3VQXA 4JGSA 2IBZH 4YHHB 4MSWC 3QG5A 1IZ3A 4UCRA 1RPOA 2QWNB 4JI5B 5LP6B 2UUBO 1V55B 2Y0IA 3OUSA 4FLYA 3CWBH 4DW1A 2BTQA 3HPLC 4WCEV 1WAZA 3QF7A 1K33A 4OX9B 4QPJA 4KHPB 1S3JA 4GX5A 1WJZA 4J80A 2N05A 1GMGA 4X1KB 1GM8A 1XMQO 4CH6A 4RO2A 4GKJO 4PDRA 1KQSU 3BRCA 3OR6C 3ZHRA 4R7CA 3RYHA 1CEZA 1F4MA 4YJ2A 2D3OW 3LNNA 3SYCA 1BL8A 4FZ1A 1FJGB 3AK1A 5LBQA 3JAKB 4O4IA 3CC2V 4MW3A 1G8MA 3K57A 3DSQA 4RQFA 4LNUB 3CCMV 5JCOA 3ZN1A 3LDDA 1KYOF 2AHZA 3ICXA 5L3DA 3S3WA 1AILA 4JTAB 4NKGB 2YC0A 3ZHVA 5EYPA 3BA8A 4U3FH 4PELA 2VRZA 3P3NA 4WBNB 1IVSA 3OTFA 4TSFG 1NH2B 4TUYB 2UXDO 4F6RB 5FNVA 1B06A 2GTAA 1XREA 2CGNA 2X6BA 1B3QA 2QWQB 5LXTB 3K03A 4B3MB 4LF6O 3CRAA 5KHKA 3ABUA 3CMEV 2DE0X 4RQEA 4LR3A 2IH1C 2QM8A 1CXZB 2ADPA 3N2GA 2HEPA 2X7RB 2ZINA 1HNWB 1SQFA 4YHHO 3GVMA 1F23A 3HR0A 3ZJZA 1SETA 3N2KA 3CHXA 1Q3EA 3E86A 2F93B 4CZZA 3DXRB 2QGNA 3JASB 4JYAB 5IYZB 1VQ4V 1JX9A 4JI2B 1EZJA 4L87A 3RYFA 2IJIA 4Q20A 4X1IA 1R6KA 5JH7A 2JEXA 2DYSB 2KQXA 2YEVB 2HR3A 1M5IA 3KCXA 3D3IA 1URFA 3O65A 4X1YA 5KUMA 2ADQB 3K0GA 4W4KA 1M9NA 4UCSA 5DN6G 3E83A 5JVDB 5IYDO 3DGEA 2EX3A 3RVYA 5LHHA 1FXKA 5LHIA 4UB8Z 4JAUA 4UVBA 5EK0A 4PA9A 4AQYB 1NR1A 4NTXA 2AGAA 2EILC 3WG7C 4ZI7B 3J81N 4O4JB 1W0KG 5LHGA 1QQCA 4U3JB 1NZ6A 4AILC 1QR8A 2VS0A 3OW2U 4YIOA 4LFCB 3CCEV 3E22B 4GCZA 1H2NA 4LFBO 5BMVB 4TV8A 4DR6O 4QPKA 4MVSA 3K0DA 2EIKC 1FXHA 4B3MO 4DUYO 5JQGA 1P49A 5LOVA 1BMFG 3K5LA 3FB5C 1UFIA 3VQWA 4DV1O 4KXRA 5D5PA 3ABLB 4A5UB 1K34A 5JWPA 4NB5A 3ZMVA 1J5EB 2IW5A 3ABKB 4KP4A 1JA8A 1ORQC 2CK3G 3HKCA 3ZRWA 3GB7C 3U10A 1FXVA 2UXCB 3SJBC 4WFBV 1KC8W 1AJPA 4CH3A 1KMIZ 2N04A 1OCRC 5JJJB 3EFFK 4X8AA 3M7MX 4TUYA 2LO1A 1QLEC 2QM7A 1VP7A 3KG2A 1GK9A 4DR3B 4JV5O 3AG3B 1VQMV 3OT7A 1N8RW 3FKSG 3M8AA 2ZDIC 1YITV 1VARA 3OM3B 4TV9A 5KA6A 2A79B 5LL6Y 2XAHA 3BVOA 4LWSB 4DYLA 4NR1A 4MVRA 4IHJA 2YUAA 1KP2A 3K08A 3SJQC 3MD0A 3OE7G 4B3SO 1AI7A 1W2BU 3B77A 3RT3C 4JI0B 3DXRA 1OCCC 1LUWA 1HNXO 1D5AA 2YIBA 2YSUB 5IYZA 3FB6C 4JPRA 3LDCA 3SGIA 3FFQA 3QO8A 5DECA 4W4LA 5JJEB 1YTFD 4K8XA 1U97A 3FB8C 4DR7O 1GO3F 2QEXV 4Q6GA 2ZE7A 4JAVA 2HKOA 1IXMA 1Y74B 2KB1A 2HFEC 4OGQB 1IDSA 5L3EA 2V7QG 2ILMA 2ZIMA 3JAWA 4BW9A 4BR6A 1GTOA 2CGOA 3LSSA 4RAIA 1OZ0A 3GWOA 4DV7B 4DV3O 2ZXWC 2IJHA 2JJ1G 2OCCB 5KHHA 2R9IA 3D3QA 5IJ0B 4I7ZB 2P22C 1WB7A 5EBMC 4PA7A 3APQA 1Y76B 4HNAB 4P30A 5L3CA 1ROPA 3P3PA 5KHGA 1HWYA 4FK5C 3E8GA 5LA6A 2EJ7A 4K8ZA 1SQXH 1FOUA 3QNEA 2XAQA 4WFGA 1BZKA 4B7EA 4JI1B 2WAMA 4LCUC 2A0LA 3QO7A 1J95A 4I50A 4O2AA 2GV9A 1XDCA 2NLJC 2DQ3A 1Q6UA 1X4TA 4YJ3A 1US6A 2E74B 4PD4F 1PNMA 3ZRSA 4R8CA 4X65B 2XHBA 2K1EA 3H1JH 3OTOB 5ITZA 3W7WA 5HFMA 2H3OA 4PJ0Z 3CB2A 4JI0O 3MDSA 3PJSK 2EINC 1TGOA 4RWUA 2Q8VA 4QE7A 3CCVV 2QTSA 1FKAO 1EN5A 2WSSG 3G4SV 5IJ9B 3T1YB 5CA0A 4DXWA 1SERA 1BHBA 3SJCC 4YIPA 1YI2V 1N32B 2BOBC 2BTQB 4DV2O 1V9PA 3CS5A 5LGUA 4LF8B 3E8HA 1P7BA 1VF5B 1UJWB 2R70A 3ZIAG 2P90A 4UXNA 1WP7A 2V4DA 1R73A 4GX2A 5A2QN 5B1AB 1VQ8V 3APOA 1RM1C 1KB9F 1SQPH 5BR8B 1NBMG 3RYHB 4UCUA 4LF7O 4NYKA 2QWPB 4DV5B 4YJ2B 1JMKC 2XUMA 5KX5A 4X66O 2BCCH 1K4CC 3TK1A 1JOYA 5IDJA 2WA4A 1CP9A 1YSCA 1M56B 4O4IB 2UUBB 5TISZ 3BFRA 5K1XA 3HKEA 4YXWG 3CYOA 2ZNJA 4B3RO 3TCUA 2CUGA 4JI1O 3JARA 3AG1B 5DM6V 5J9PC 1HDJA 2XNDG 1L1FA 2XAFA 5EYPB
chains in the Genus database with same CATH topology
1VARA 4FFKA 3AK1A 1EN4A 1EM1A 1D5NA 4JZGA 1AR4A 1LUWA 3MDSA 1MA1A 3DC6A 1KKCA 4YIOA 3LSUA 1WB8A 2RCVA 3DC5A 1AP5A 1EN5A 3EVKA 2AW9A 3IC9A 1GN2A 2CE4A 4GUNA 1GN6A 1MSDA 4C7UA 2QKAA 1BSMA 3TJTA 3AK3A 4YIPA 4F6EA 1B06A 1XREA 3AK2A 1SZXA 2QKCA 1ZTEA 1IX9A 1ZLZA 4JZ2A 3CEIA 1PL4A 1BT8A 4X9QA 1IDSA 1I08A 1I0HA 1P7GA 2ADPA 1MMMA 2P4KA 1IXBA 1N0JA 1AVMA 1LUVA 4BR6A 3KKYA 1XUQA 1N0NA 1XILA 1Y67A 3KDRA 1PM9A 1GN3A 1JA8A 5A9GA 1BS3A 1QNMA 3C3SA 1MNGA 1ZSPA 1JR9A 4E4EA 3RN4A 1WB7A 3QVNA 1VEWA 1ZUQA 3C3TA 1AP6A 2GDSA 3BFRA 4JYYA 3K9SA 5AG2A 2ADQB 1AR5A 1GN4A 3OT7A 1EN6A 1XDCA 2CDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAR A;  4FFK A;  3AK1 A;  1EN4 A;  1EM1 A;  1D5N A;  4JZG A;  1AR4 A;  1LUW A;  3MDS A;  1MA1 A;  3DC6 A;  1KKC A;  4YIO A;  3LSU A;  1WB8 A;  2RCV A;  3DC5 A;  1AP5 A;  1EN5 A;  3EVK A;  2AW9 A;  3IC9 A;  1GN2 A;  2CE4 A;  4GUN A;  1GN6 A;  1MSD A;  4C7U A;  2QKA A;  1BSM A;  3TJT A;  3AK3 A;  4YIP A;  4F6E A;  1B06 A;  1XRE A;  3AK2 A;  1SZX A;  2QKC A;  1ZTE A;  1IX9 A;  1ZLZ A;  4JZ2 A;  3CEI A;  1PL4 A;  1BT8 A;  4X9Q A;  1IDS A;  1I08 A;  1I0H A;  1P7G A;  2ADP A;  1MMM A;  2P4K A;  1IXB A;  1N0J A;  1AVM A;  1LUV A;  4BR6 A;  3KKY A;  1XUQ A;  1N0N A;  1XIL A;  1Y67 A;  1PM9 A;  1GN3 A;  1JA8 A;  5A9G A;  1BS3 A;  1QNM A;  3C3S A;  1MNG A;  1ZSP A;  1JR9 A;  4E4E A;  3RN4 A;  1WB7 A;  3QVN A;  1VEW A;  1ZUQ A;  3C3T A;  1AP6 A;  2GDS A;  3BFR A;  4JYY A;  3K9S A;  5AG2 A;  2ADQ B;  1AR5 A;  1GN4 A;  3OT7 A;  1EN6 A;  1XDC A;  2CDY A; 
#chains in the Genus database with same CATH topology
 5B3S B;  2AZ2 A;  3AG4 B;  4H37 A;  3L9D A;  1JVM A;  3JYC A;  1XMQ B;  5EZY A;  3OTO O;  5FNV B;  2CTW A;  5B66 Z;  2Q7H A;  1AR4 A;  1I5Y A;  3HKD A;  3IAY A;  3ASN B;  2ARH A;  2RCV A;  2NR5 A;  2ZDI A;  1HP8 A;  3N2G B;  4CH5 A;  3WB1 A;  4FLX A;  4HNA A;  1GN6 A;  1CPY A;  1H8H G;  1FYJ A;  5LP6 C;  1I5X A;  1V55 C;  1N32 O;  3N2K B;  5GTI Z;  4J10 A;  4JYC A;  1OV9 A;  3IC7 A;  3OUF A;  4BAY A;  1BT8 A;  3JCU Z;  1JJ2 U;  3UO2 A;  4N23 A;  5B1B B;  1HR0 O;  3OR7 C;  3FYE B;  1VQ9 V;  3RYF B;  2FB5 A;  2L35 A;  4X1I B;  5JH7 B;  1RP3 B;  3SPH A;  3T4D A;  1WLE A;  1M90 W;  2Q9L A;  2EIM B;  2ZE6 A;  2UXD B;  2ZQM A;  2WLM A;  3OD4 A;  1N4C A;  1FS0 G;  1BS3 A;  4X1Y B;  2W0F C;  2VQF B;  1M57 C;  4UUJ C;  2MW2 B;  4FMT A;  3C90 A;  4UCV A;  3L73 H;  1DF5 A;  1S72 V;  3ZMS A;  3SPJ A;  5C8Y A;  3K79 A;  1BQ0 A;  1FXK B;  1ZL8 A;  1H2L A;  2Q67 A;  1AJQ A;  1NI8 A;  2A7W A;  4MTG A;  3ZBH A;  1R3J C;  1WA8 A;  2R9R B;  3H9V A;  1N36 O;  1K7D A;  2QA4 V;  5LMN O;  1NVP B;  5LGT A;  2Z5U A;  3MHH C;  1AI6 A;  3BAA A;  1K97 A;  1GN4 A;  3SR2 C;  1XL6 A;  3G6E V;  1X59 A;  3LNM B;  2UXB B;  3UO3 A;  2CH7 A;  4IYH A;  4ICG A;  1XNQ O;  4TV8 B;  3AG7 A;  3ZHQ A;  4LH6 A;  5J2T A;  5KUK A;  3CE2 A;  4DR2 O;  2KSD A;  4MVZ A;  3WB0 A;  2Q69 A;  5JQG B;  2F1M A;  2YID A;  5LOV B;  1AR1 B;  5BY1 A;  3ML0 A;  1NTZ H;  3CSX A;  3ZCC A;  3VBB A;  4WFA V;  1V54 B;  3AG2 B;  3JD2 A;  1QVF U;  3KZI Z;  1AI5 A;  3EVK A;  3QO5 A;  1XL4 A;  1LR1 A;  1H2K A;  2Y69 B;  1R3L C;  3K5O A;  1WPX A;  3U0Z A;  5KLV H;  3HKC B;  3ZRW B;  3K5N A;  4TWK A;  2ZKO A;  1RSO A;  4I9W A;  1AI4 A;  1I08 A;  1P7G A;  2ZE5 A;  4CC6 A;  4K0K O;  3J80 N;  1QU7 A;  1MZE A;  1ZX3 A;  2IJK A;  4LFB B;  4DR6 B;  1SQQ H;  2PUS A;  4MTO A;  1L8D A;  3TXS A;  1N0N A;  1WN7 A;  1MG1 A;  2PYL A;  4DUY B;  1XHX A;  4X20 A;  2VQF O;  4RUE A;  1D2D A;  1JR9 A;  1BE3 H;  3P32 A;  3H1K H;  4AI8 A;  4DV1 B;  3UKM A;  1VF6 C;  4TV9 B;  4AHC A;  1XNR O;  5J2U A;  3HKB A;  4E2L A;  2GHY A;  4IHJ B;  5LGN A;  1H5W A;  1SKV A;  4DV4 O;  4FZ0 A;  3WFV A;  1PKX A;  3A0R A;  4PI2 A;  4DV0 O;  3A0B Z;  3P30 A;  1XI1 A;  1Y6X A;  2L6L A;  5LMU O;  1Q43 A;  5CBG A;  4FFK A;  2UXB O;  4IGG A;  4BW5 A;  2EZP A;  1EM1 A;  2Y48 A;  4J11 A;  4G28 B;  4I5S A;  2IU0 A;  2E75 B;  1BHA A;  2GBO A;  4UFZ A;  3B8M A;  4LP8 A;  3RYI A;  1EBO A;  2XTA A;  4JZG A;  5B1O A;  4JV5 B;  5CA1 A;  2XAS A;  3CXH F;  1KU9 A;  4X64 B;  4JI8 O;  1KKC A;  3LSU A;  4P9P A;  2UU9 O;  2AW9 A;  3JAW B;  1H38 A;  4PA4 A;  4IYI A;  3K9A A;  4I0X A;  4QNH B;  4C7U A;  3CP1 A;  3T1H O;  1O9G A;  2P6J A;  1HW7 A;  1R1B A;  3ABK C;  4B3S B;  1S0V A;  4XDJ A;  3ETD A;  2BTO A;  1YIJ V;  4IIJ A;  2JIZ G;  1ZLZ A;  2HP8 A;  4O4H A;  5E79 Z;  1RPR A;  1HNX B;  1HNZ O;  1IBM O;  2Z0A A;  3LDE A;  1PNL A;  4NXM B;  1IXB A;  1SS3 A;  2IJJ A;  5IYB O;  4H33 A;  4PHZ A;  1MAB G;  4DR7 B;  5LA6 B;  1M4U A;  1WNS A;  5A9G A;  2IH3 C;  2A3Q A;  1SRY A;  3CCU V;  2PI4 A;  2MK3 A;  4O2A B;  2GUZ A;  1OCO B;  4I50 B;  1NJI W;  3QVN A;  1KEC A;  4YJ3 B;  1VEW A;  2BE3 A;  2HVK C;  3CCJ V;  3JAM N;  3ZHT A;  4WFH A;  3FD9 A;  5ITZ B;  4N21 A;  4DV3 B;  3JD4 A;  4LF5 O;  2OIE A;  4F4L A;  3ETQ A;  3K04 A;  2WLL A;  1Y4M A;  1KD1 W;  2W6I G;  2LW1 A;  5JJN B;  3D36 A;  5CA0 B;  5GW7 A;  2JRI A;  1BCC H;  2HJF C;  4LF4 O;  3CCL V;  1K73 W;  3ABM B;  3UT5 A;  3OEH G;  4JI6 B;  1D5N A;  1GKF A;  1VQ6 V;  2UXX A;  3SJA C;  2EJR A;  2QWO B;  4LFA O;  3ETG A;  4X64 O;  2JGU A;  3ZRV A;  4LF9 B;  4ZHQ A;  5FL7 G;  1VQL V;  3RGB A;  3R66 A;  1S5J A;  2P4V A;  2YIA A;  4D7S A;  4EKW A;  2EIJ B;  3MAQ A;  3AK2 A;  1SZX A;  2OCH A;  1ZTE A;  1EFR G;  4YY3 O;  4QE9 A;  2JGD A;  5GON A;  4JI7 B;  2OCC C;  1FFX A;  4NXM O;  5KX5 B;  3RFR A;  2WPD G;  1JQ0 A;  1YCI A;  1PNK A;  4JTD B;  3L75 H;  1XIL A;  4ASU G;  1YJN V;  4JI3 O;  4PDM A;  3HKE B;  3STZ C;  2DYR C;  2QSA A;  4OPH A;  4DV2 B;  1ZSP A;  2D2C B;  3MHS C;  3JAR B;  2ZM6 O;  4FLT A;  2PYJ A;  1TUE B;  4E4E A;  1QVG U;  1R6T A;  1COW G;  2PZS A;  1EZV H;  3SYP A;  3JD1 A;  3CRR A;  1JFF A;  1VQK V;  3FB7 C;  1K9M W;  5EZY B;  4B3T O;  1MZF A;  2ETN A;  3RYC A;  1SA0 A;  3CJH A;  3K9S A;  3H1I H;  3SPI A;  3HKD B;  4LF7 B;  2N74 A;  3IFX A;  1Z5W A;  1SQG A;  3ZN0 A;  4UCO A;  4X66 B;  1VF6 A;  3D8C A;  4DV6 O;  2EUL A;  4EB6 A;  3SDL A;  4U7N A;  2UXN A;  1EN4 A;  2W0X A;  4TQD A;  3BY6 A;  5KAI Z;  3CCR V;  1XMO O;  1I94 B;  4JI6 O;  1PD3 A;  4B3R B;  4FM0 A;  1ZAU A;  3G67 A;  2OTL V;  2NNU A;  3CXC U;  3G6B A;  1FFT B;  3OEE G;  2W6J G;  3DC5 A;  5EC1 C;  5EIB D;  4CS3 A;  4LF9 O;  1S77 D;  3IC9 A;  1JPX A;  2ZCE A;  4GUN A;  1VQO V;  4ABM A;  3OFN G;  5B1A C;  4G27 B;  3VQY A;  3JD3 A;  3H1L H;  3I55 V;  2QDO A;  2BSK A;  3TGU H;  3F7Y C;  1K4D C;  1TVK B;  3ASO B;  1OCZ C;  5DED A;  4JI7 O;  3ZHS A;  4GX1 A;  3Q4H A;  1N34 O;  4Z1M G;  1MMM A;  4DR5 O;  1AVM A;  1O9H A;  5C8Y B;  3K58 A;  2KKW A;  4WFF A;  3EXA A;  2E5L O;  2WA3 A;  3L74 H;  3S3X A;  1ZL8 B;  1M56 C;  1OJH A;  1ENV A;  1GN3 A;  4MT8 A;  1WA8 B;  2VWK A;  2FYU H;  4ZKI A;  3JAT A;  3E89 A;  5KHJ A;  3AG1 C;  4P9O A;  3M99 B;  1N33 B;  1T5E A;  2VQE O;  1YDX A;  1HR0 B;  5B3S C;  3AG4 C;  2RQ6 A;  2CH7 B;  5IE9 A;  1H8E G;  3EHB B;  5J2T B;  2YI9 A;  1AJN A;  4UVC A;  1W59 A;  1NVP D;  1TA8 A;  2LQT A;  3KCY A;  3BPZ A;  3ASN C;  4MS2 A;  3BA9 A;  4H13 B;  3A2F A;  4PI0 A;  5EIB C;  2RNB A;  3JSN A;  4UV8 A;  3DTU B;  5IWA O;  2OWO A;  4DK1 A;  4I55 A;  1I94 O;  3IGA C;  3L71 H;  1N36 B;  3JD0 A;  5LMN B;  2OYQ A;  5C93 A;  4FPP A;  1MA1 A;  2R72 A;  3ZS8 C;  1RSO B;  2JJ2 G;  4K3A A;  5B1B C;  4HYO A;  2XAG A;  2A06 H;  1S5H C;  4J9Y B;  1MSD A;  4NXN O;  4I4T A;  1XNQ B;  4KUM A;  2EIM C;  2Q4P A;  2UUC B;  1JNB A;  2X6C A;  5CB4 A;  4DR2 B;  3SYO A;  4X20 B;  3OMI B;  5CA3 A;  4NTY A;  3BEH A;  1WPB A;  2QTO A;  4DRX B;  2K9P A;  3ETE A;  1FXK C;  3RWR D;  3F5W C;  5J2U B;  3HKB B;  1NH2 D;  1L0L H;  3OGI B;  1F7Y A;  1Y67 A;  3KDR A;  1XOU A;  4QIW F;  5EBW C;  2UUA B;  2H94 A;  3W7S A;  1K8A W;  2QJ1 A;  3ZMZ A;  1N33 O;  1R3I C;  4KFM A;  5BZB A;  2HHH O;  4K0K B;  1UPG A;  1E79 G;  5IY5 B;  4O2B A;  3CX5 F;  4LC1 A;  1LNQ A;  4RUF A;  2Q5Z A;  4GYC B;  3RYI B;  3VOU A;  1TVK A;  3ZED A;  2KG7 A;  2LP7 A;  1YZB A;  2YIB D;  4MVO A;  1AR5 A;  1NR7 A;  4IT5 A;  3FYI B;  1Q7Y W;  5CA1 B;  4JYB A;  2O57 A;  1V54 C;  2PGG A;  2XAJ A;  1Q5O A;  1H2G A;  4DO2 A;  1E1Q G;  4XDK A;  1U96 A;  1XNR B;  4I0X B;  1FD9 A;  4BIO A;  1SF9 A;  1Q6I A;  3G80 A;  3HB3 B;  2WLH A;  3RVZ A;  3RW0 A;  3X2Q B;  1Q8I A;  4IIJ B;  4DV4 B;  3WU2 Z;  2ZR3 A;  4O4H B;  4DV0 B;  2DQ0 A;  1YEW A;  2Q68 A;  2RDC A;  5LMU B;  1I7F A;  2YS8 A;  3K5M A;  2JK5 C;  1NU1 H;  1VQN V;  2QR4 A;  4KL1 A;  1SZT A;  2UUC O;  5F2V O;  5KA5 A;  4DR4 O;  5FPR A;  3ZMT A;  1TAE A;  2BOC C;  4DR1 O;  2Q0A A;  4DUZ O;  2P7T C;  4H44 B;  4J7Z A;  4P2Z A;  4JI8 B;  1R3K C;  2GUZ B;  1H2S B;  1N0J A;  5BXZ A;  2ZD9 A;  1YF2 A;  3W7X A;  1B6Q A;  2UU9 B;  2ATK C;  3ZRX A;  2PF4 E;  1F4N A;  3T1H B;  3CMA V;  1PM9 A;  2YXY A;  3UCS C;  2UUA O;  2X0L A;  1QNM A;  2F95 B;  3C3S A;  1M57 B;  1KP3 A;  1HNZ B;  1IBM B;  3K3W A;  1NTM H;  1TUB A;  2FKX A;  1M93 A;  2PY5 A;  3RN4 A;  2WLL B;  2ZNI A;  4O4L A;  2DYS C;  3UT5 B;  4X62 O;  1IJG A;  3GWK C;  4CC5 A;  1KKD A;  5AG2 A;  1JCH A;  4J7K A;  1PL0 A;  2Z3Y A;  4UB6 Z;  1EN6 A;  2FL4 A;  2XOK G;  1VQ7 V;  4GZR B;  4ZHQ B;  4DRX A;  3N27 A;  2AZ0 A;  1Q86 W;  4GKK B;  2ITC C;  4X89 A;  4ZBM A;  2ITD C;  3CC4 V;  5E1A C;  4MVU A;  4ZOL A;  2Q7E A;  4JAA A;  4I9Q A;  2JGD B;  3LSQ A;  5GON B;  4LF5 B;  2F4V O;  1FFX B;  1IBL O;  1WB8 A;  1AP5 A;  2FTK A;  4B08 A;  5LYJ A;  2CE4 A;  5CMU A;  1G4Y B;  1VMG A;  3TJT A;  1BSM A;  1YJ9 V;  4JI5 O;  4LF4 B;  5CN0 A;  1H2M A;  1Q90 D;  1XBL A;  1VQ5 V;  2B9Z A;  4L8J A;  4JZ2 A;  3CEI A;  4CS2 A;  5IT9 N;  1PL4 A;  2DWD C;  4IL6 Z;  4QJF B;  4OX9 O;  4FFB A;  4LFA B;  4OXS A;  1FAF A;  1OCO C;  4KHP O;  3ABL C;  3PN1 A;  4GT1 A;  1LUV A;  3CRC A;  1JFF B;  1QHT A;  2CTR A;  5KMG A;  1DK1 A;  5L3F A;  3A8T A;  3JCZ A;  2CTP A;  4FLZ A;  3OMA B;  3RYC B;  1KUQ A;  1SA0 B;  3CJH B;  2GTS A;  1SC5 B;  4YY3 B;  3STL C;  3VQV A;  4D7T A;  3K59 A;  2Y4T A;  1MNG A;  1P4R A;  3I56 V;  4PV1 B;  4FLU A;  2WLI A;  3BAB A;  4FM1 A;  3L70 H;  3SPC A;  1M1K W;  2QM4 A;  4CS4 A;  4EB6 B;  4J9Z B;  1FJG O;  2DJV A;  3IJ4 A;  1G1X B;  5LP6 A;  3ABM C;  2H8P C;  4GX0 A;  4TOI A;  1K3E A;  2JDI G;  4PDL A;  4JYY A;  4JI3 B;  2YI8 A;  4X88 A;  4FM2 A;  2ZT9 B;  3CD6 V;  1VQP V;  1NTK H;  3OAA G;  3AG3 C;  5H9C A;  5HFL A;  2LW7 A;  2ZM6 B;  1THZ A;  4X1K A;  2YIC A;  1MSW D;  1GM7 A;  4J41 A;  4GKK O;  2EIJ C;  4B3T B;  4Z1V A;  2G38 A;  4OPA A;  2BSK B;  5H2F Z;  4CH4 A;  2Y4U A;  3THO A;  3Q4H B;  2V1D A;  1AB3 A;  5FPO A;  2CAZ C;  2OIG A;  4DV6 B;  4BIU A;  1KBH A;  4BWA A;  1HNW O;  1DTO A;  3JAK A;  3AK3 A;  1Y66 A;  4D6T H;  1Q81 W;  4FJC C;  2EIL B;  2Q6A A;  3WG7 B;  2X6A A;  2P5O A;  1XMO B;  4UVA A;  4LNU A;  1IX9 A;  3SYQ A;  3B4S A;  2PTM A;  3ZMU A;  4JYA O;  3JAT B;  3SYA A;  4JI2 O;  2FML A;  4WBN A;  3T4Z A;  3KKY A;  2R9A A;  2F66 C;  3A0H Z;  4F6R A;  1SQV H;  2F23 A;  2DWE C;  5LXT A;  2EIK B;  1L0N H;  3E2E A;  2LFR A;  2RN9 A;  2E76 B;  1N34 B;  3H01 A;  1DGS A;  2LGQ A;  3SPG A;  1P84 F;  4U7O A;  4DR5 B;  2WWW A;  4NVP A;  4HBN A;  3FAV B;  2E5L B;  3E35 A;  4XBF A;  4AQY O;  4G2K A;  1VIB A;  1VF7 A;  4TQF A;  4I55 B;  1AP6 A;  1PPJ H;  1A32 A;  3B8N A;  3K06 A;  3JAS A;  2M7W A;  3B40 A;  2P67 A;  4LFC O;  2VQE B;  1B04 A;  2QWR B;  3WB2 A;  1OCR B;  4JI4 B;  4R50 A;  2F43 G;  1SES A;  3TXQ A;  4I4T B;  3UM7 A;  2YEV A;  5KAF Z;  3JSL A;  2JS5 A;  4PA3 A;  2M6Y A;  4MVM A;  1QLE B;  1NQT A;  3ASO C;  1IUR A;  1NKD A;  5CB4 B;  3R65 A;  1W0J G;  5D5Q A;  4UCT A;  2YXL A;  4K35 A;  2HLD G;  5JVD A;  4FIP C;  2HVJ C;  4NTW A;  3OMN B;  1YHQ V;  4R6Z A;  2DN9 A;  1XHZ A;  4MTX A;  4CBC A;  3BHP A;  2JEU A;  2EBO A;  4HZ3 A;  3T2M A;  3AEI A;  2QKA A;  5IWA B;  1J5E O;  4ZI7 A;  2E3C A;  2Q73 A;  3ABT A;  4O4J A;  1ZWI C;  4EFB A;  2WLK A;  4U3J A;  2UXC O;  1OCC B;  4B7K A;  4PA6 A;  3U11 A;  1NT2 B;  4X9Q A;  3F7V C;  4XDL A;  1WP8 A;  2DW4 A;  2Q0O C;  4MW8 A;  3E22 A;  5BMV A;  4NXN B;  4O2B B;  3CCS V;  4Z2W A;  3JAL B;  1QR9 A;  3G71 V;  2YDE A;  1BGY H;  2KG7 B;  3FX7 A;  2DYR B;  5EC2 C;  1MOF A;  2WLN A;  4DR3 O;  4ZIB A;  4HAM A;  1K5Q A;  2WLJ A;  4EFE A;  1R6N A;  2OT5 A;  1YJW V;  1GM9 A;  4FLV A;  2OTJ V;  1JJO A;  2RJZ A;  1ARO P;  2VWJ A;  1ZUQ A;  2HG5 C;  3J7A U;  1OHH G;  3OGC C;  2ZXW B;  2B1I A;  4J7J A;  5JCO C;  4TT3 G;  4WF9 V;  5B1N A;  4MTF A;  4MVQ A;  2HHH B;  4JI4 O;  2RMK B;  1QBZ A;  5L3B A;  1NS1 A;  1PV0 A;  1Z2G A;  1K92 A;  1GH6 A;  2ZIO A;  2DOS A;  2C2A A;  3DC6 A;  4J42 A;  1YVW A;  4JAS A;  4LWS A;  1DLB A;  3TET A;  1DF4 A;  3E8B A;  3FAV A;  3O9O A;  4WFE A;  4LH7 A;  1QLN A;  3CRQ A;  3CCQ V;  1YTF B;  3I5D A;  3LUT B;  5KHI A;  4F6E A;  3F5T A;  3RBZ A;  4DV7 O;  5IYC O;  5FLX N;  1OCZ B;  2XT9 A;  4DW0 A;  1IBK B;  2NN4 A;  3CC7 V;  4H0L B;  2EIN B;  1Z5V A;  1TUB B;  5H6R A;  2B1G A;  2HJD A;  5EBL C;  5H6Q A;  3QTC A;  2ZE8 A;  4UV9 A;  4O4L B;  4LBE C;  4PDV A;  1XQ8 A;  5IY5 C;  2LFS A;  3B09 A;  1XUQ A;  2QKS A;  2IM9 A;  4DR4 B;  3NXS A;  4DR1 B;  5B5E Z;  2Y0P A;  3NR7 A;  1Y74 A;  1Q6H A;  4DUZ B;  2CTQ A;  1SQB H;  4DK0 A;  1S76 D;  2GSM B;  3ZHU A;  5K1P A;  1GRJ A;  3BCC H;  4X65 O;  2YXH A;  4GKJ B;  3L72 H;  2B5U A;  4JF3 A;  4ZOL B;  1F51 A;  3E8F A;  3W7U A;  3C3T A;  1RFY A;  2GDS A;  1E1R G;  3X2Q C;  1BQZ A;  1RM1 B;  4FVM A;  2QE7 G;  2JS3 A;  2LGW A;  3W7T A;  4GLX A;  1GAX A;  2Q7G A;  1XEQ A;  5IJ0 A;  1K5S A;  2CDY A;  3UQ8 A;  3T1Y O;  1Y76 A;  5LYJ B;  3CRM A;  4JTC B;  2DMX A;  4QGP A;  3JAL A;  2EZO A;  5L3G A;  4X62 B;  2P06 A;  3T1C A;  4FLW A;  4LF8 O;  3CPW U;  4FFB B;  5GTH Z;  2A9H A;  3AG2 C;  2ZR2 A;  2JVD A;  1FPO A;  1Q82 W;  1GN2 A;  5KMG B;  1QCE A;  1YXB A;  4BIZ A;  2Y69 C;  5H5N A;  4EEQ A;  2IU3 A;  2QKC A;  4LF6 B;  5BR8 O;  2LJ2 A;  1IBK O;  2ODM A;  1G6U A;  3ZX6 A;  5CBF A;  3H1H H;  1S5L Z;  5CBH A;  4DV5 O;  2F4V B;  3B2E E;  1I0H A;  2WLI B;  1PP9 H;  1IBL B;  2P4K A;  2AXT Z;  5IJ9 A;  2AHY A;  2PI5 A;  3D36 C;  3VQX A;  4JGS A;  2IBZ H;  4YHH B;  4MSW C;  3QG5 A;  1IZ3 A;  4UCR A;  1RPO A;  2QWN B;  4JI5 B;  5LP6 B;  2UUB O;  1V55 B;  2Y0I A;  3OUS A;  4FLY A;  3CWB H;  4DW1 A;  2BTQ A;  3HPL C;  4WCE V;  1WAZ A;  3QF7 A;  1K33 A;  4OX9 B;  4QPJ A;  4KHP B;  1S3J A;  4GX5 A;  1WJZ A;  4J80 A;  2N05 A;  1GMG A;  4X1K B;  1GM8 A;  1XMQ O;  4CH6 A;  4RO2 A;  4GKJ O;  4PDR A;  1KQS U;  3BRC A;  3OR6 C;  3ZHR A;  4R7C A;  3RYH A;  1CEZ A;  1F4M A;  4YJ2 A;  2D3O W;  3LNN A;  3SYC A;  1BL8 A;  4FZ1 A;  1FJG B;  3AK1 A;  5LBQ A;  3JAK B;  4O4I A;  3CC2 V;  4MW3 A;  1G8M A;  3K57 A;  3DSQ A;  4RQF A;  4LNU B;  3CCM V;  5JCO A;  3ZN1 A;  3LDD A;  1KYO F;  2AHZ A;  3ICX A;  5L3D A;  3S3W A;  1AIL A;  4JTA B;  4NKG B;  2YC0 A;  3ZHV A;  5EYP A;  3BA8 A;  4U3F H;  4PEL A;  2VRZ A;  3P3N A;  4WBN B;  1IVS A;  3OTF A;  4TSF G;  1NH2 B;  4TUY B;  2UXD O;  4F6R B;  5FNV A;  1B06 A;  2GTA A;  1XRE A;  2CGN A;  2X6B A;  1B3Q A;  2QWQ B;  5LXT B;  3K03 A;  4B3M B;  4LF6 O;  3CRA A;  5KHK A;  3ABU A;  3CME V;  2DE0 X;  4RQE A;  4LR3 A;  2IH1 C;  2QM8 A;  1CXZ B;  2ADP A;  3N2G A;  2HEP A;  2X7R B;  2ZIN A;  1HNW B;  1SQF A;  4YHH O;  3GVM A;  1F23 A;  3HR0 A;  3ZJZ A;  1SET A;  3N2K A;  3CHX A;  1Q3E A;  3E86 A;  2F93 B;  4CZZ A;  3DXR B;  2QGN A;  3JAS B;  4JYA B;  5IYZ B;  1VQ4 V;  1JX9 A;  4JI2 B;  1EZJ A;  4L87 A;  3RYF A;  2IJI A;  4Q20 A;  4X1I A;  1R6K A;  5JH7 A;  2JEX A;  2DYS B;  2KQX A;  2YEV B;  2HR3 A;  1M5I A;  3KCX A;  3D3I A;  1URF A;  3O65 A;  4X1Y A;  5KUM A;  2ADQ B;  3K0G A;  4W4K A;  1M9N A;  4UCS A;  5DN6 G;  3E83 A;  5JVD B;  5IYD O;  3DGE A;  2EX3 A;  3RVY A;  5LHH A;  1FXK A;  5LHI A;  4UB8 Z;  4JAU A;  4UVB A;  5EK0 A;  4PA9 A;  4AQY B;  1NR1 A;  4NTX A;  2AGA A;  2EIL C;  3WG7 C;  4ZI7 B;  3J81 N;  4O4J B;  1W0K G;  5LHG A;  1QQC A;  4U3J B;  1NZ6 A;  4AIL C;  1QR8 A;  2VS0 A;  3OW2 U;  4YIO A;  4LFC B;  3CCE V;  3E22 B;  4GCZ A;  1H2N A;  4LFB O;  5BMV B;  4TV8 A;  4DR6 O;  4QPK A;  4MVS A;  3K0D A;  2EIK C;  1FXH A;  4B3M O;  4DUY O;  5JQG A;  1P49 A;  5LOV A;  1BMF G;  3K5L A;  3FB5 C;  1UFI A;  3VQW A;  4DV1 O;  4KXR A;  5D5P A;  3ABL B;  4A5U B;  1K34 A;  5JWP A;  4NB5 A;  3ZMV A;  1J5E B;  2IW5 A;  3ABK B;  4KP4 A;  1JA8 A;  1ORQ C;  2CK3 G;  3HKC A;  3ZRW A;  3GB7 C;  3U10 A;  1FXV A;  2UXC B;  3SJB C;  4WFB V;  1KC8 W;  1AJP A;  4CH3 A;  1KMI Z;  2N04 A;  1OCR C;  5JJJ B;  3EFF K;  4X8A A;  3M7M X;  4TUY A;  2LO1 A;  1QLE C;  2QM7 A;  1VP7 A;  3KG2 A;  1GK9 A;  4DR3 B;  4JV5 O;  3AG3 B;  1VQM V;  3OT7 A;  1N8R W;  3FKS G;  3M8A A;  2ZDI C;  1YIT V;  1VAR A;  3OM3 B;  4TV9 A;  5KA6 A;  2A79 B;  5LL6 Y;  2XAH A;  3BVO A;  4LWS B;  4DYL A;  4NR1 A;  4MVR A;  4IHJ A;  2YUA A;  1KP2 A;  3K08 A;  3SJQ C;  3MD0 A;  3OE7 G;  4B3S O;  1AI7 A;  1W2B U;  3B77 A;  3RT3 C;  4JI0 B;  3DXR A;  1OCC C;  1LUW A;  1HNX O;  1D5A A;  2YIB A;  2YSU B;  5IYZ A;  3FB6 C;  4JPR A;  3LDC A;  3SGI A;  3FFQ A;  3QO8 A;  5DEC A;  4W4L A;  5JJE B;  1YTF D;  4K8X A;  1U97 A;  3FB8 C;  4DR7 O;  1GO3 F;  2QEX V;  4Q6G A;  2ZE7 A;  4JAV A;  2HKO A;  1IXM A;  1Y74 B;  2KB1 A;  2HFE C;  4OGQ B;  1IDS A;  5L3E A;  2V7Q G;  2ILM A;  2ZIM A;  3JAW A;  4BW9 A;  4BR6 A;  1GTO A;  2CGO A;  3LSS A;  4RAI A;  1OZ0 A;  3GWO A;  4DV7 B;  4DV3 O;  2ZXW C;  2IJH A;  2JJ1 G;  2OCC B;  5KHH A;  2R9I A;  3D3Q A;  5IJ0 B;  4I7Z B;  2P22 C;  1WB7 A;  5EBM C;  4PA7 A;  3APQ A;  1Y76 B;  4HNA B;  4P30 A;  5L3C A;  1ROP A;  3P3P A;  5KHG A;  1HWY A;  4FK5 C;  3E8G A;  5LA6 A;  2EJ7 A;  4K8Z A;  1SQX H;  1FOU A;  3QNE A;  2XAQ A;  4WFG A;  1BZK A;  4B7E A;  4JI1 B;  2WAM A;  4LCU C;  2A0L A;  3QO7 A;  1J95 A;  4I50 A;  4O2A A;  2GV9 A;  1XDC A;  2NLJ C;  2DQ3 A;  1Q6U A;  1X4T A;  4YJ3 A;  1US6 A;  2E74 B;  4PD4 F;  1PNM A;  3ZRS A;  4R8C A;  4X65 B;  2XHB A;  2K1E A;  3H1J H;  3OTO B;  5ITZ A;  3W7W A;  5HFM A;  2H3O A;  4PJ0 Z;  3CB2 A;  4JI0 O;  3MDS A;  3PJS K;  2EIN C;  1TGO A;  4RWU A;  2Q8V A;  4QE7 A;  3CCV V;  2QTS A;  1FKA O;  1EN5 A;  2WSS G;  3G4S V;  5IJ9 B;  3T1Y B;  5CA0 A;  4DXW A;  1SER A;  1BHB A;  3SJC C;  4YIP A;  1YI2 V;  1N32 B;  2BOB C;  2BTQ B;  4DV2 O;  1V9P A;  3CS5 A;  5LGU A;  4LF8 B;  3E8H A;  1P7B A;  1VF5 B;  1UJW B;  2R70 A;  3ZIA G;  2P90 A;  4UXN A;  1WP7 A;  2V4D A;  1R73 A;  4GX2 A;  5A2Q N;  5B1A B;  1VQ8 V;  3APO A;  1RM1 C;  1KB9 F;  1SQP H;  5BR8 B;  1NBM G;  3RYH B;  4UCU A;  4LF7 O;  4NYK A;  2QWP B;  4DV5 B;  4YJ2 B;  1JMK C;  2XUM A;  5KX5 A;  4X66 O;  2BCC H;  1K4C C;  3TK1 A;  1JOY A;  5IDJ A;  2WA4 A;  1CP9 A;  1YSC A;  1M56 B;  4O4I B;  2UUB B;  5TIS Z;  3BFR A;  5K1X A;  3HKE A;  4YXW G;  3CYO A;  2ZNJ A;  4B3R O;  3TCU A;  2CUG A;  4JI1 O;  3JAR A;  3AG1 B;  5DM6 V;  5J9P C;  1HDJ A;  2XND G;  1L1F A;  2XAF A;  5EYP B; 
#chains in the Genus database with same CATH homology
 1VAR A;  4FFK A;  3AK1 A;  1EN4 A;  1EM1 A;  1D5N A;  4JZG A;  1AR4 A;  1LUW A;  3MDS A;  1MA1 A;  3DC6 A;  1KKC A;  4YIO A;  3LSU A;  1WB8 A;  2RCV A;  3DC5 A;  1AP5 A;  1EN5 A;  3EVK A;  2AW9 A;  3IC9 A;  1GN2 A;  2CE4 A;  4GUN A;  1GN6 A;  1MSD A;  4C7U A;  2QKA A;  1BSM A;  3TJT A;  3AK3 A;  4YIP A;  4F6E A;  1B06 A;  1XRE A;  3AK2 A;  1SZX A;  2QKC A;  1ZTE A;  1IX9 A;  1ZLZ A;  4JZ2 A;  3CEI A;  1PL4 A;  1BT8 A;  4X9Q A;  1IDS A;  1I08 A;  1I0H A;  1P7G A;  2ADP A;  1MMM A;  2P4K A;  1IXB A;  1N0J A;  1AVM A;  1LUV A;  4BR6 A;  3KKY A;  1XUQ A;  1N0N A;  1XIL A;  1Y67 A;  3KDR A;  1PM9 A;  1GN3 A;  1JA8 A;  5A9G A;  1BS3 A;  1QNM A;  3C3S A;  1MNG A;  1ZSP A;  1JR9 A;  4E4E A;  3RN4 A;  1WB7 A;  3QVN A;  1VEW A;  1ZUQ A;  3C3T A;  1AP6 A;  2GDS A;  3BFR A;  4JYY A;  3K9S A;  5AG2 A;  2ADQ B;  1AR5 A;  1GN4 A;  3OT7 A;  1EN6 A;  1XDC A;  2CDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...