1N0NA

Catalytic and structural effects of amino-acid substitution at his30 in human manganese superoxide dismutase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKVHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic and Structural Effects of Amino-Acid Substitution at His30 in Human Manganese Superoxide Dismutase
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1n0nA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1n0nA02
1EN5A 3DC5A 1BSMA 3KKYA 4JZGA 1ZTEA 3AK1A 1EN4A 1ZLZA 1XUQA 1GN4A 1GN6A 1Y67A 1SZXA 3AK3A 1LUWA 1VEWA 1WB8A 2AW9A 3RN4A 1QNMA 3C3SA 1AR5A 1IXBA 4BR6A 1PL4A 1MA1A 1N0NA 1IX9A 1VARA 4FFKA 1JA8A 2GDSA 3IC9A 3MDSA 4GUNA 3C3TA 1MNGA 1AVMA 1MSDA 1XILA 4JYYA 3OT7A 1WB7A 1AP6A 1EN6A 1N0JA 3LSUA 1JR9A 1BT8A 1ZSPA 3BFRA 1D5NA 3K9SA 1AP5A 1LUVA 1P7GA 1XREA 4F6EA 1GN3A 2QKAA 3CEIA 5A9GA 2QKCA 2P4KA 5AG2A 4YIOA 1BS3A 2ADQB 1MMMA 1GN2A 3QVNA 3TJTA 4C7UA 1B06A 1XDCA 1ZUQA 2CE4A 1AR4A 1PM9A 3DC6A 3AK2A 1I0HA 1KKCA 2RCVA 4JZ2A 1I08A 4YIPA 4X9QA 2ADPA 1IDSA 3EVKA 4E4EA 2CDYA 1EM1A
chains in the Genus database with same CATH superfamily
4NVPA 1L0NH 3LSQA 4MTGA 2BOBC 2WLLB 2GTSA 4PELA 3CHXA 1B3QA 5L3EA 3CD6V 1VQ4V 4U7NA 1OCZB 1NTKH 1OCRB 1EN4A 5HFLA 1YDXA 2X6CA 5B66Z 1JPXA 3OEEG 1SZXA 4JI1O 3ASOB 1D5AA 2JJ1G 2Y69B 2Q0OC 3R66A 3JAWA 4LF4O 3SGIA 2Q9LA 3VQYA 1VF5B 3T2MA 1HNWB 2ILMA 1HNWO 2UUAB 3I5DA 3UT5A 1I7FA 4FIPC 3SYCA 1SA0A 3ZEDA 2DYSB 1F23A 1K7DA 3K3WA 4U3JB 2DN9A 1MZFA 2FTKA 2R9IA 4ZIBA 3BY6A 3SPCA 4DO2A 3L73H 2BTQA 5KHHA 3T1CA 1SRYA 3N2KA 4ABMA 5TISZ 2YXLA 1L1FA 2G38A 2VS0A 2YS8A 1SESA 4D7TA 5KUMA 4JI6O 3B09A 1AP5A 4IT5A 1K34A 4I7ZB 3DTUB 4X20A 4B08A 4GYCB 2X6BA 2XHBA 1I5YA 5KHKA 3RT3C 4GLXA 2HFEC 1M4UA 1NH2B 5EBMC 4WFAV 3K5NA 4RO2A 1SQVH 1M5IA 1KU9A 3LNMB 5IYCO 2JK5C 4OPHA 4O4JA 1RSOB 4Z1MG 4DV3O 1F4NA 1QHTA 2QTOA 4H44B 3ZX6A 3WU2Z 3MHHC 3CC2V 1UFIA 2B9ZA 1M93A 4ZKIA 2R9RB 2ZD9A 2ZNJA 3QO7A 3JAKB 4B3RB 1KMIZ 5GTIZ 1N34O 2JEXA 2Z3YA 1KKDA 1Y4MA 1TVKA 1G1XB 2UXBB 1IJGA 3F5TA 1S72V 1N8RW 1SERA 3AK1A 4B3SO 1ZLZA 1XUQA 4D6TH 4DUZO 5BMVA 1FPOA 3ZCCA 2OTLV 3BABA 4DV3B 1Q81W 1FJGB 1P7BA 1WB8A 1THZA 3Q4HB 4UCVA 5LBQA 1IBLB 4O2AA 4DR3B 4UXNA 1KUQA 1OJHA 1JVMA 3A2FA 3JATB 4AHCA 2IJHA 3AG2C 2Q7EA 5CMUA 5LXTA 4X88A 4PI2A 4PV1B 1U97A 4UCTA 4IYHA 4PA3A 1R3JC 1YZBA 3THOA 1VMGA 1J5EB 3ZHRA 4OPAA 4O4LA 3OUFA 1S77D 4DR6O 1RFYA 4DV4B 3VBBA 3E86A 4DW1A 3CJHB 4X62B 2NLJC 1SZTA 1JFFB 4RAIA 2DWDC 1H2KA 1SQPH 1VIBA 4G27B 1BMFG 3E89A 5B1BB 5LP6B 1Y76B 5A9GA 1VQ9V 4NXMB 2UXCO 1ORQC 4FFBA 1OCZC 1NT2B 1QU7A 2KKWA 4GKJO 5D5PA 1Z2GA 1K97A 2XNDG 4FVMA 2Q8VA 3CRCA 3K0DA 3UT5B 1AR1B 3GB7C 4WF9V 3AG3B 1NTMH 5EZYB 5J2UB 4LWSB 5LXTB 1WA8A 3CE2A 4JI1B 3RBZA 1BHBA 5LA6A 3RYIA 4CC6A 1Q5OA 4HBNA 1E1QG 4E4EA 3RGBA 4XDKA 2YC0A 3CJHA 3E2EA 3ZRWB 2WA4A 1SQFA 5D5QA 2XAJA 4AILC 1N4CA 4Q6GA 3JALA 3WG7B 2H3OA 2LW1A 5CB4A 5IYDO 4DV0O 3T1HO 4LFCB 4H13B 4ZOLB 4ZBMA 1GM7A 5BZBA 1NS1A 3OFNG 3G71V 2AZ0A 3ZRVA 2CH7B 2Z5UA 2V1DA 3CC4V 2WWWA 4P9PA 4GUNA 2KB1A 3PJSK 1I94O 2K1EA 2ZQMA 4X64O 3T4DA 2BSKB 5FNVB 5FL7G 4YJ2B 3T1YO 2UXDO 2OWOA 4CH3A 3IGAC 4O4LB 3ASNC 2AGAA 3JD0A 1YHQV 5EYPA 3CCMV 4YJ3A 1XNQO 1G4YB 2P4KA 4DR2O 1E79G 4X66O 4LR3A 4LNUA 1CEZA 5LYJA 1KP3A 1AILA 1XDCA 5L3FA 3L74H 4ZHQB 2PUSA 2C2AA 3FYEB 4PA6A 3DXRA 1H8HG 4MVSA 4UV9A 4UCSA 5L3BA 2DE0X 3CP1A 2CTWA 3RYHB 1K5SA 2AHZA 3JD3A 4LFAO 2OCHA 2ZINA 4EFEA 5LP6C 3K03A 5C8YB 5LP6A 4LFBB 2GUZA 2EJRA 4YHHO 1H38A 5CBGA 4N21A 5BMVB 3JALB 2P7TC 5GTHZ 1YI2V 3LDEA 4WFHA 1TGOA 4AI8A 5EIBD 1YJWV 3A0BZ 2F95B 1D2DA 3ICXA 1QVFU 3J7AU 2ZM6B 4WBNA 4MVQA 5IJ9B 3P3NA 2QWRB 1RP3B 4CH5A 1NVPD 2ZXWC 3UCSC 3ZMSA 2KSDA 4NTYA 4LF7O 2GV9A 1UPGA 2A3QA 2HVKC 4J9YB 1HR0O 1YSCA 3RYCB 1MABG 2EIKC 1IZ3A 4H37A 4JV5B 2F66C 1JR9A 3OR7C 1G8MA 4MTFA 2DYRC 1MSWD 1M1KW 1X4TA 3ABLB 3OTOO 2EX3A 1P49A 1WAZA 3FB5C 4YXWG 1DLBA 1NR7A 2A9HA 2DOSA 3W7SA 2VWJA 2CK3G 3R65A 4X1YA 1JOYA 5K1PA 3K04A 4X65O 3CWBH 1AJQA 1N33B 1K8AW 4RUFA 2CH7A 2E76B 3C90A 1H5WA 1HNXB 4JI2B 4PD4F 5LYJB 4CS2A 1VF6C 1YEWA 5JCOA 3JAWB 1PM9A 3O9OA 2Q5ZA 4WFFA 1XHXA 4QGPA 4JTCB 4OX9B 4OXSA 3QO5A 5FNVA 2HP8A 1GTOA 2ZDIA 2WSSG 2F43G 3ZHTA 4UB6Z 3HKBA 3SJAC 4J7KA 1VQ5V 4P2ZA 3DSQA 4B7KA 1YVWA 1BSMA 3AG3C 3JASA 2WLNA 3CXHF 3QF7A 4TUYB 2JS3A 5IYZA 3ABLC 4WFEA 3B40A 2F4VO 3CCRV 2JDIG 3MHSC 2IH3C 1ZX3A 3OGIB 3D36C 1K73W 4FZ0A 4I0XA 1IXBA 1X59A 4WFGA 3RVYA 3N2KB 4NTWA 1MOFA 2Y69C 4LBEC 5LOVA 5B5EZ 4GX5A 3SYQA 2WA3A 1GAXA 3ZRSA 3T1HB 1IURA 4KHPO 2YUAA 3CRMA 2QSAA 1N0JA 2EZPA 2WLMA 3ETGA 4LF8O 4DR5B 4LF4B 5LGUA 2PTMA 1JJ2U 2CGOA 3KG2A 1HWYA 2EILB 1FXKB 1P7GA 3UKMA 2HHHB 2HHHO 1IBLO 4RWUA 2CGNA 2EBOA 1HNZB 2CTQA 2P90A 4MVZA 3B77A 1S5LZ 2QM7A 2ADQB 3JCZA 2IM9A 2QWNB 1SA0B 1KC8W 1WP7A 2MK3A 5E1AC 3STZC 5LMUO 3FB7C 3G6BA 1US6A 2HKOA 5CA0A 3RWRD 4DR5O 4DR4B 4PA7A 3D8CA 2FYUH 1EM1A 3HKBB 4TQDA 2JEUA 3GVMA 5H6RA 2YIBA 3S3WA 3CCLV 1CP9A 4JI8B 2EIKB 4EKWA 2Y0IA 4IGGA 4X1IA 1EBOA 4X8AA 4I50B 2ODMA 1J5EO 5IWAB 2WLKA 3VOUA 1QNMA 1WLEA 5KAIZ 2X7RB 4QE9A 3UM7A 4UVAA 1S3JA 4X89A 1S5JA 3CB2A 5EZYA 2WPDG 4GT1A 4JI8O 4BIUA 4TV9B 2N05A 3CPWU 4JYCA 1IXMA 2BTOA 2GHYA 3CSXA 3K5MA 1P4RA 3OT7A 4O4IB 1FFTB 1OCOC 5KHIA 3RFRA 2IJJA 1FXHA 1D5NA 3K9SA 3OM3B 1XREA 5EBWC 2YXHA 3OAAG 3TCUA 1B6QA 4J41A 3GWOA 1ENVA 5AG2A 4F6RA 2WLIA 3RYFB 5JH7A 3Q4HA 5B1BC 3KCXA 3W7WA 3IC7A 2CE4A 4LF7B 3E22B 3AEIA 1OCCB 2UU9O 1XHZA 1CPYA 3ETQA 1F7YA 1WNSA 1NI8A 1KECA 4I4TA 2JGDB 1MG1A 3QG5A 2XOKG 3JASB 4O2BA 5LA6B 1FXKA 3RYIB 2Q4PA 4BAYA 3KKYA 3JARA 1Z5VA 2ZE5A 3HKEB 1RM1C 5B1AB 1K33A 4KP4A 5DEDA 4YHHB 1S5HC 2ZIOA 2UXNA 3W7TA 1GN4A 4FLVA 5H5NA 1S0VA 1NZ6A 3RYFA 2WLIB 4FFBB 1XL6A 3SYOA 2P67A 5DM6V 5EK0A 1R6TA 3RN4A 4K0KB 2YICA 4DRXA 5IDJA 4X1IB 1NH2D 4LF8B 2QEXV 5CB4B 5CN0A 2Y48A 5JVDB 2Q67A 2A0LA 1DK1A 4YJ2A 1COWG 3IC9A 2ITDC 4UUJC 2AXTZ 4DV2B 4UVBA 1AI7A 1K3EA 3DXRB 4DV5O 1R1BA 3FX7A 1XNRO 1JNBA 4B3MO 1WJZA 3CCQV 3WG7C 5EYPB 5LGNA 1O9HA 4QIWF 2A06H 3BAAA 1RM1B 1LUVA 1SQBH 5KA5A 1Y66A 3ZIAG 3CMEV 4I55A 4ZOLA 3H1IH 2X6AA 4EFBA 5FPRA 4DR2B 2CTPA 3AG1B 3N2GB 5LMNO 4JYAB 2QM4A 4HYOA 1XMQB 2ZR2A 2XT9A 1ZUQA 3W7XA 4NTXA 1YITV 1BQZA 2IJIA 1QLEB 3OD4A 3DC6A 3OE7G 5B1AC 4BIOA 5IY5C 3BEHA 1JCHA 4JZ2A 4WBNB 5C8YA 3IAYA 2ADPA 1VQ7V 3SYAA 5K1XA 3EVKA 4K8ZA 3FAVA 3HKDA 3JCUZ 1VP7A 2RMKB 3UO3A 4DUYO 2EIJC 4B3TO 3IFXA 3DC5A 3H1LH 3IJ4A 4GX1A 1L0LH 4I4TB 1WPXA 5L3GA 4YY3B 3JSNA 2QM8A 3UQ8A 3D36A 1GN6A 1URFA 5C93A 2R9AA 5KUKA 1HNZO 1LR1A 1GH6A 2HEPA 2QTSA 2JRIA 1HP8A 1PD3A 3K08A 1AI5A 1SF9A 1OCRC 5BY1A 4MW3A 1GKFA 5KA6A 5LL6Y 1M56B 2PYJA 1BL8A 2LGQA 2E74B 4BWAA 2B1GA 2LQTA 1K92A 1F4MA 4TQFA 4UVCA 1MNGA 2OIGA 1MSDA 1XILA 5J2TA 1WB7A 1AP6A 5JCOC 5CA1B 3SJBC 4AQYO 1SQGA 4J42A 1MZEA 3F7VC 3SJQC 3ML0A 2OCCC 4UB8Z 2O57A 3QNEA 4MSWC 4DV1B 1SS3A 3VQXA 4FLZA 2KG7A 4X1KA 4P30A 5CA3A 3D3QA 3RVZA 5JJEB 4DV4O 4GX0A 1NJIW 5FPOA 3W7UA 2PGGA 2EIJB 1MMMA 1AB3A 4KL1A 1NTZH 2P22C 1AR4A 3B2EE 1V54C 4NXNB 3HPLC 3K9AA 2XUMA 4IHJB 1KKCA 5EIBC 3SYPA 1DF4A 4A5UB 1ROPA 3ABKB 3AG7A 2IJKA 4RUEA 4ZI7A 2PF4E 4R50A 4GCZA 3JARB 4J7JA 3OTFA 4JI2O 2ETNA 1YIJV 2LGWA 3TXQA 2CUGA 1XNRB 4JI5O 3N2GA 4OGQB 1P84F 4DR7B 1Y67A 2DYRB 3OW2U 3DGEA 4K35A 5EC2C 2JVDA 1LNQA 2L6LA 3E35A 2NR5A 2Q68A 5DN6G 3JAMN 5IY5B 2DW4A 1ZAUA 4BR6A 1TUBA 2YI9A 2VQFB 1PPJH 3KDRA 2YSUB 3JD1A 4FFKA 1R3IC 1SQQH 2PI4A 4TV8B 2GDSA 3SJCC 3ZMUA 4FLXA 3H1KH 1H2GA 3L72H 3P30A 4DUYB 3C3TA 3ZMZA 1R6NA 4CBCA 2YIAA 3CRAA 5IE9A 1OZ0A 5IYZB 5CA1A 4B7EA 1FD9A 2VQEB 2HG5C 3OUSA 2QA4V 5IYBO 3H1JH 4LFCO 2ZR3A 1JMKC 3TK1A 4G2KA 2QKAA 4R8CA 5J2UA 2BOCC 3I55V 4YJ3B 3SDLA 3MAQA 3E8FA 3NR7A 4DXWA 2UU9B 4LF5O 4NB5A 2ATKC 2RJZA 4NXMO 2UXCB 1T5EA 1WA8B 4LFBO 1GMGA 3ZJZA 4J11A 4DV1O 4NYKA 2RNBA 1PKXA 3LDCA 3ZHVA 2LP7A 4X9QA 3SPJA 3E83A 3E8HA 3RYHA 4J9ZB 4FM2A 1IBMO 2D3OW 5H2FZ 3ABUA 2PZSA 2EIMC 1IBMB 2FMLA 2NN4A 4JASA 3ASNB 3ZBHA 3K0GA 3ZN0A 1QR8A 1PNMA 1VQPV 1EFRG 3ABTA 2Q6AA 4J10A 5KHJA 1FJGO 2XAFA 1AR5A 4DYLA 1H2LA 1Q8IA 4FM1A 3E22A 3T1YB 4I5SA 1R6KA 1QLNA 3ZHQA 2DMXA 2IBZH 1XNQB 2CAZC 1EN6A 4HNAB 4DR3O 3B8MA 1TVKB 4YY3O 3CXCU 3OR6C 3JD4A 1E1RG 4PDRA 1GN3A 5ITZB 1R3KC 3HKEA 3CX5F 4MW8A 5H6QA 3AG4C 3B4SA 2F1MA 1BS3A 2F93B 5LMUB 4FK5C 3TJTA 2GSMB 2EIMB 3ABMB 1FOUA 1N32O 2JJ2G 4U3JA 1W59A 4DRXB 2JGUA 4D7SA 4DV0B 3T4ZA 4QPJA 2GUZB 4TV9A 4H0LB 3L9DA 4O4JB 4Z2WA 3K5LA 2BSKA 2HLDG 1BCCH 3ZMVA 1EZJA 4TWKA 1V54B 3JSLA 5EBLC 4TOIA 4GKJB 2FL4A 1WPBA 5DECA 4CH6A 4CZZA 3G6EV 4JGSA 4DV5B 1AJNA 2MW2B 2Y4TA 3AK3A 4NXNO 4F6RB 4FZ1A 4JAUA 4K8XA 1PL4A 1MA1A 1N0NA 2EJ7A 1SC5B 1R73A 4FJCC 4ICGA 1QLEC 1H2MA 1JA8A 4O4HB 1M57B 1EZVH 4MVMA 3K79A 4H33A 4ASUG 2BTQB 3BHPA 5JWPA 3LNNA 4LH6A 4IL6Z 5IJ0A 4MVUA 3LSUA 4BW5A 1ZSPA 4HNAA 1CXZB 1PNLA 1U96A 4R6ZA 4E2LA 1VQLV 4F6EA 3EFFK 3K06A 2OYQA 3HB3B 1W0JG 3N27A 3GWKC 1GK9A 1XI1A 5KAFZ 5KMGB 4LC1A 4JI3B 1BQ0A 1FAFA 1OCOB 1B06A 2M6YA 5EC1C 5B1NA 3H9VA 4LF9B 1Q43A 2ARHA 4LH7A 4XDJA 5FLXN 1M56C 1I0HA 2WLHA 4CS3A 4JAVA 4FM0A 5BR8B 1PP9H 3F7YC 2IU3A 5JQGB 2OTJV 1DGSA 2A7WA 4QJFB 4KHPB 5LGTA 2Q0AA 2LO1A 2QWPB 2LJ2A 3RYCA 2W0FC 1Y6XA 1GO3F 3BPZA 3G67A 2PI5A 3P32A 4DR1O 3CRQA 3FB6C 2X0LA 1OCCC 4JI3O 2ZT9B 1FXKC 1GM9A 2ZXWB 2NNUA 2QKSA 1BZKA 5B3SC 2W0XA 4I9WA 1Q6UA 2DJVA 1LUWA 2XTAA 4I50A 4PA9A 3FKSG 1JJOA 1VQ8V 1J95A 4JI4B 2F4VB 4MS2A 4MVRA 4ZHQA 4JI6B 4MT8A 2ZM6O 1K4CC 1ZL8B 4JF3A 3F5WC 5JJNB 2LFSA 1IX9A 3J80N 3CCEV 3M8AA 3ZRXA 3E8BA 4JI7B 3JD2A 3ABMC 2EULA 3A0HZ 1O9GA 2YEVB 3KZIZ 2V4DA 2IW5A 1HDJA 1N36B 4BW9A 3CCUV 2QDOA 1KP2A 3VQVA 4ZI7B 1SKVA 3J81N 1HW7A 1OV9A 3VQWA 4UCOA 3WFVA 1N33O 2ZKOA 3CEIA 3M7MX 3ZS8C 1S76D 2GBOA 2EILC 1M90W 2Q7GA 3PN1A 5CA0B 3H01A 3A0RA 3QVNA 4I0XB 3CCJV 1XQ8A 1IBKB 2YDEA 1K4DC 2JIZG 4LNUB 4DK0A 4YIPA 5KX5B 4QNHB 2BCCH 2WLJA 4PI0A 2ZE7A 2ZCEA 2JGDA 1R3LC 1VQNV 1EN5A 1FFXB 2VWKA 1XMOO 3ABKC 4L8JA 2UUCO 4LF6O 1VQOV 2HJFC 4X64B 3QO8A 3CYOA 1YTFB 5JJJB 2QJ1A 3L71H 1AJPA 4PDMA 1VEWA 4B3TB 2VQEO 3KCYA 1B04A 3OMAB 2K9PA 3CRRA 1XBLA 5H9CA 1YJ9V 1XL4A 4GKKB 1Y74A 1SQXH 5A2QN 1SETA 4Q20A 1IVSA 3LUTB 5KX5A 3CC7V 4IHJA 2JS5A 4J7ZA 3NXSA 3BA9A 2EINC 3WB1A 1KBHA 3SPHA 1FFXA 2UUBO 2DQ0A 2FKXA 4IYIA 3WB2A 4KXRA 4JI0B 5CBFA 4TUYA 2WLLA 1RPRA 1YF2A 4MTXA 4DV6O 2PY5A 2W6IG 4DV6B 2OIEA 2R70A 1BE3H 4LP8A 1PNKA 1HNXO 2ZE6A 2QKCA 1YJNV 2LW7A 4X20B 5GW7A 1NVPB 4C7UA 4MVOA 3ZHSA 1KD1W 2PYLA 3U11A 5B3SB 2DQ3A 4PDVA 3K59A 1Q6IA 1OHHG 3BRCA 4O2AB 2WAMA 3TGUH 3E8GA 3STLC 3OTOB 1V55B 1NKDA 4RQFA 5KLVH 1ZWIC 2E5LB 4X65B 1IDSA 3ZN1A 1FKAO 1W0KG 1DTOA 2AHYA 4J80A 5LHIA 1I94B 3FD9A 4W4LA 4XBFA 3H1HH 3SR2C 4FLTA 1JFFA 4O4IA 4EB6A 1ZTEA 2DWEC 4G28B 4JAAA 2V7QG 1F51A 4DR6B 4N23A 4JV5O 3K58A 3JATA 3AG2B 3CS5A 4CH4A 2RN9A 3TXSA 3TETA 2Y4UA 5JVDA 3MD0A 2XASA 1Y76A 2AW9A 4PA4A 4FLUA 3X2QC 1H8EG 2E75B 1UJWB 1KYOF 1L8DA 4LF6B 3SPIA 1VARA 3BCCH 1XMOB 2HR3A 1G6UA 3QTCA 1I5XA 1Y74B 3CCSV 1QQCA 3MDSA 3D3IA 4JPRA 1WP8A 1KQSU 3FFQA 5LHGA 2D2CB 2RDCA 1FYJA 2E3CA 4TSFG 3G80A 1NR1A 4XDLA 2VQFO 2DYSC 3FAVB 1BT8A 2QE7G 4FPPA 3CCVV 2E5LO 3FB8C 3OGCC 1YXBA 1AI6A 5GONB 2ZIMA 4B3RO 2CTRA 2P5OA 2N04A 1IBKO 5IT9N 2HVJC 1KB9F 3O65A 4LFAB 4DR7O 2P06A 4K3AA 2Y0PA 4JI5B 4X66B 4WCEV 2VRZA 1V9PA 3RW0A 4F4LA 3LSSA 1K9MW 2H94A 4FLYA 1GN2A 2IH1C 1VQKV 2B5UA 5CBHA 3X2QB 2AZ2A 1GRJA 3LDDA 3AK2A 1FXVA 4X62O 5LMNB 2RCVA 1QCEA 2YIDA 1I08A 3ZRWA 1PV0A 4LF5B 1M57C 5J9PC 2EZOA 1TAEA 2CDYA 1Q90D 3ASOC 4IIJB 2UUBB 2XAHA 2XAQA 3U0ZA 4U3FH 3HKCB 3P3PA 1BHAA 2EINB 2P4VA 4P9OA 5BXZA 2P6JA 4JZGA 4NKGB 1TUEB 3ETEA 3K57A 3FYIB 4B3MB 4GKKO 4Z1VA 2QR4A 3SPGA 5KHGA 4OX9O 1VQ6V 4DV2O 2A79B 5E79Z 1TA8A 2B1IA 3M99B 1Q3EA 2IU0A 4LWSA 4HZ3A 2KG7B 3L75H 4X1KB 3C3SA 1QR9A 4O4HA 2F23A 3ZMTA 1TUBB 5BR8O 2UXBO 4TT3G 3WB0A 4AQYB 1N34B 5IJ0B 2ITCC 4CS4A 2R72A 4TV8A 5JQGA 1FS0G 1VQMV 1W2BU 3B8NA 2Q69A 2ZNIA 1NBMG 3AG1C 3EXAA 2ZE8A 3ZHUA 3BFRA 3L70H 4QPKA 4FLWA 4K0KO 1WN7A 2Q7HA 4UV8A 4UFZA 4U7OA 1K5QA 2KQXA 1Q6HA 3ETDA 3HR0A 2ZDIC 3K5OA 1Q82W 4R7CA 1XOUA 4YIOA 1JX9A 3I56V 4JYBA 1Q7YW 4UCUA 2N74A 1JQ0A 1Q86W 2HJDA 1BGYH 1PL0A 4MTOA 5F2VO 3U10A 1YCIA 4BIZA 5GONA 4IIJA 3JAKA 4CC5A 4EB6B 4O2BB 4I9QA 3S3XA 4GX2A 4KFMA 2XAGA 2UUAO 1QVGU 1VF7A 4JTAB 4KUMA 4JYAO 1A32A 1H2SB 5KMGA 3OMNB 5JH7B 4DV7B 3HKCA 4L87A 5LHHA 4RQEA 2QWQB 1XEQA 2W6JG 3OEHG 1NU1H 1GM8A 4FMTA 1N36O 4DK1A 4X1YB 2M7WA 1Z5WA 4JI0O 4DUZB 4LCUC 1M9NA 2L35A 4B3SB 4WFBV 4QE7A 5IWAO 5L3DA 3OMIB 1AROP 3APOA 4JI7O 4EEQA 1N32B 1NQTA 2Q73A 3EHBB 2GTAA 3HKDB 2LFRA 2Z0AA 5IJ9A 1AVMA 2YIBD 4JYYA 4DV7O 3BA8A 3A8TA 5HFMA 4PHZA 4JTDB 1RPOA 2UXDB 4JI4O 2YI8A 2QWOB 4NR1A 3AG4B 2OT5A 3APQA 4GZRB 1H2NA 2BE3A 4W4KA 3BVOA 4LF9O 5L3CA 2H8PC 3CMAV 5ITZA 5B1OA 1VF6A 4DR1B 1RSOA 2FB5A 1ZL8A 1V55C 1HR0B 3JYCA 4I55B 1YTFD 3G4SV 2UUCB 4UCRA 2YXYA 1AI4A 2OCCB 1DF5A 2QGNA 4HAMA 3UO2A 4PDLA 2UXXA 5LOVB 1XMQO 4DR4O 2RQ6A 4PJ0Z 4DW0A 1QBZA 5J2TB 2YEVA
chains in the Genus database with same CATH topology
1EN5A 3DC5A 1BSMA 3KKYA 4JZGA 1ZTEA 3AK1A 1EN4A 1ZLZA 1XUQA 1GN4A 1GN6A 1Y67A 1SZXA 3AK3A 1LUWA 1VEWA 1WB8A 2AW9A 3RN4A 1QNMA 3C3SA 1AR5A 1IXBA 4BR6A 1PL4A 1MA1A 1N0NA 1IX9A 3KDRA 1VARA 4FFKA 1JA8A 2GDSA 3IC9A 3MDSA 4GUNA 3C3TA 1MNGA 1AVMA 1MSDA 1XILA 4JYYA 3OT7A 1WB7A 1AP6A 1EN6A 1N0JA 3LSUA 1JR9A 1BT8A 1ZSPA 3BFRA 1D5NA 3K9SA 1AP5A 1LUVA 1P7GA 1XREA 4F6EA 1GN3A 2QKAA 3CEIA 5A9GA 2QKCA 2P4KA 5AG2A 4YIOA 1BS3A 2ADQB 1MMMA 1GN2A 3QVNA 3TJTA 4C7UA 1B06A 1XDCA 1ZUQA 2CE4A 1AR4A 1PM9A 3DC6A 3AK2A 1I0HA 1KKCA 2RCVA 4JZ2A 1I08A 4YIPA 4X9QA 2ADPA 1IDSA 3EVKA 4E4EA 2CDYA 1EM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EN5 A;  3DC5 A;  1BSM A;  3KKY A;  4JZG A;  1ZTE A;  3AK1 A;  1EN4 A;  1ZLZ A;  1XUQ A;  1GN4 A;  1GN6 A;  1Y67 A;  1SZX A;  3AK3 A;  1LUW A;  1VEW A;  1WB8 A;  2AW9 A;  3RN4 A;  1QNM A;  3C3S A;  1AR5 A;  1IXB A;  4BR6 A;  1PL4 A;  1MA1 A;  1N0N A;  1IX9 A;  1VAR A;  4FFK A;  1JA8 A;  2GDS A;  3IC9 A;  3MDS A;  4GUN A;  3C3T A;  1MNG A;  1AVM A;  1MSD A;  1XIL A;  4JYY A;  3OT7 A;  1WB7 A;  1AP6 A;  1EN6 A;  1N0J A;  3LSU A;  1JR9 A;  1BT8 A;  1ZSP A;  3BFR A;  1D5N A;  3K9S A;  1AP5 A;  1LUV A;  1P7G A;  1XRE A;  4F6E A;  1GN3 A;  2QKA A;  3CEI A;  5A9G A;  2QKC A;  2P4K A;  5AG2 A;  4YIO A;  1BS3 A;  2ADQ B;  1MMM A;  1GN2 A;  3QVN A;  3TJT A;  4C7U A;  1B06 A;  1XDC A;  1ZUQ A;  2CE4 A;  1AR4 A;  1PM9 A;  3DC6 A;  3AK2 A;  1I0H A;  1KKC A;  2RCV A;  4JZ2 A;  1I08 A;  4YIP A;  4X9Q A;  2ADP A;  1IDS A;  3EVK A;  4E4E A;  2CDY A;  1EM1 A; 
#chains in the Genus database with same CATH topology
 4NVP A;  1L0N H;  3LSQ A;  4MTG A;  2BOB C;  2WLL B;  2GTS A;  4PEL A;  3CHX A;  1B3Q A;  5L3E A;  3CD6 V;  1VQ4 V;  4U7N A;  1OCZ B;  1NTK H;  1OCR B;  1EN4 A;  5HFL A;  1YDX A;  2X6C A;  5B66 Z;  1JPX A;  3OEE G;  1SZX A;  4JI1 O;  3ASO B;  1D5A A;  2JJ1 G;  2Y69 B;  2Q0O C;  3R66 A;  3JAW A;  4LF4 O;  3SGI A;  2Q9L A;  3VQY A;  1VF5 B;  3T2M A;  1HNW B;  2ILM A;  1HNW O;  2UUA B;  3I5D A;  3UT5 A;  1I7F A;  4FIP C;  3SYC A;  1SA0 A;  3ZED A;  2DYS B;  1F23 A;  1K7D A;  3K3W A;  4U3J B;  2DN9 A;  1MZF A;  2FTK A;  2R9I A;  4ZIB A;  3BY6 A;  3SPC A;  4DO2 A;  3L73 H;  2BTQ A;  5KHH A;  3T1C A;  1SRY A;  3N2K A;  4ABM A;  5TIS Z;  2YXL A;  1L1F A;  2G38 A;  2VS0 A;  2YS8 A;  1SES A;  4D7T A;  5KUM A;  4JI6 O;  3B09 A;  1AP5 A;  4IT5 A;  1K34 A;  4I7Z B;  3DTU B;  4X20 A;  4B08 A;  4GYC B;  2X6B A;  2XHB A;  1I5Y A;  5KHK A;  3RT3 C;  4GLX A;  2HFE C;  1M4U A;  1NH2 B;  5EBM C;  4WFA V;  3K5N A;  4RO2 A;  1SQV H;  1M5I A;  1KU9 A;  3LNM B;  5IYC O;  2JK5 C;  4OPH A;  4O4J A;  1RSO B;  4Z1M G;  4DV3 O;  1F4N A;  1QHT A;  2QTO A;  4H44 B;  3ZX6 A;  3WU2 Z;  3MHH C;  3CC2 V;  1UFI A;  2B9Z A;  1M93 A;  4ZKI A;  2R9R B;  2ZD9 A;  2ZNJ A;  3QO7 A;  3JAK B;  4B3R B;  1KMI Z;  5GTI Z;  1N34 O;  2JEX A;  2Z3Y A;  1KKD A;  1Y4M A;  1TVK A;  1G1X B;  2UXB B;  1IJG A;  3F5T A;  1S72 V;  1N8R W;  1SER A;  3AK1 A;  4B3S O;  1ZLZ A;  1XUQ A;  4D6T H;  4DUZ O;  5BMV A;  1FPO A;  3ZCC A;  2OTL V;  3BAB A;  4DV3 B;  1Q81 W;  1FJG B;  1P7B A;  1WB8 A;  1THZ A;  3Q4H B;  4UCV A;  5LBQ A;  1IBL B;  4O2A A;  4DR3 B;  4UXN A;  1KUQ A;  1OJH A;  1JVM A;  3A2F A;  3JAT B;  4AHC A;  2IJH A;  3AG2 C;  2Q7E A;  5CMU A;  5LXT A;  4X88 A;  4PI2 A;  4PV1 B;  1U97 A;  4UCT A;  4IYH A;  4PA3 A;  1R3J C;  1YZB A;  3THO A;  1VMG A;  1J5E B;  3ZHR A;  4OPA A;  4O4L A;  3OUF A;  1S77 D;  4DR6 O;  1RFY A;  4DV4 B;  3VBB A;  3E86 A;  4DW1 A;  3CJH B;  4X62 B;  2NLJ C;  1SZT A;  1JFF B;  4RAI A;  2DWD C;  1H2K A;  1SQP H;  1VIB A;  4G27 B;  1BMF G;  3E89 A;  5B1B B;  5LP6 B;  1Y76 B;  5A9G A;  1VQ9 V;  4NXM B;  2UXC O;  1ORQ C;  4FFB A;  1OCZ C;  1NT2 B;  1QU7 A;  2KKW A;  4GKJ O;  5D5P A;  1Z2G A;  1K97 A;  2XND G;  4FVM A;  2Q8V A;  3CRC A;  3K0D A;  3UT5 B;  1AR1 B;  3GB7 C;  4WF9 V;  3AG3 B;  1NTM H;  5EZY B;  5J2U B;  4LWS B;  5LXT B;  1WA8 A;  3CE2 A;  4JI1 B;  3RBZ A;  1BHB A;  5LA6 A;  3RYI A;  4CC6 A;  1Q5O A;  4HBN A;  1E1Q G;  4E4E A;  3RGB A;  4XDK A;  2YC0 A;  3CJH A;  3E2E A;  3ZRW B;  2WA4 A;  1SQF A;  5D5Q A;  2XAJ A;  4AIL C;  1N4C A;  4Q6G A;  3JAL A;  3WG7 B;  2H3O A;  2LW1 A;  5CB4 A;  5IYD O;  4DV0 O;  3T1H O;  4LFC B;  4H13 B;  4ZOL B;  4ZBM A;  1GM7 A;  5BZB A;  1NS1 A;  3OFN G;  3G71 V;  2AZ0 A;  3ZRV A;  2CH7 B;  2Z5U A;  2V1D A;  3CC4 V;  2WWW A;  4P9P A;  4GUN A;  2KB1 A;  3PJS K;  1I94 O;  2K1E A;  2ZQM A;  4X64 O;  3T4D A;  2BSK B;  5FNV B;  5FL7 G;  4YJ2 B;  3T1Y O;  2UXD O;  2OWO A;  4CH3 A;  3IGA C;  4O4L B;  3ASN C;  2AGA A;  3JD0 A;  1YHQ V;  5EYP A;  3CCM V;  4YJ3 A;  1XNQ O;  1G4Y B;  2P4K A;  4DR2 O;  1E79 G;  4X66 O;  4LR3 A;  4LNU A;  1CEZ A;  5LYJ A;  1KP3 A;  1AIL A;  1XDC A;  5L3F A;  3L74 H;  4ZHQ B;  2PUS A;  2C2A A;  3FYE B;  4PA6 A;  3DXR A;  1H8H G;  4MVS A;  4UV9 A;  4UCS A;  5L3B A;  2DE0 X;  3CP1 A;  2CTW A;  3RYH B;  1K5S A;  2AHZ A;  3JD3 A;  4LFA O;  2OCH A;  2ZIN A;  4EFE A;  5LP6 C;  3K03 A;  5C8Y B;  5LP6 A;  4LFB B;  2GUZ A;  2EJR A;  4YHH O;  1H38 A;  5CBG A;  4N21 A;  5BMV B;  3JAL B;  2P7T C;  5GTH Z;  1YI2 V;  3LDE A;  4WFH A;  1TGO A;  4AI8 A;  5EIB D;  1YJW V;  3A0B Z;  2F95 B;  1D2D A;  3ICX A;  1QVF U;  3J7A U;  2ZM6 B;  4WBN A;  4MVQ A;  5IJ9 B;  3P3N A;  2QWR B;  1RP3 B;  4CH5 A;  1NVP D;  2ZXW C;  3UCS C;  3ZMS A;  2KSD A;  4NTY A;  4LF7 O;  2GV9 A;  1UPG A;  2A3Q A;  2HVK C;  4J9Y B;  1HR0 O;  1YSC A;  3RYC B;  1MAB G;  2EIK C;  1IZ3 A;  4H37 A;  4JV5 B;  2F66 C;  1JR9 A;  3OR7 C;  1G8M A;  4MTF A;  2DYR C;  1MSW D;  1M1K W;  1X4T A;  3ABL B;  3OTO O;  2EX3 A;  1P49 A;  1WAZ A;  3FB5 C;  4YXW G;  1DLB A;  1NR7 A;  2A9H A;  2DOS A;  3W7S A;  2VWJ A;  2CK3 G;  3R65 A;  4X1Y A;  1JOY A;  5K1P A;  3K04 A;  4X65 O;  3CWB H;  1AJQ A;  1N33 B;  1K8A W;  4RUF A;  2CH7 A;  2E76 B;  3C90 A;  1H5W A;  1HNX B;  4JI2 B;  4PD4 F;  5LYJ B;  4CS2 A;  1VF6 C;  1YEW A;  5JCO A;  3JAW B;  1PM9 A;  3O9O A;  2Q5Z A;  4WFF A;  1XHX A;  4QGP A;  4JTC B;  4OX9 B;  4OXS A;  3QO5 A;  5FNV A;  2HP8 A;  1GTO A;  2ZDI A;  2WSS G;  2F43 G;  3ZHT A;  4UB6 Z;  3HKB A;  3SJA C;  4J7K A;  1VQ5 V;  4P2Z A;  3DSQ A;  4B7K A;  1YVW A;  1BSM A;  3AG3 C;  3JAS A;  2WLN A;  3CXH F;  3QF7 A;  4TUY B;  2JS3 A;  5IYZ A;  3ABL C;  4WFE A;  3B40 A;  2F4V O;  3CCR V;  2JDI G;  3MHS C;  2IH3 C;  1ZX3 A;  3OGI B;  3D36 C;  1K73 W;  4FZ0 A;  4I0X A;  1IXB A;  1X59 A;  4WFG A;  3RVY A;  3N2K B;  4NTW A;  1MOF A;  2Y69 C;  4LBE C;  5LOV A;  5B5E Z;  4GX5 A;  3SYQ A;  2WA3 A;  1GAX A;  3ZRS A;  3T1H B;  1IUR A;  4KHP O;  2YUA A;  3CRM A;  2QSA A;  1N0J A;  2EZP A;  2WLM A;  3ETG A;  4LF8 O;  4DR5 B;  4LF4 B;  5LGU A;  2PTM A;  1JJ2 U;  2CGO A;  3KG2 A;  1HWY A;  2EIL B;  1FXK B;  1P7G A;  3UKM A;  2HHH B;  2HHH O;  1IBL O;  4RWU A;  2CGN A;  2EBO A;  1HNZ B;  2CTQ A;  2P90 A;  4MVZ A;  3B77 A;  1S5L Z;  2QM7 A;  2ADQ B;  3JCZ A;  2IM9 A;  2QWN B;  1SA0 B;  1KC8 W;  1WP7 A;  2MK3 A;  5E1A C;  3STZ C;  5LMU O;  3FB7 C;  3G6B A;  1US6 A;  2HKO A;  5CA0 A;  3RWR D;  4DR5 O;  4DR4 B;  4PA7 A;  3D8C A;  2FYU H;  1EM1 A;  3HKB B;  4TQD A;  2JEU A;  3GVM A;  5H6R A;  2YIB A;  3S3W A;  3CCL V;  1CP9 A;  4JI8 B;  2EIK B;  4EKW A;  2Y0I A;  4IGG A;  4X1I A;  1EBO A;  4X8A A;  4I50 B;  2ODM A;  1J5E O;  5IWA B;  2WLK A;  3VOU A;  1QNM A;  1WLE A;  5KAI Z;  2X7R B;  4QE9 A;  3UM7 A;  4UVA A;  1S3J A;  4X89 A;  1S5J A;  3CB2 A;  5EZY A;  2WPD G;  4GT1 A;  4JI8 O;  4BIU A;  4TV9 B;  2N05 A;  3CPW U;  4JYC A;  1IXM A;  2BTO A;  2GHY A;  3CSX A;  3K5M A;  1P4R A;  3OT7 A;  4O4I B;  1FFT B;  1OCO C;  5KHI A;  3RFR A;  2IJJ A;  1FXH A;  1D5N A;  3K9S A;  3OM3 B;  1XRE A;  5EBW C;  2YXH A;  3OAA G;  3TCU A;  1B6Q A;  4J41 A;  3GWO A;  1ENV A;  5AG2 A;  4F6R A;  2WLI A;  3RYF B;  5JH7 A;  3Q4H A;  5B1B C;  3KCX A;  3W7W A;  3IC7 A;  2CE4 A;  4LF7 B;  3E22 B;  3AEI A;  1OCC B;  2UU9 O;  1XHZ A;  1CPY A;  3ETQ A;  1F7Y A;  1WNS A;  1NI8 A;  1KEC A;  4I4T A;  2JGD B;  1MG1 A;  3QG5 A;  2XOK G;  3JAS B;  4O2B A;  5LA6 B;  1FXK A;  3RYI B;  2Q4P A;  4BAY A;  3KKY A;  3JAR A;  1Z5V A;  2ZE5 A;  3HKE B;  1RM1 C;  5B1A B;  1K33 A;  4KP4 A;  5DED A;  4YHH B;  1S5H C;  2ZIO A;  2UXN A;  3W7T A;  1GN4 A;  4FLV A;  5H5N A;  1S0V A;  1NZ6 A;  3RYF A;  2WLI B;  4FFB B;  1XL6 A;  3SYO A;  2P67 A;  5DM6 V;  5EK0 A;  1R6T A;  3RN4 A;  4K0K B;  2YIC A;  4DRX A;  5IDJ A;  4X1I B;  1NH2 D;  4LF8 B;  2QEX V;  5CB4 B;  5CN0 A;  2Y48 A;  5JVD B;  2Q67 A;  2A0L A;  1DK1 A;  4YJ2 A;  1COW G;  3IC9 A;  2ITD C;  4UUJ C;  2AXT Z;  4DV2 B;  4UVB A;  1AI7 A;  1K3E A;  3DXR B;  4DV5 O;  1R1B A;  3FX7 A;  1XNR O;  1JNB A;  4B3M O;  1WJZ A;  3CCQ V;  3WG7 C;  5EYP B;  5LGN A;  1O9H A;  4QIW F;  2A06 H;  3BAA A;  1RM1 B;  1LUV A;  1SQB H;  5KA5 A;  1Y66 A;  3ZIA G;  3CME V;  4I55 A;  4ZOL A;  3H1I H;  2X6A A;  4EFB A;  5FPR A;  4DR2 B;  2CTP A;  3AG1 B;  3N2G B;  5LMN O;  4JYA B;  2QM4 A;  4HYO A;  1XMQ B;  2ZR2 A;  2XT9 A;  1ZUQ A;  3W7X A;  4NTX A;  1YIT V;  1BQZ A;  2IJI A;  1QLE B;  3OD4 A;  3DC6 A;  3OE7 G;  5B1A C;  4BIO A;  5IY5 C;  3BEH A;  1JCH A;  4JZ2 A;  4WBN B;  5C8Y A;  3IAY A;  2ADP A;  1VQ7 V;  3SYA A;  5K1X A;  3EVK A;  4K8Z A;  3FAV A;  3HKD A;  3JCU Z;  1VP7 A;  2RMK B;  3UO3 A;  4DUY O;  2EIJ C;  4B3T O;  3IFX A;  3DC5 A;  3H1L H;  3IJ4 A;  4GX1 A;  1L0L H;  4I4T B;  1WPX A;  5L3G A;  4YY3 B;  3JSN A;  2QM8 A;  3UQ8 A;  3D36 A;  1GN6 A;  1URF A;  5C93 A;  2R9A A;  5KUK A;  1HNZ O;  1LR1 A;  1GH6 A;  2HEP A;  2QTS A;  2JRI A;  1HP8 A;  1PD3 A;  3K08 A;  1AI5 A;  1SF9 A;  1OCR C;  5BY1 A;  4MW3 A;  1GKF A;  5KA6 A;  5LL6 Y;  1M56 B;  2PYJ A;  1BL8 A;  2LGQ A;  2E74 B;  4BWA A;  2B1G A;  2LQT A;  1K92 A;  1F4M A;  4TQF A;  4UVC A;  1MNG A;  2OIG A;  1MSD A;  1XIL A;  5J2T A;  1WB7 A;  1AP6 A;  5JCO C;  5CA1 B;  3SJB C;  4AQY O;  1SQG A;  4J42 A;  1MZE A;  3F7V C;  3SJQ C;  3ML0 A;  2OCC C;  4UB8 Z;  2O57 A;  3QNE A;  4MSW C;  4DV1 B;  1SS3 A;  3VQX A;  4FLZ A;  2KG7 A;  4X1K A;  4P30 A;  5CA3 A;  3D3Q A;  3RVZ A;  5JJE B;  4DV4 O;  4GX0 A;  1NJI W;  5FPO A;  3W7U A;  2PGG A;  2EIJ B;  1MMM A;  1AB3 A;  4KL1 A;  1NTZ H;  2P22 C;  1AR4 A;  3B2E E;  1V54 C;  4NXN B;  3HPL C;  3K9A A;  2XUM A;  4IHJ B;  1KKC A;  5EIB C;  3SYP A;  1DF4 A;  4A5U B;  1ROP A;  3ABK B;  3AG7 A;  2IJK A;  4RUE A;  4ZI7 A;  2PF4 E;  4R50 A;  4GCZ A;  3JAR B;  4J7J A;  3OTF A;  4JI2 O;  2ETN A;  1YIJ V;  2LGW A;  3TXQ A;  2CUG A;  1XNR B;  4JI5 O;  3N2G A;  4OGQ B;  1P84 F;  4DR7 B;  1Y67 A;  2DYR B;  3OW2 U;  3DGE A;  4K35 A;  5EC2 C;  2JVD A;  1LNQ A;  2L6L A;  3E35 A;  2NR5 A;  2Q68 A;  5DN6 G;  3JAM N;  5IY5 B;  2DW4 A;  1ZAU A;  4BR6 A;  1TUB A;  2YI9 A;  2VQF B;  1PPJ H;  3KDR A;  2YSU B;  3JD1 A;  4FFK A;  1R3I C;  1SQQ H;  2PI4 A;  4TV8 B;  2GDS A;  3SJC C;  3ZMU A;  4FLX A;  3H1K H;  1H2G A;  3L72 H;  3P30 A;  4DUY B;  3C3T A;  3ZMZ A;  1R6N A;  4CBC A;  2YIA A;  3CRA A;  5IE9 A;  1OZ0 A;  5IYZ B;  5CA1 A;  4B7E A;  1FD9 A;  2VQE B;  2HG5 C;  3OUS A;  2QA4 V;  5IYB O;  3H1J H;  4LFC O;  2ZR3 A;  1JMK C;  3TK1 A;  4G2K A;  2QKA A;  4R8C A;  5J2U A;  2BOC C;  3I55 V;  4YJ3 B;  3SDL A;  3MAQ A;  3E8F A;  3NR7 A;  4DXW A;  2UU9 B;  4LF5 O;  4NB5 A;  2ATK C;  2RJZ A;  4NXM O;  2UXC B;  1T5E A;  1WA8 B;  4LFB O;  1GMG A;  3ZJZ A;  4J11 A;  4DV1 O;  4NYK A;  2RNB A;  1PKX A;  3LDC A;  3ZHV A;  2LP7 A;  4X9Q A;  3SPJ A;  3E83 A;  3E8H A;  3RYH A;  4J9Z B;  4FM2 A;  1IBM O;  2D3O W;  5H2F Z;  3ABU A;  2PZS A;  2EIM C;  1IBM B;  2FML A;  2NN4 A;  4JAS A;  3ASN B;  3ZBH A;  3K0G A;  3ZN0 A;  1QR8 A;  1PNM A;  1VQP V;  1EFR G;  3ABT A;  2Q6A A;  4J10 A;  5KHJ A;  1FJG O;  2XAF A;  1AR5 A;  4DYL A;  1H2L A;  1Q8I A;  4FM1 A;  3E22 A;  3T1Y B;  4I5S A;  1R6K A;  1QLN A;  3ZHQ A;  2DMX A;  2IBZ H;  1XNQ B;  2CAZ C;  1EN6 A;  4HNA B;  4DR3 O;  3B8M A;  1TVK B;  4YY3 O;  3CXC U;  3OR6 C;  3JD4 A;  1E1R G;  4PDR A;  1GN3 A;  5ITZ B;  1R3K C;  3HKE A;  3CX5 F;  4MW8 A;  5H6Q A;  3AG4 C;  3B4S A;  2F1M A;  1BS3 A;  2F93 B;  5LMU B;  4FK5 C;  3TJT A;  2GSM B;  2EIM B;  3ABM B;  1FOU A;  1N32 O;  2JJ2 G;  4U3J A;  1W59 A;  4DRX B;  2JGU A;  4D7S A;  4DV0 B;  3T4Z A;  4QPJ A;  2GUZ B;  4TV9 A;  4H0L B;  3L9D A;  4O4J B;  4Z2W A;  3K5L A;  2BSK A;  2HLD G;  1BCC H;  3ZMV A;  1EZJ A;  4TWK A;  1V54 B;  3JSL A;  5EBL C;  4TOI A;  4GKJ B;  2FL4 A;  1WPB A;  5DEC A;  4CH6 A;  4CZZ A;  3G6E V;  4JGS A;  4DV5 B;  1AJN A;  2MW2 B;  2Y4T A;  3AK3 A;  4NXN O;  4F6R B;  4FZ1 A;  4JAU A;  4K8X A;  1PL4 A;  1MA1 A;  1N0N A;  2EJ7 A;  1SC5 B;  1R73 A;  4FJC C;  4ICG A;  1QLE C;  1H2M A;  1JA8 A;  4O4H B;  1M57 B;  1EZV H;  4MVM A;  3K79 A;  4H33 A;  4ASU G;  2BTQ B;  3BHP A;  5JWP A;  3LNN A;  4LH6 A;  4IL6 Z;  5IJ0 A;  4MVU A;  3LSU A;  4BW5 A;  1ZSP A;  4HNA A;  1CXZ B;  1PNL A;  1U96 A;  4R6Z A;  4E2L A;  1VQL V;  4F6E A;  3EFF K;  3K06 A;  2OYQ A;  3HB3 B;  1W0J G;  3N27 A;  3GWK C;  1GK9 A;  1XI1 A;  5KAF Z;  5KMG B;  4LC1 A;  4JI3 B;  1BQ0 A;  1FAF A;  1OCO B;  1B06 A;  2M6Y A;  5EC1 C;  5B1N A;  3H9V A;  4LF9 B;  1Q43 A;  2ARH A;  4LH7 A;  4XDJ A;  5FLX N;  1M56 C;  1I0H A;  2WLH A;  4CS3 A;  4JAV A;  4FM0 A;  5BR8 B;  1PP9 H;  3F7Y C;  2IU3 A;  5JQG B;  2OTJ V;  1DGS A;  2A7W A;  4QJF B;  4KHP B;  5LGT A;  2Q0A A;  2LO1 A;  2QWP B;  2LJ2 A;  3RYC A;  2W0F C;  1Y6X A;  1GO3 F;  3BPZ A;  3G67 A;  2PI5 A;  3P32 A;  4DR1 O;  3CRQ A;  3FB6 C;  2X0L A;  1OCC C;  4JI3 O;  2ZT9 B;  1FXK C;  1GM9 A;  2ZXW B;  2NNU A;  2QKS A;  1BZK A;  5B3S C;  2W0X A;  4I9W A;  1Q6U A;  2DJV A;  1LUW A;  2XTA A;  4I50 A;  4PA9 A;  3FKS G;  1JJO A;  1VQ8 V;  1J95 A;  4JI4 B;  2F4V B;  4MS2 A;  4MVR A;  4ZHQ A;  4JI6 B;  4MT8 A;  2ZM6 O;  1K4C C;  1ZL8 B;  4JF3 A;  3F5W C;  5JJN B;  2LFS A;  1IX9 A;  3J80 N;  3CCE V;  3M8A A;  3ZRX A;  3E8B A;  4JI7 B;  3JD2 A;  3ABM C;  2EUL A;  3A0H Z;  1O9G A;  2YEV B;  3KZI Z;  2V4D A;  2IW5 A;  1HDJ A;  1N36 B;  4BW9 A;  3CCU V;  2QDO A;  1KP2 A;  3VQV A;  4ZI7 B;  1SKV A;  3J81 N;  1HW7 A;  1OV9 A;  3VQW A;  4UCO A;  3WFV A;  1N33 O;  2ZKO A;  3CEI A;  3M7M X;  3ZS8 C;  1S76 D;  2GBO A;  2EIL C;  1M90 W;  2Q7G A;  3PN1 A;  5CA0 B;  3H01 A;  3A0R A;  3QVN A;  4I0X B;  3CCJ V;  1XQ8 A;  1IBK B;  2YDE A;  1K4D C;  2JIZ G;  4LNU B;  4DK0 A;  4YIP A;  5KX5 B;  4QNH B;  2BCC H;  2WLJ A;  4PI0 A;  2ZE7 A;  2ZCE A;  2JGD A;  1R3L C;  1VQN V;  1EN5 A;  1FFX B;  2VWK A;  1XMO O;  3ABK C;  4L8J A;  2UUC O;  4LF6 O;  1VQO V;  2HJF C;  4X64 B;  3QO8 A;  3CYO A;  1YTF B;  5JJJ B;  2QJ1 A;  3L71 H;  1AJP A;  4PDM A;  1VEW A;  4B3T B;  2VQE O;  3KCY A;  1B04 A;  3OMA B;  2K9P A;  3CRR A;  1XBL A;  5H9C A;  1YJ9 V;  1XL4 A;  4GKK B;  1Y74 A;  1SQX H;  5A2Q N;  1SET A;  4Q20 A;  1IVS A;  3LUT B;  5KX5 A;  3CC7 V;  4IHJ A;  2JS5 A;  4J7Z A;  3NXS A;  3BA9 A;  2EIN C;  3WB1 A;  1KBH A;  3SPH A;  1FFX A;  2UUB O;  2DQ0 A;  2FKX A;  4IYI A;  3WB2 A;  4KXR A;  4JI0 B;  5CBF A;  4TUY A;  2WLL A;  1RPR A;  1YF2 A;  4MTX A;  4DV6 O;  2PY5 A;  2W6I G;  4DV6 B;  2OIE A;  2R70 A;  1BE3 H;  4LP8 A;  1PNK A;  1HNX O;  2ZE6 A;  2QKC A;  1YJN V;  2LW7 A;  4X20 B;  5GW7 A;  1NVP B;  4C7U A;  4MVO A;  3ZHS A;  1KD1 W;  2PYL A;  3U11 A;  5B3S B;  2DQ3 A;  4PDV A;  3K59 A;  1Q6I A;  1OHH G;  3BRC A;  4O2A B;  2WAM A;  3TGU H;  3E8G A;  3STL C;  3OTO B;  1V55 B;  1NKD A;  4RQF A;  5KLV H;  1ZWI C;  2E5L B;  4X65 B;  1IDS A;  3ZN1 A;  1FKA O;  1W0K G;  1DTO A;  2AHY A;  4J80 A;  5LHI A;  1I94 B;  3FD9 A;  4W4L A;  4XBF A;  3H1H H;  3SR2 C;  4FLT A;  1JFF A;  4O4I A;  4EB6 A;  1ZTE A;  2DWE C;  4G28 B;  4JAA A;  2V7Q G;  1F51 A;  4DR6 B;  4N23 A;  4JV5 O;  3K58 A;  3JAT A;  3AG2 B;  3CS5 A;  4CH4 A;  2RN9 A;  3TXS A;  3TET A;  2Y4U A;  5JVD A;  3MD0 A;  2XAS A;  1Y76 A;  2AW9 A;  4PA4 A;  4FLU A;  3X2Q C;  1H8E G;  2E75 B;  1UJW B;  1KYO F;  1L8D A;  4LF6 B;  3SPI A;  1VAR A;  3BCC H;  1XMO B;  2HR3 A;  1G6U A;  3QTC A;  1I5X A;  1Y74 B;  3CCS V;  1QQC A;  3MDS A;  3D3I A;  4JPR A;  1WP8 A;  1KQS U;  3FFQ A;  5LHG A;  2D2C B;  2RDC A;  1FYJ A;  2E3C A;  4TSF G;  3G80 A;  1NR1 A;  4XDL A;  2VQF O;  2DYS C;  3FAV B;  1BT8 A;  2QE7 G;  4FPP A;  3CCV V;  2E5L O;  3FB8 C;  3OGC C;  1YXB A;  1AI6 A;  5GON B;  2ZIM A;  4B3R O;  2CTR A;  2P5O A;  2N04 A;  1IBK O;  5IT9 N;  2HVJ C;  1KB9 F;  3O65 A;  4LFA B;  4DR7 O;  2P06 A;  4K3A A;  2Y0P A;  4JI5 B;  4X66 B;  4WCE V;  2VRZ A;  1V9P A;  3RW0 A;  4F4L A;  3LSS A;  1K9M W;  2H94 A;  4FLY A;  1GN2 A;  2IH1 C;  1VQK V;  2B5U A;  5CBH A;  3X2Q B;  2AZ2 A;  1GRJ A;  3LDD A;  3AK2 A;  1FXV A;  4X62 O;  5LMN B;  2RCV A;  1QCE A;  2YID A;  1I08 A;  3ZRW A;  1PV0 A;  4LF5 B;  1M57 C;  5J9P C;  2EZO A;  1TAE A;  2CDY A;  1Q90 D;  3ASO C;  4IIJ B;  2UUB B;  2XAH A;  2XAQ A;  3U0Z A;  4U3F H;  3HKC B;  3P3P A;  1BHA A;  2EIN B;  2P4V A;  4P9O A;  5BXZ A;  2P6J A;  4JZG A;  4NKG B;  1TUE B;  3ETE A;  3K57 A;  3FYI B;  4B3M B;  4GKK O;  4Z1V A;  2QR4 A;  3SPG A;  5KHG A;  4OX9 O;  1VQ6 V;  4DV2 O;  2A79 B;  5E79 Z;  1TA8 A;  2B1I A;  3M99 B;  1Q3E A;  2IU0 A;  4LWS A;  4HZ3 A;  2KG7 B;  3L75 H;  4X1K B;  3C3S A;  1QR9 A;  4O4H A;  2F23 A;  3ZMT A;  1TUB B;  5BR8 O;  2UXB O;  4TT3 G;  3WB0 A;  4AQY B;  1N34 B;  5IJ0 B;  2ITC C;  4CS4 A;  2R72 A;  4TV8 A;  5JQG A;  1FS0 G;  1VQM V;  1W2B U;  3B8N A;  2Q69 A;  2ZNI A;  1NBM G;  3AG1 C;  3EXA A;  2ZE8 A;  3ZHU A;  3BFR A;  3L70 H;  4QPK A;  4FLW A;  4K0K O;  1WN7 A;  2Q7H A;  4UV8 A;  4UFZ A;  4U7O A;  1K5Q A;  2KQX A;  1Q6H A;  3ETD A;  3HR0 A;  2ZDI C;  3K5O A;  1Q82 W;  4R7C A;  1XOU A;  4YIO A;  1JX9 A;  3I56 V;  4JYB A;  1Q7Y W;  4UCU A;  2N74 A;  1JQ0 A;  1Q86 W;  2HJD A;  1BGY H;  1PL0 A;  4MTO A;  5F2V O;  3U10 A;  1YCI A;  4BIZ A;  5GON A;  4IIJ A;  3JAK A;  4CC5 A;  4EB6 B;  4O2B B;  4I9Q A;  3S3X A;  4GX2 A;  4KFM A;  2XAG A;  2UUA O;  1QVG U;  1VF7 A;  4JTA B;  4KUM A;  4JYA O;  1A32 A;  1H2S B;  5KMG A;  3OMN B;  5JH7 B;  4DV7 B;  3HKC A;  4L87 A;  5LHH A;  4RQE A;  2QWQ B;  1XEQ A;  2W6J G;  3OEH G;  1NU1 H;  1GM8 A;  4FMT A;  1N36 O;  4DK1 A;  4X1Y B;  2M7W A;  1Z5W A;  4JI0 O;  4DUZ B;  4LCU C;  1M9N A;  2L35 A;  4B3S B;  4WFB V;  4QE7 A;  5IWA O;  5L3D A;  3OMI B;  1ARO P;  3APO A;  4JI7 O;  4EEQ A;  1N32 B;  1NQT A;  2Q73 A;  3EHB B;  2GTA A;  3HKD B;  2LFR A;  2Z0A A;  5IJ9 A;  1AVM A;  2YIB D;  4JYY A;  4DV7 O;  3BA8 A;  3A8T A;  5HFM A;  4PHZ A;  4JTD B;  1RPO A;  2UXD B;  4JI4 O;  2YI8 A;  2QWO B;  4NR1 A;  3AG4 B;  2OT5 A;  3APQ A;  4GZR B;  1H2N A;  2BE3 A;  4W4K A;  3BVO A;  4LF9 O;  5L3C A;  2H8P C;  3CMA V;  5ITZ A;  5B1O A;  1VF6 A;  4DR1 B;  1RSO A;  2FB5 A;  1ZL8 A;  1V55 C;  1HR0 B;  3JYC A;  4I55 B;  1YTF D;  3G4S V;  2UUC B;  4UCR A;  2YXY A;  1AI4 A;  2OCC B;  1DF5 A;  2QGN A;  4HAM A;  3UO2 A;  4PDL A;  2UXX A;  5LOV B;  1XMQ O;  4DR4 O;  2RQ6 A;  4PJ0 Z;  4DW0 A;  1QBZ A;  5J2T B;  2YEV A; 
#chains in the Genus database with same CATH homology
 1EN5 A;  3DC5 A;  1BSM A;  3KKY A;  4JZG A;  1ZTE A;  3AK1 A;  1EN4 A;  1ZLZ A;  1XUQ A;  1GN4 A;  1GN6 A;  1Y67 A;  1SZX A;  3AK3 A;  1LUW A;  1VEW A;  1WB8 A;  2AW9 A;  3RN4 A;  1QNM A;  3C3S A;  1AR5 A;  1IXB A;  4BR6 A;  1PL4 A;  1MA1 A;  1N0N A;  1IX9 A;  3KDR A;  1VAR A;  4FFK A;  1JA8 A;  2GDS A;  3IC9 A;  3MDS A;  4GUN A;  3C3T A;  1MNG A;  1AVM A;  1MSD A;  1XIL A;  4JYY A;  3OT7 A;  1WB7 A;  1AP6 A;  1EN6 A;  1N0J A;  3LSU A;  1JR9 A;  1BT8 A;  1ZSP A;  3BFR A;  1D5N A;  3K9S A;  1AP5 A;  1LUV A;  1P7G A;  1XRE A;  4F6E A;  1GN3 A;  2QKA A;  3CEI A;  5A9G A;  2QKC A;  2P4K A;  5AG2 A;  4YIO A;  1BS3 A;  2ADQ B;  1MMM A;  1GN2 A;  3QVN A;  3TJT A;  4C7U A;  1B06 A;  1XDC A;  1ZUQ A;  2CE4 A;  1AR4 A;  1PM9 A;  3DC6 A;  3AK2 A;  1I0H A;  1KKC A;  2RCV A;  4JZ2 A;  1I08 A;  4YIP A;  4X9Q A;  2ADP A;  1IDS A;  3EVK A;  4E4E A;  2CDY A;  1EM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...