1N0NA

Catalytic and structural effects of amino-acid substitution at his30 in human manganese superoxide dismutase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKVHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic and Structural Effects of Amino-Acid Substitution at His30 in Human Manganese Superoxide Dismutase
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1n0nA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1n0nA02
1SZXA 1N0JA 1WB7A 4E4EA 2ADPA 3MDSA 1GN4A 1B06A 1PL4A 1KKCA 1D5NA 1EN6A 1I08A 1EN4A 3BFRA 5AG2A 1Y67A 1BS3A 1GN6A 1XDCA 1MMMA 4F6EA 2AW9A 2P4KA 3C3TA 4JZGA 1XREA 1BT8A 4GUNA 3IC9A 4JZ2A 1AP6A 2RCVA 3LSUA 4X9QA 1VEWA 2CDYA 3AK2A 3OT7A 3EVKA 2ADQB 3TJTA 1AVMA 1BSMA 1JA8A 1MA1A 1MSDA 3KKYA 1VARA 3K9SA 1XILA 3QVNA 3CEIA 1AR5A 4JYYA 1ZSPA 3AK1A 1GN2A 1IX9A 1LUVA 1ZLZA 4YIPA 4FFKA 4YIOA 5A9GA 1WB8A 1AP5A 2QKCA 1I0HA 1JR9A 3RN4A 1N0NA 3DC5A 3C3SA 2CE4A 4C7UA 1AR4A 3AK3A 1XUQA 1EM1A 1PM9A 3DC6A 4BR6A 1IXBA 1EN5A 1LUWA 2GDSA 2QKAA 1GN3A 1P7GA 1ZTEA 1QNMA 1IDSA 1ZUQA 1MNGA
chains in the Genus database with same CATH superfamily
2Y69B 2OTJV 1K5QA 1N0JA 5TISZ 1F51A 1Y74B 3BA9A 4DR3B 1GN4A 1B06A 1PV0A 2W6JG 1Q8IA 3BFRA 4B3RO 1CP9A 4WFEA 2WLIA 1FJGB 1GAXA 2JRIA 4I55B 4DW0A 1DGSA 5CA3A 5EBLC 2X6CA 4ABMA 3N2KB 2JS5A 2VQFB 1B04A 2ITCC 1FXKC 4YJ3B 3CCLV 2E75B 1FFXB 4IHJA 2WA4A 1K3EA 3O65A 4O4HA 1NZ6A 3OTOB 2DW4A 3PN1A 1AI6A 3U10A 3EVKA 4CC6A 1X4TA 1PD3A 1GM7A 1W59A 3KKYA 3ZHQA 1WP8A 1R3JC 4LNUB 4EB6B 2KSDA 1Z5WA 4I50B 4IYHA 4GKKB 5H9CA 4JI3B 1N36O 5LGUA 1EZJA 2M7WA 2HFEC 1IX9A 1ZLZA 3CJHB 3B8MA 3ZRWA 3AG3C 1NH2B 1ENVA 4YIOA 3DXRB 3KG2A 2Q5ZA 2P22C 5EK0A 2WLKA 2JGDA 3L70H 5IY5C 2P06A 1FYJA 1NH2D 5B1OA 2X7RB 2BTQB 5EBMC 5DEDA 3T1YB 3A8TA 3BEHA 3JALB 1RP3B 2XAJA 2EJ7A 4A5UB 1PNKA 1Q5OA 5JJNB 4JI5O 5KHKA 3ZHTA 4N21A 1XNQB 3CD6V 2ZM6O 5LMNB 2ZE7A 4NYKA 5CN0A 5LXTA 1JMKC 2XT9A 3E83A 1GRJA 3OUFA 2GSMB 3K06A 5J2UB 4DK0A 2Q68A 4K8ZA 4DV5B 3F5WC 3VOUA 2Y69C 5K1PA 3BPZA 3VQXA 1BHAA 1SF9A 4OXSA 2GTSA 5EYPA 4DR7O 1FS0G 1P49A 4B7EA 1IBKB 3K5NA 3AK2A 4DK1A 2RQ6A 2QWQB 3K04A 1XNRB 5JCOC 1PP9H 4O4HB 1U97A 5JVDB 2PZSA 1S3JA 4NXNO 2ZDIA 5IJ9A 1US6A 3M7MX 5GTIZ 4TV8B 3K9AA 5K1XA 4JYAB 3ZMSA 1H2KA 1BQ0A 5F2VO 1ZX3A 1JJ2U 4FLZA 3CYOA 4NB5A 2AZ0A 1OCOB 1P7BA 3OD4A 1Q6HA 5BMVA 2HJFC 4DV1O 2UXBO 5HFMA 5L3GA 5IYDO 2UU9O 1L1FA 2EINC 1WAZA 3CPWU 1PNLA 1G6UA 2ZR2A 1Q6IA 2OCHA 1WJZA 3DC6A 3ZMVA 4CS3A 4UVCA 3N2KA 4JI0B 2DE0X 2GTAA 5C93A 3T4ZA 5IY5B 4PHZA 2ZCEA 2BOCC 2DOSA 3L74H 4UCSA 2JJ2G 2MK3A 4J7KA 4R7CA 4P2ZA 2JEXA 3H1HH 1I5XA 1D5NA 1AI7A 1EN6A 1KKCA 2UXXA 3L71H 4O2BA 5KHJA 2YXLA 5BXZA 3ABKC 1G4YB 1E1RG 2HHHB 2UUBB 1R6TA 3E86A 1SRYA 3HKDA 3FB8C 4I9WA 1Y74A 4LWSA 3H1KH 4MTXA 4P30A 1J5EO 1TUBB 2LP7A 2BTOA 4X65B 3ZS8C 2XAHA 3ASOC 3RYFB 3Q4HB 1D2DA 1XOUA 2F66C 1RPOA 5H6QA 2IU3A 1I7FA 2D2CB 1VQLV 4BW5A 5L3EA 3J7AU 2QM7A 3HKCA 3LDCA 3U0ZA 3OMNB 1NR1A 4NTYA 4LF8O 1K7DA 3CCQV 2YSUB 4MTFA 1VQ9V 1H2MA 2P5OA 1GTOA 2WAMA 1NKDA 3CX5F 3OR7C 2KG7B 5LP6B 3G6BA 3S3WA 3JSNA 4WFHA 1FAFA 1KD1W 1OV9A 1GM8A 4ZI7B 4PDMA 2A9HA 1I94B 1P4RA 3K79A 3KCYA 5LA6A 1F7YA 4J7JA 4R50A 4LNUA 2QWPB 3UO2A 4MS2A 4PA6A 1SESA 4UVBA 2HR3A 3L9DA 5IYBO 5BY1A 5B5EZ 1XUQA 3M99B 1HDJA 4FIPC 4X1KB 1EZVH 1NI8A 5LOVA 5KA5A 3WG7C 1ZTEA 3TGUH 1QNMA 1M57B 1MNGA 2B1GA 1J95A 4PA7A 4MTGA 1KP2A 4NVPA 4UXNA 1N34B 4I7ZB 4KL1A 4FLVA 3HKDB 4LP8A 4YJ2A 1OCCC 4GX1A 2ZIMA 4XDJA 2UUCO 1JX9A 4I5SA 2DWDC 3JALA 2ZKOA 4DYLA 3E89A 3O9OA 4EFBA 3JD3A 5J2TA 5KHIA 4B3SO 3CCUV 3ZMTA 1S5HC 2YI8A 2Q4PA 2XUMA 4KHPO 2KQXA 2XTAA 1Q7YW 1Y66A 2BSKA 1O9HA 2H3OA 3RBZA 4DRXB 5LP6C 4FM1A 2OIGA 4X9QA 3MAQA 4ZKIA 4DV6O 5EIBC 2KKWA 5KX5B 1FJGO 4HYOA 3VQWA 3H01A 4JI6O 3B4SA 2HKOA 3L72H 3SYCA 2NLJC 1JFFA 2PGGA 4HAMA 4Z1VA 5JH7A 4DV4O 4X1IA 5DN6G 3JAWB 4F4LA 2DMXA 4UCVA 4I4TB 2HHHO 2F43G 2N04A 2FKXA 1UFIA 5L3DA 1MOFA 1V54B 3JCUZ 1HNWO 3I55V 4X66O 4ZBMA 1Y76B 2Z5UA 2A79B 3D3IA 3AG4B 4H0LB 4U7OA 4O2BB 4ZOLA 3X2QB 4KXRA 3T1HB 4CS4A 2DQ3A 4DR5O 1XMQO 1PM9A 2UUCB 3RYFA 2XNDG 1QCEA 1S77D 1HNXB 1VF5B 3SPCA 1ZUQA 4NR1A 1SC5B 3OE7G 2PI5A 1VQPV 4OX9O 4DR1B 3CC7V 3LDEA 3SPIA 1ZAUA 4YJ2B 2ZD9A 1X59A 4UB8Z 1J5EB 3C90A 5GTHZ 1NU1H 3JARA 2F4VB 2A7WA 1MZEA 4DR6O 4H44B 4J11A 5LHGA 4KUMA 5J2TB 1SQQH 3QO8A 3P32A 3TXSA 3CCEV 1THZA 4D6TH 1MG1A 3W7TA 1Z5VA 3ABMB 3JD4A 1TVKA 1S0VA 2OCCB 5KUKA 2OCCC 1V54C 1BZKA 1JJOA 2BSKB 2V1DA 3CHXA 2LO1A 4YHHO 5IJ0A 3TJTA 3T1CA 4DV5O 3K03A 3RYHA 4UUJC 5GW7A 4IL6Z 1VQMV 4X89A 4LF5B 2CTQA 3ZCCA 2UXNA 1OCCB 1TAEA 2B9ZA 1HW7A 2DYRB 1BGYH 2A3QA 4I4TA 3SDLA 3UKMA 1GN2A 4X64B 1YEWA 4O4LA 1Y6XA 2XAGA 4E2LA 4DV0B 1HWYA 4QPKA 4FLUA 1QLEB 3BAAA 1QLEC 5KHHA 4O2AA 3T1YO 2PYLA 1EM1A 3RVZA 1XNRO 4LBEC 4WFBV 2CTRA 2GV9A 1K33A 2IM9A 3AG4C 2A06H 5E79Z 1K4DC 3ETDA 1QU7A 2O57A 4JGSA 1AJNA 4NKGB 3T4DA 4CH5A 1ORQC 3E2EA 4MVMA 1NVPB 4Q6GA 3ABLB 1JFFB 3CRCA 3T2MA 4CZZA 1NT2B 4DXWA 3E22A 2ZQMA 2C2AA 2YXYA 2HVJC 2X6BA 3MD0A 1M1KW 3TETA 4RQFA 3SJQC 2Q67A 2Q7EA 1AROP 3OT7A 1E1QG 3FAVB 2UUAB 1XHXA 4ZOLB 1DF5A 2ADQB 4PDLA 3G6EV 3ETQA 2AHYA 4J7ZA 4LF9B 5EIBD 5IJ0B 1FFTB 3ABKB 2R72A 2ZXWC 4BIZA 2JEUA 5J9PC 4U7NA 2QWRB 1MSWD 4JYYA 3QO5A 2GUZB 1FXKB 2B5UA 4JPRA 4GKKO 1WPXA 3ZRXA 2P90A 3H1LH 3IC7A 4YIPA 4DV2B 4YY3O 2UU9B 4IIJA 2Q0OC 2P7TC 1Q6UA 5BR8B 3QG5A 2CUGA 2VQEB 1YTFB 4DV2O 2YIAA 2VRZA 1YXBA 2EIMC 4DR4O 2Y4UA 2JGUA 2ZDIC 1N8RW 1JPXA 2EIJB 2W0XA 1R3IC 2QKAA 2EULA 1M56B 1L8DA 3K59A 5CBGA 3CCVV 4LF6B 3ZEDA 2Q9LA 2IJHA 2HLDG 3CE2A 5KMGA 1M93A 3FD9A 3M8AA 3CC4V 1Y67A 2ZR3A 4TWKA 2F4VO 5B66Z 1BMFG 4X8AA 2AW9A 1TGOA 4O4IA 1MABG 3DSQA 4B3RB 2Q69A 4J42A 2EJRA 3ZHVA 3IC9A 2IH3C 4JZ2A 2BCCH 4GX0A 1OCOC 2EIKB 1M9NA 1QBZA 3OGIB 4JYBA 4I0XA 5IT9N 2X6AA 1YHQV 1NBMG 5EYPB 4FLWA 2UXCO 4FLXA 1IBLO 1BSMA 3RYIB 4KHPB 1V55B 4MVQA 4J41A 1GO3F 2F93B 3SJBC 3K9SA 1N4CA 1AJQA 4PI2A 4TUYB 3STLC 1YCIA 3SYQA 2DN9A 1SS3A 4DUZO 4TQFA 3EFFK 5JQGB 2AHZA 1R6NA 2IJIA 4WFFA 5JJEB 2K1EA 3UT5A 2Q7GA 3SYOA 3E8GA 4DV0O 3UQ8A 4FM0A 3E22B 4JI4O 3OR6C 3CSXA 5IWAO 3HKEB 3QNEA 5CB4A 5LHHA 2ZE5A 1HNXO 1PL0A 1WB7A 2EILB 4WBNB 3ZMZA 5KLVH 2CK3G 1OJHA 4K35A 5AG2A 4QJFB 1SQPH 3SPGA 3OMAB 4XBFA 1CXZB 5KAFZ 3K0DA 4LH7A 2WLMA 5L3BA 2DWEC 4PA4A 1VIBA 3CXHF 4AQYO 4DR2B 4ZHQA 4X66B 4TV9B 4I0XB 5KUMA 5DM6V 2X0LA 3L75H 2VQFO 1ZL8B 1K8AW 3Q4HA 3ZBHA 3H1IH 3W7UA 3B40A 3BVOA 3ZN1A 1FFXA 4IHJB 4I9QA 2NN4A 3GWKC 3S3XA 3IAYA 2BE3A 2LQTA 3UM7A 4K3AA 3ASNB 4ASUG 1K34A 1OCRC 3TCUA 2V4DA 1NQTA 3DGEA 4X62O 1KQSU 4GCZA 1SA0B 1KB9F 2R9RB 4DR2O 1QQCA 2DYRC 4PA9A 1GH6A 2YEVA 3CWBH 5A9GA 5EBWC 1K9MW 1L0NH 4U3JB 2EILC 4IT5A 1JR9A 4B3SB 3LSSA 5JQGA 2ZINA 3F7VC 4I55A 3DXRA 1VQNV 1M4UA 2ATKC 1XMOB 1VF6A 4B3MB 2QE7G 3H1JH 4DUYB 4N23A 3F5TA 5C8YA 2GDSA 3AEIA 2IBZH 1VQ7V 4YY3B 1R6KA 3CCJV 3WFVA 5FL7G 2DQ0A 2D3OW 1Q3EA 1I08A 1EN4A 2FMLA 2JJ1G 4WBNA 2F1MA 1YJWV 4DV7O 4OPAA 2N74A 1HR0B 2WLHA 1K97A 3ZRVA 1QR8A 4F6EA 3D8CA 2YIBA 2P4KA 4X88A 2QA4V 4X20B 2IJKA 4JZGA 2E5LB 1I5YA 1UPGA 5IE9A 4WFAV 1KBHA 2EINB 5LMUO 2L35A 2UUAO 1NTZH 4P9PA 3UO3A 4UFZA 1YJ9V 1FD9A 4TV9A 1IZ3A 4JI2B 1VEWA 4PDVA 1KUQA 4MW3A 2IU0A 1NJIW 1ZL8A 1R3KC 1H38A 4JI0O 1JVMA 1AILA 3KZIZ 1H2GA 5CA0B 2NNUA 5JCOA 2Z0AA 3OAAG 2VQEO 1MSDA 1RSOB 1KYOF 4GX5A 1AJPA 1CPYA 2XAFA 2E3CA 3CRQA 4Q20A 1EFRG 3ETEA 2YC0A 2WWWA 2AGAA 3E35A 2OYQA 4XDLA 4LF7B 4BWAA 1WB8A 1AP5A 2ARHA 4FZ1A 4GZRB 5FNVB 1I0HA 3HR0A 1VF6C 3TK1A 3A0RA 3ZRWB 1BL8A 4TOIA 1S76D 1EBOA 1VP7A 3BABA 1SQBH 1V9PA 2EIMB 1WLEA 3QO7A 3WB0A 1SZXA 3QTCA 4MVSA 4PV1B 1HP8A 2A0LA 5J2UA 1QVFU 2DYSC 2Z3YA 2OT5A 3I5DA 3HKEA 1S5JA 4DR4B 5CB4B 3K5OA 2UXCB 5JVDA 2OIEA 4AILC 3RW0A 5LGTA 1BS3A 1VQ4V 3FFQA 3ZIAG 1VMGA 4LF5O 3ZMUA 1F4NA 3JSLA 3MHSC 3L73H 3OEHG 3SR2C 4LR3A 4UV8A 3JATB 4HNAB 4OPHA 2LGWA 2E76B 4CBCA 5FPOA 2LW7A 3ASNC 1RPRA 3ETGA 5BMVB 1IBMB 3GB7C 1YVWA 5KHGA 4NXNB 1OCZC 3JCZA 1NS1A 3WB1A 2CTPA 2RN9A 4CC5A 2MW2B 4I50A 3FKSG 4Z1MG 1CEZA 2XAQA 3CCMV 3CRRA 1K5SA 3D36C 3MHHC 1XQ8A 4DR7B 4KFMA 3ABLC 1SZTA 1XEQA 1YZBA 2B1IA 3B09A 2FYUH 5FNVA 5JWPA 3LSQA 1GMGA 4KP4A 4QE9A 4BW9A 1OHHG 3ICXA 3P30A 4FFBA 2ZIOA 1AB3A 2BTQA 1KKDA 3OGCC 4DV1B 5GONA 2EBOA 4LWSB 2CE4A 1V55C 3OTFA 1XMOO 1MZFA 1TUBA 4IYIA 1G8MA 1Q86W 1IXBA 4AHCA 2QKSA 4YHHB 4JI5B 4RUFA 1LR1A 4GYCB 4UV9A 4CH4A 3K5LA 5EC2C 2R70A 1COWG 1KECA 2UXDB 5EZYB 1JNBA 1M90W 3RVYA 4R8CA 1NTMH 1RM1C 1FOUA 4LF9O 5IYCO 4UCUA 1U96A 2QR4A 2E5LO 2AZ2A 4J10A 4UVAA 3H9VA 3ZHRA 3RT3C 1OCZB 2JS3A 2GBOA 2PY5A 3P3PA 4DV7B 2EX3A 2HJDA 2LW1A 2QM8A 2RJZA 3K08A 4XDKA 2HEPA 4UCRA 1BT8A 4GUNA 4FMTA 1Z2GA 3LSUA 3A0BZ 2QTSA 2Y0PA 3SYPA 4X20A 4FPPA 4U3FH 3LNNA 2QGNA 4HNAA 4YXWG 2LJ2A 5IYZB 2ZM6B 3SGIA 1XHZA 5IJ9B 3SPHA 2QDOA 1JA8A 2OTLV 1XMQB 3BCCH 4PA3A 1DLBA 1Y4MA 3ZX6A 1VARA 4DR5B 3CP1A 4ICGA 1XILA 2Y0IA 5LA6B 3OTOO 1K73W 2DJVA 4JTDB 3CEIA 1AR5A 4X1IB 3STZC 2YI9A 3GWOA 3W7SA 1W0KG 4J9YB 1HNZB 4NXMB 2P67A 2CGOA 5B1AC 4W4KA 2HVKC 1YI2V 3K5MA 3ML0A 2WSSG 3OMIB 4GKJB 5CA1A 1WPBA 2W6IG 3QF7A 1E79G 5B3SB 3RN4A 5CBHA 1AR4A 1VQ6V 3JASB 4FFBB 2GHYA 4JI7B 1WN7A 5B1BC 1H8EG 1GN3A 4HBNA 3JAMN 3AG2C 3JATA 4GKJO 5LYJA 4FLYA 2QSAA 4E4EA 2ADPA 3AG7A 4J9ZB 4B3MO 4LF4B 4EFEA 2W0FC 2LFSA 5B1NA 1YSCA 2EIJC 4LFAO 3CCRV 3G67A 5KMGB 2JDIG 1GN6A 1R73A 4YJ3A 3W7WA 3T1HO 4W4LA 3CRAA 5LBQA 2OWOA 1IVSA 1GM9A 2ZE6A 4X1KA 4MVZA 3RFRA 2EIKC 1VQKV 1YIJV 1O9GA 1KC8W 1IJGA 1UJWB 3AG3B 4B7KA 3CCSV 4PD4F 2WPDG 3ZHUA 1H2LA 4AI8A 2ZE8A 4B3TB 4JTCB 4JAVA 4DV4B 1KMIZ 2PI4A 4JV5B 4PI0A 4DR1O 4EB6A 3HB3B 5FLXN 2Q73A 1BHBA 1JOYA 5IYZA 2YUAA 4QGPA 1YITV 1VQ8V 1SETA 5CBFA 3QVNA 3J80N 3ZRSA 5JH7B 3AK1A 4JAAA 3JAWA 5H2FZ 4LC1A 3SJAC 5A2QN 3I56V 4RQEA 3JASA 5KX5A 2RMKB 3LUTB 2RNBA 3GVMA 3HKBA 1W2BU 4LFAB 4C7UA 2N05A 5CA1B 5DECA 1IBLB 4PELA 1RM1B 4L87A 4BIOA 1AR1B 4NTXA 2IW5A 5BR8O 5L3CA 2JVDA 3RYCB 5GONB 4LCUC 4LFBO 1IDSA 2ITDC 5IWAB 1G1XB 3MDSA 4JF3A 1Y76A 3BY6A 3KCXA 5CMUA 2Y48A 1OCRB 5LYJB 3FYIB 4JV5O 5JJJB 3R66A 1SQXH 1FXHA 1K92A 2Y4TA 4JI1B 3OEEG 1N33O 4BIUA 4K0KO 5EZYA 2WLLB 3W7XA 1T5EA 3RYHB 1JCHA 1XDCA 4DV6B 2UUBO 2P6JA 2VWJA 4H37A 2CAZC 1TUEB 1S72V 1RFYA 1I94O 2XASA 1PPJH 3CB2A 2HG5C 4LFCB 2K9PA 3K3WA 1QVGU 1YDXA 4Z2WA 2RCVA 1YTFD 3RWRD 4ZHQB 3OUSA 1QR9A 3OFNG 1XL6A 1ROPA 3APQA 1AVMA 4O2AB 3ABTA 1MA1A 3JARB 4LF4O 4LF8B 4O4JB 1Q43A 1FPOA 3TXQA 2P4VA 1VF7A 5LL6Y 5H6RA 3E8HA 2ETNA 1KP3A 2PUSA 4ZIBA 3BHPA 5IDJA 2PF4E 2F23A 4TSFG 4GX2A 2RDCA 3K0GA 3R65A 3SJCC 1GKFA 2ILMA 2QJ1A 1F23A 1P84F 4TQDA 1Q82W 2YEVB 4BR6A 2FL4A 2YDEA 4U3JA 2DYSB 1NTKH 3CS5A 3A2FA 2UXDO 4JI8O 2CGNA 1IBKO 5FPRA 2R9AA 2Q7HA 3NR7A 4D7TA 2G38A 1NVPD 1NR7A 3K58A 1PNMA 1PL4A 4O4LB 1OZ0A 4JI3O 4B08A 3UCSC 2QWOB 1DTOA 5E1AC 5EC1C 1M56C 3P3NA 1MMMA 3K57A 3KDRA 3WU2Z 1IURA 2CH7A 1VQ5V 3BA8A 4DO2A 3FX7A 4MT8A 1L0LH 1XNQO 4FJCC 4DV3O 1TVKB 3VQVA 1TA8A 1XREA 3HKCB 3ABUA 3G80A 1WNSA 3B8NA 4JYAO 1QHTA 4RWUA 5D5PA 4QIWF 4G28B 4LFCO 3CRMA 3RGBA 5B3SC 3CMEV 2M6YA 2KG7A 4RO2A 3HKBB 3VBBA 4R6ZA 4MVUA 4WCEV 5LP6A 4F6RA 3N2GB 1AI5A 2GUZA 1AI4A 4DR6B 2LGQA 4ZI7A 2WLJA 3F7YC 1QLNA 4LF7O 2QTOA 3RYCA 4FK5C 3NXSA 2YIDA 1RSOA 4EEQA 2IJJA 2QWNB 1H8HG 4DV3B 1H2SB 3FAVA 4FFKA 4FZ0A 5KA6A 3EXAA 1N32B 2H8PC 2QKCA 1F4MA 5H5NA 4G2KA 4K8XA 4RAIA 5LOVB 1N32O 1WA8B 3DC5A 4H33A 1FXKA 3OM3B 3ABMC 4UCTA 1K4CC 3AG1C 1EN5A 4O4IB 2BOBC 2L6LA 2PYJA 2FB5A 4IIJB 1R3LC 2EZPA 4FM2A 3D36A 3U11A 3JAKA 4X1YA 4JI2O 3G4SV 4JI8B 4PJ0Z 3EHBB 1SQVH 5LMUB 1SERA 1GK9A 3J81N 2EZOA 1M57C 5B1AB 2YXHA 3A0HZ 3FB5C 4WFGA 4J80A 2ODMA 1IBMO 1B6QA 4MW8A 1HR0O 1YJNV 4O4JA 1N33B 4JI1O 4DRXA 1URFA 2HP8A 3C3TA 4QPJA 4BAYA 4OX9B 4TT3G 2YICA 4JI6B 2CH7B 1FKAO 2WLLA 1IXMA 3AG2B 3IFXA 5LGNA 1AP6A 2ZNJA 5B1BB 3CC2V 4PDRA 4LFBB 1SQFA 4JAUA 2CDYA 4DW1A 2LFRA 3CXCU 4JASA 3FYEB 5LMNO 4MVRA 2YS8A 1B3QA 4TUYA 3UT5B 3JD2A 2WLIB 2IH1C 3G71V 3THOA 3FB6C 2WLNA 3DTUB 2JIZG 1M5IA 1DF4A 4GT1A 2Q8VA 3VQYA 2JGDB 2QEXV 1VQOV 4GLXA 1HNWB 4OGQB 1ZWIC 4FVMA 2WA3A 4JTAB 1Q81W 5D5QA 3JD0A 3ZN0A 1BQZA 3RYIA 3ASOB 2V7QG 3C3SA 5ITZA 4JI4B 2ZXWB 4D7SA 4JI7O 3B77A 4MSWC 1XBLA 4X64O 3E8BA 1LUWA 1WA8A 1N36B 4DR3O 4NTWA 1P7GA 4H13B 3ZJZA 4CS2A 3LNMB 2AXTZ 2XOKG 2Q6AA 2H94A 3LDDA 3N27A 3CJHA 1XL4A 3JAKB 3PJSK 3SYAA 1S5LZ 1WP7A 4NXMO 2ZNIA 1SQGA 3FB7C 2XHBA 1PKXA 1KU9A 1BCCH 3AG1B 1BE3H 2FTKA 4RUEA 4F6RB 1H2NA 4L8JA 5HFLA 1Q90D 1W0JG 4G27B 3ZHSA 2JK5C 1N34O 3IGAC 3SPJA 1D5AA 2NR5A 3OW2U 4MTOA 3E8FA 2PTMA 3BRCA 3B2EE 4HZ3A 3APOA 4LH6A 1H5WA 4K0KB 5KAIZ 3JYCA 4TV8A 5BZBA 1YF2A 1DK1A 4FLTA 1SKVA 3D3QA 5LXTB 3IJ4A 4UCOA 4X65O 1R1BA 1SA0A 4B3TO 5CA0A 4QE7A 5LHIA 3WG7B 2CTWA 3JD1A 4MVOA 3X2QC 4X1YB 5L3FA 4DUYO 1ZSPA 3N2GA 4DUZB 1A32A 1LUVA 2E74B 1HNZO 4AQYB 5ITZB 4EKWA 1FXVA 4LF6O 2QM4A 4QNHB 4CH6A 5C8YB 2F95B 2VWKA 4IGGA 1XI1A 1N0NA 2VS0A 4CH3A 3HPLC 4WF9V 3CMAV 3AK3A 1LNQA 3WB2A 2YIBD 2KB1A 2ZT9B 4X62B 4UB6Z 1JQ0A 2R9IA 4P9OA 2UXBB 2Q0AA 4JYCA
chains in the Genus database with same CATH topology
1SZXA 1N0JA 1WB7A 4E4EA 2ADPA 3MDSA 1GN4A 1B06A 1PL4A 1KKCA 1D5NA 1EN6A 1I08A 1EN4A 3BFRA 5AG2A 1Y67A 1BS3A 1GN6A 1XDCA 1MMMA 4F6EA 3KDRA 2AW9A 2P4KA 3C3TA 4JZGA 1XREA 1BT8A 4GUNA 3IC9A 4JZ2A 1AP6A 2RCVA 3LSUA 4X9QA 1VEWA 2CDYA 3AK2A 3OT7A 3EVKA 2ADQB 3TJTA 1AVMA 1BSMA 1JA8A 1MA1A 1MSDA 3KKYA 1VARA 3K9SA 1XILA 3QVNA 3CEIA 1AR5A 4JYYA 1ZSPA 3AK1A 1GN2A 1IX9A 1LUVA 1ZLZA 4YIPA 4FFKA 4YIOA 5A9GA 1WB8A 1AP5A 2QKCA 1I0HA 1JR9A 3RN4A 1N0NA 3DC5A 3C3SA 2CE4A 4C7UA 1AR4A 3AK3A 1XUQA 1EM1A 1PM9A 3DC6A 4BR6A 1IXBA 1EN5A 1LUWA 2GDSA 2QKAA 1GN3A 1P7GA 1ZTEA 1QNMA 1IDSA 1ZUQA 1MNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZX A;  1N0J A;  1WB7 A;  4E4E A;  2ADP A;  3MDS A;  1GN4 A;  1B06 A;  1PL4 A;  1KKC A;  1D5N A;  1EN6 A;  1I08 A;  1EN4 A;  3BFR A;  5AG2 A;  1Y67 A;  1BS3 A;  1GN6 A;  1XDC A;  1MMM A;  4F6E A;  2AW9 A;  2P4K A;  3C3T A;  4JZG A;  1XRE A;  1BT8 A;  4GUN A;  3IC9 A;  4JZ2 A;  1AP6 A;  2RCV A;  3LSU A;  4X9Q A;  1VEW A;  2CDY A;  3AK2 A;  3OT7 A;  3EVK A;  2ADQ B;  3TJT A;  1AVM A;  1BSM A;  1JA8 A;  1MA1 A;  1MSD A;  3KKY A;  1VAR A;  3K9S A;  1XIL A;  3QVN A;  3CEI A;  1AR5 A;  4JYY A;  1ZSP A;  3AK1 A;  1GN2 A;  1IX9 A;  1LUV A;  1ZLZ A;  4YIP A;  4FFK A;  4YIO A;  5A9G A;  1WB8 A;  1AP5 A;  2QKC A;  1I0H A;  1JR9 A;  3RN4 A;  1N0N A;  3DC5 A;  3C3S A;  2CE4 A;  4C7U A;  1AR4 A;  3AK3 A;  1XUQ A;  1EM1 A;  1PM9 A;  3DC6 A;  4BR6 A;  1IXB A;  1EN5 A;  1LUW A;  2GDS A;  2QKA A;  1GN3 A;  1P7G A;  1ZTE A;  1QNM A;  1IDS A;  1ZUQ A;  1MNG A; 
#chains in the Genus database with same CATH topology
 2Y69 B;  2OTJ V;  1K5Q A;  1N0J A;  5TIS Z;  1F51 A;  1Y74 B;  3BA9 A;  4DR3 B;  1GN4 A;  1B06 A;  1PV0 A;  2W6J G;  1Q8I A;  3BFR A;  4B3R O;  1CP9 A;  4WFE A;  2WLI A;  1FJG B;  1GAX A;  2JRI A;  4I55 B;  4DW0 A;  1DGS A;  5CA3 A;  5EBL C;  2X6C A;  4ABM A;  3N2K B;  2JS5 A;  2VQF B;  1B04 A;  2ITC C;  1FXK C;  4YJ3 B;  3CCL V;  2E75 B;  1FFX B;  4IHJ A;  2WA4 A;  1K3E A;  3O65 A;  4O4H A;  1NZ6 A;  3OTO B;  2DW4 A;  3PN1 A;  1AI6 A;  3U10 A;  3EVK A;  4CC6 A;  1X4T A;  1PD3 A;  1GM7 A;  1W59 A;  3KKY A;  3ZHQ A;  1WP8 A;  1R3J C;  4LNU B;  4EB6 B;  2KSD A;  1Z5W A;  4I50 B;  4IYH A;  4GKK B;  5H9C A;  4JI3 B;  1N36 O;  5LGU A;  1EZJ A;  2M7W A;  2HFE C;  1IX9 A;  1ZLZ A;  3CJH B;  3B8M A;  3ZRW A;  3AG3 C;  1NH2 B;  1ENV A;  4YIO A;  3DXR B;  3KG2 A;  2Q5Z A;  2P22 C;  5EK0 A;  2WLK A;  2JGD A;  3L70 H;  5IY5 C;  2P06 A;  1FYJ A;  1NH2 D;  5B1O A;  2X7R B;  2BTQ B;  5EBM C;  5DED A;  3T1Y B;  3A8T A;  3BEH A;  3JAL B;  1RP3 B;  2XAJ A;  2EJ7 A;  4A5U B;  1PNK A;  1Q5O A;  5JJN B;  4JI5 O;  5KHK A;  3ZHT A;  4N21 A;  1XNQ B;  3CD6 V;  2ZM6 O;  5LMN B;  2ZE7 A;  4NYK A;  5CN0 A;  5LXT A;  1JMK C;  2XT9 A;  3E83 A;  1GRJ A;  3OUF A;  2GSM B;  3K06 A;  5J2U B;  4DK0 A;  2Q68 A;  4K8Z A;  4DV5 B;  3F5W C;  3VOU A;  2Y69 C;  5K1P A;  3BPZ A;  3VQX A;  1BHA A;  1SF9 A;  4OXS A;  2GTS A;  5EYP A;  4DR7 O;  1FS0 G;  1P49 A;  4B7E A;  1IBK B;  3K5N A;  3AK2 A;  4DK1 A;  2RQ6 A;  2QWQ B;  3K04 A;  1XNR B;  5JCO C;  1PP9 H;  4O4H B;  1U97 A;  5JVD B;  2PZS A;  1S3J A;  4NXN O;  2ZDI A;  5IJ9 A;  1US6 A;  3M7M X;  5GTI Z;  4TV8 B;  3K9A A;  5K1X A;  4JYA B;  3ZMS A;  1H2K A;  1BQ0 A;  5F2V O;  1ZX3 A;  1JJ2 U;  4FLZ A;  3CYO A;  4NB5 A;  2AZ0 A;  1OCO B;  1P7B A;  3OD4 A;  1Q6H A;  5BMV A;  2HJF C;  4DV1 O;  2UXB O;  5HFM A;  5L3G A;  5IYD O;  2UU9 O;  1L1F A;  2EIN C;  1WAZ A;  3CPW U;  1PNL A;  1G6U A;  2ZR2 A;  1Q6I A;  2OCH A;  1WJZ A;  3DC6 A;  3ZMV A;  4CS3 A;  4UVC A;  3N2K A;  4JI0 B;  2DE0 X;  2GTA A;  5C93 A;  3T4Z A;  5IY5 B;  4PHZ A;  2ZCE A;  2BOC C;  2DOS A;  3L74 H;  4UCS A;  2JJ2 G;  2MK3 A;  4J7K A;  4R7C A;  4P2Z A;  2JEX A;  3H1H H;  1I5X A;  1D5N A;  1AI7 A;  1EN6 A;  1KKC A;  2UXX A;  3L71 H;  4O2B A;  5KHJ A;  2YXL A;  5BXZ A;  3ABK C;  1G4Y B;  1E1R G;  2HHH B;  2UUB B;  1R6T A;  3E86 A;  1SRY A;  3HKD A;  3FB8 C;  4I9W A;  1Y74 A;  4LWS A;  3H1K H;  4MTX A;  4P30 A;  1J5E O;  1TUB B;  2LP7 A;  2BTO A;  4X65 B;  3ZS8 C;  2XAH A;  3ASO C;  3RYF B;  3Q4H B;  1D2D A;  1XOU A;  2F66 C;  1RPO A;  5H6Q A;  2IU3 A;  1I7F A;  2D2C B;  1VQL V;  4BW5 A;  5L3E A;  3J7A U;  2QM7 A;  3HKC A;  3LDC A;  3U0Z A;  3OMN B;  1NR1 A;  4NTY A;  4LF8 O;  1K7D A;  3CCQ V;  2YSU B;  4MTF A;  1VQ9 V;  1H2M A;  2P5O A;  1GTO A;  2WAM A;  1NKD A;  3CX5 F;  3OR7 C;  2KG7 B;  5LP6 B;  3G6B A;  3S3W A;  3JSN A;  4WFH A;  1FAF A;  1KD1 W;  1OV9 A;  1GM8 A;  4ZI7 B;  4PDM A;  2A9H A;  1I94 B;  1P4R A;  3K79 A;  3KCY A;  5LA6 A;  1F7Y A;  4J7J A;  4R50 A;  4LNU A;  2QWP B;  3UO2 A;  4MS2 A;  4PA6 A;  1SES A;  4UVB A;  2HR3 A;  3L9D A;  5IYB O;  5BY1 A;  5B5E Z;  1XUQ A;  3M99 B;  1HDJ A;  4FIP C;  4X1K B;  1EZV H;  1NI8 A;  5LOV A;  5KA5 A;  3WG7 C;  1ZTE A;  3TGU H;  1QNM A;  1M57 B;  1MNG A;  2B1G A;  1J95 A;  4PA7 A;  4MTG A;  1KP2 A;  4NVP A;  4UXN A;  1N34 B;  4I7Z B;  4KL1 A;  4FLV A;  3HKD B;  4LP8 A;  4YJ2 A;  1OCC C;  4GX1 A;  2ZIM A;  4XDJ A;  2UUC O;  1JX9 A;  4I5S A;  2DWD C;  3JAL A;  2ZKO A;  4DYL A;  3E89 A;  3O9O A;  4EFB A;  3JD3 A;  5J2T A;  5KHI A;  4B3S O;  3CCU V;  3ZMT A;  1S5H C;  2YI8 A;  2Q4P A;  2XUM A;  4KHP O;  2KQX A;  2XTA A;  1Q7Y W;  1Y66 A;  2BSK A;  1O9H A;  2H3O A;  3RBZ A;  4DRX B;  5LP6 C;  4FM1 A;  2OIG A;  4X9Q A;  3MAQ A;  4ZKI A;  4DV6 O;  5EIB C;  2KKW A;  5KX5 B;  1FJG O;  4HYO A;  3VQW A;  3H01 A;  4JI6 O;  3B4S A;  2HKO A;  3L72 H;  3SYC A;  2NLJ C;  1JFF A;  2PGG A;  4HAM A;  4Z1V A;  5JH7 A;  4DV4 O;  4X1I A;  5DN6 G;  3JAW B;  4F4L A;  2DMX A;  4UCV A;  4I4T B;  2HHH O;  2F43 G;  2N04 A;  2FKX A;  1UFI A;  5L3D A;  1MOF A;  1V54 B;  3JCU Z;  1HNW O;  3I55 V;  4X66 O;  4ZBM A;  1Y76 B;  2Z5U A;  2A79 B;  3D3I A;  3AG4 B;  4H0L B;  4U7O A;  4O2B B;  4ZOL A;  3X2Q B;  4KXR A;  3T1H B;  4CS4 A;  2DQ3 A;  4DR5 O;  1XMQ O;  1PM9 A;  2UUC B;  3RYF A;  2XND G;  1QCE A;  1S77 D;  1HNX B;  1VF5 B;  3SPC A;  1ZUQ A;  4NR1 A;  1SC5 B;  3OE7 G;  2PI5 A;  1VQP V;  4OX9 O;  4DR1 B;  3CC7 V;  3LDE A;  3SPI A;  1ZAU A;  4YJ2 B;  2ZD9 A;  1X59 A;  4UB8 Z;  1J5E B;  3C90 A;  5GTH Z;  1NU1 H;  3JAR A;  2F4V B;  2A7W A;  1MZE A;  4DR6 O;  4H44 B;  4J11 A;  5LHG A;  4KUM A;  5J2T B;  1SQQ H;  3QO8 A;  3P32 A;  3TXS A;  3CCE V;  1THZ A;  4D6T H;  1MG1 A;  3W7T A;  1Z5V A;  3ABM B;  3JD4 A;  1TVK A;  1S0V A;  2OCC B;  5KUK A;  2OCC C;  1V54 C;  1BZK A;  1JJO A;  2BSK B;  2V1D A;  3CHX A;  2LO1 A;  4YHH O;  5IJ0 A;  3TJT A;  3T1C A;  4DV5 O;  3K03 A;  3RYH A;  4UUJ C;  5GW7 A;  4IL6 Z;  1VQM V;  4X89 A;  4LF5 B;  2CTQ A;  3ZCC A;  2UXN A;  1OCC B;  1TAE A;  2B9Z A;  1HW7 A;  2DYR B;  1BGY H;  2A3Q A;  4I4T A;  3SDL A;  3UKM A;  1GN2 A;  4X64 B;  1YEW A;  4O4L A;  1Y6X A;  2XAG A;  4E2L A;  4DV0 B;  1HWY A;  4QPK A;  4FLU A;  1QLE B;  3BAA A;  1QLE C;  5KHH A;  4O2A A;  3T1Y O;  2PYL A;  1EM1 A;  3RVZ A;  1XNR O;  4LBE C;  4WFB V;  2CTR A;  2GV9 A;  1K33 A;  2IM9 A;  3AG4 C;  2A06 H;  5E79 Z;  1K4D C;  3ETD A;  1QU7 A;  2O57 A;  4JGS A;  1AJN A;  4NKG B;  3T4D A;  4CH5 A;  1ORQ C;  3E2E A;  4MVM A;  1NVP B;  4Q6G A;  3ABL B;  1JFF B;  3CRC A;  3T2M A;  4CZZ A;  1NT2 B;  4DXW A;  3E22 A;  2ZQM A;  2C2A A;  2YXY A;  2HVJ C;  2X6B A;  3MD0 A;  1M1K W;  3TET A;  4RQF A;  3SJQ C;  2Q67 A;  2Q7E A;  1ARO P;  3OT7 A;  1E1Q G;  3FAV B;  2UUA B;  1XHX A;  4ZOL B;  1DF5 A;  2ADQ B;  4PDL A;  3G6E V;  3ETQ A;  2AHY A;  4J7Z A;  4LF9 B;  5EIB D;  5IJ0 B;  1FFT B;  3ABK B;  2R72 A;  2ZXW C;  4BIZ A;  2JEU A;  5J9P C;  4U7N A;  2QWR B;  1MSW D;  4JYY A;  3QO5 A;  2GUZ B;  1FXK B;  2B5U A;  4JPR A;  4GKK O;  1WPX A;  3ZRX A;  2P90 A;  3H1L H;  3IC7 A;  4YIP A;  4DV2 B;  4YY3 O;  2UU9 B;  4IIJ A;  2Q0O C;  2P7T C;  1Q6U A;  5BR8 B;  3QG5 A;  2CUG A;  2VQE B;  1YTF B;  4DV2 O;  2YIA A;  2VRZ A;  1YXB A;  2EIM C;  4DR4 O;  2Y4U A;  2JGU A;  2ZDI C;  1N8R W;  1JPX A;  2EIJ B;  2W0X A;  1R3I C;  2QKA A;  2EUL A;  1M56 B;  1L8D A;  3K59 A;  5CBG A;  3CCV V;  4LF6 B;  3ZED A;  2Q9L A;  2IJH A;  2HLD G;  3CE2 A;  5KMG A;  1M93 A;  3FD9 A;  3M8A A;  3CC4 V;  1Y67 A;  2ZR3 A;  4TWK A;  2F4V O;  5B66 Z;  1BMF G;  4X8A A;  2AW9 A;  1TGO A;  4O4I A;  1MAB G;  3DSQ A;  4B3R B;  2Q69 A;  4J42 A;  2EJR A;  3ZHV A;  3IC9 A;  2IH3 C;  4JZ2 A;  2BCC H;  4GX0 A;  1OCO C;  2EIK B;  1M9N A;  1QBZ A;  3OGI B;  4JYB A;  4I0X A;  5IT9 N;  2X6A A;  1YHQ V;  1NBM G;  5EYP B;  4FLW A;  2UXC O;  4FLX A;  1IBL O;  1BSM A;  3RYI B;  4KHP B;  1V55 B;  4MVQ A;  4J41 A;  1GO3 F;  2F93 B;  3SJB C;  3K9S A;  1N4C A;  1AJQ A;  4PI2 A;  4TUY B;  3STL C;  1YCI A;  3SYQ A;  2DN9 A;  1SS3 A;  4DUZ O;  4TQF A;  3EFF K;  5JQG B;  2AHZ A;  1R6N A;  2IJI A;  4WFF A;  5JJE B;  2K1E A;  3UT5 A;  2Q7G A;  3SYO A;  3E8G A;  4DV0 O;  3UQ8 A;  4FM0 A;  3E22 B;  4JI4 O;  3OR6 C;  3CSX A;  5IWA O;  3HKE B;  3QNE A;  5CB4 A;  5LHH A;  2ZE5 A;  1HNX O;  1PL0 A;  1WB7 A;  2EIL B;  4WBN B;  3ZMZ A;  5KLV H;  2CK3 G;  1OJH A;  4K35 A;  5AG2 A;  4QJF B;  1SQP H;  3SPG A;  3OMA B;  4XBF A;  1CXZ B;  5KAF Z;  3K0D A;  4LH7 A;  2WLM A;  5L3B A;  2DWE C;  4PA4 A;  1VIB A;  3CXH F;  4AQY O;  4DR2 B;  4ZHQ A;  4X66 B;  4TV9 B;  4I0X B;  5KUM A;  5DM6 V;  2X0L A;  3L75 H;  2VQF O;  1ZL8 B;  1K8A W;  3Q4H A;  3ZBH A;  3H1I H;  3W7U A;  3B40 A;  3BVO A;  3ZN1 A;  1FFX A;  4IHJ B;  4I9Q A;  2NN4 A;  3GWK C;  3S3X A;  3IAY A;  2BE3 A;  2LQT A;  3UM7 A;  4K3A A;  3ASN B;  4ASU G;  1K34 A;  1OCR C;  3TCU A;  2V4D A;  1NQT A;  3DGE A;  4X62 O;  1KQS U;  4GCZ A;  1SA0 B;  1KB9 F;  2R9R B;  4DR2 O;  1QQC A;  2DYR C;  4PA9 A;  1GH6 A;  2YEV A;  3CWB H;  5A9G A;  5EBW C;  1K9M W;  1L0N H;  4U3J B;  2EIL C;  4IT5 A;  1JR9 A;  4B3S B;  3LSS A;  5JQG A;  2ZIN A;  3F7V C;  4I55 A;  3DXR A;  1VQN V;  1M4U A;  2ATK C;  1XMO B;  1VF6 A;  4B3M B;  2QE7 G;  3H1J H;  4DUY B;  4N23 A;  3F5T A;  5C8Y A;  2GDS A;  3AEI A;  2IBZ H;  1VQ7 V;  4YY3 B;  1R6K A;  3CCJ V;  3WFV A;  5FL7 G;  2DQ0 A;  2D3O W;  1Q3E A;  1I08 A;  1EN4 A;  2FML A;  2JJ1 G;  4WBN A;  2F1M A;  1YJW V;  4DV7 O;  4OPA A;  2N74 A;  1HR0 B;  2WLH A;  1K97 A;  3ZRV A;  1QR8 A;  4F6E A;  3D8C A;  2YIB A;  2P4K A;  4X88 A;  2QA4 V;  4X20 B;  2IJK A;  4JZG A;  2E5L B;  1I5Y A;  1UPG A;  5IE9 A;  4WFA V;  1KBH A;  2EIN B;  5LMU O;  2L35 A;  2UUA O;  1NTZ H;  4P9P A;  3UO3 A;  4UFZ A;  1YJ9 V;  1FD9 A;  4TV9 A;  1IZ3 A;  4JI2 B;  1VEW A;  4PDV A;  1KUQ A;  4MW3 A;  2IU0 A;  1NJI W;  1ZL8 A;  1R3K C;  1H38 A;  4JI0 O;  1JVM A;  1AIL A;  3KZI Z;  1H2G A;  5CA0 B;  2NNU A;  5JCO A;  2Z0A A;  3OAA G;  2VQE O;  1MSD A;  1RSO B;  1KYO F;  4GX5 A;  1AJP A;  1CPY A;  2XAF A;  2E3C A;  3CRQ A;  4Q20 A;  1EFR G;  3ETE A;  2YC0 A;  2WWW A;  2AGA A;  3E35 A;  2OYQ A;  4XDL A;  4LF7 B;  4BWA A;  1WB8 A;  1AP5 A;  2ARH A;  4FZ1 A;  4GZR B;  5FNV B;  1I0H A;  3HR0 A;  1VF6 C;  3TK1 A;  3A0R A;  3ZRW B;  1BL8 A;  4TOI A;  1S76 D;  1EBO A;  1VP7 A;  3BAB A;  1SQB H;  1V9P A;  2EIM B;  1WLE A;  3QO7 A;  3WB0 A;  1SZX A;  3QTC A;  4MVS A;  4PV1 B;  1HP8 A;  2A0L A;  5J2U A;  1QVF U;  2DYS C;  2Z3Y A;  2OT5 A;  3I5D A;  3HKE A;  1S5J A;  4DR4 B;  5CB4 B;  3K5O A;  2UXC B;  5JVD A;  2OIE A;  4AIL C;  3RW0 A;  5LGT A;  1BS3 A;  1VQ4 V;  3FFQ A;  3ZIA G;  1VMG A;  4LF5 O;  3ZMU A;  1F4N A;  3JSL A;  3MHS C;  3L73 H;  3OEH G;  3SR2 C;  4LR3 A;  4UV8 A;  3JAT B;  4HNA B;  4OPH A;  2LGW A;  2E76 B;  4CBC A;  5FPO A;  2LW7 A;  3ASN C;  1RPR A;  3ETG A;  5BMV B;  1IBM B;  3GB7 C;  1YVW A;  5KHG A;  4NXN B;  1OCZ C;  3JCZ A;  1NS1 A;  3WB1 A;  2CTP A;  2RN9 A;  4CC5 A;  2MW2 B;  4I50 A;  3FKS G;  4Z1M G;  1CEZ A;  2XAQ A;  3CCM V;  3CRR A;  1K5S A;  3D36 C;  3MHH C;  1XQ8 A;  4DR7 B;  4KFM A;  3ABL C;  1SZT A;  1XEQ A;  1YZB A;  2B1I A;  3B09 A;  2FYU H;  5FNV A;  5JWP A;  3LSQ A;  1GMG A;  4KP4 A;  4QE9 A;  4BW9 A;  1OHH G;  3ICX A;  3P30 A;  4FFB A;  2ZIO A;  1AB3 A;  2BTQ A;  1KKD A;  3OGC C;  4DV1 B;  5GON A;  2EBO A;  4LWS B;  2CE4 A;  1V55 C;  3OTF A;  1XMO O;  1MZF A;  1TUB A;  4IYI A;  1G8M A;  1Q86 W;  1IXB A;  4AHC A;  2QKS A;  4YHH B;  4JI5 B;  4RUF A;  1LR1 A;  4GYC B;  4UV9 A;  4CH4 A;  3K5L A;  5EC2 C;  2R70 A;  1COW G;  1KEC A;  2UXD B;  5EZY B;  1JNB A;  1M90 W;  3RVY A;  4R8C A;  1NTM H;  1RM1 C;  1FOU A;  4LF9 O;  5IYC O;  4UCU A;  1U96 A;  2QR4 A;  2E5L O;  2AZ2 A;  4J10 A;  4UVA A;  3H9V A;  3ZHR A;  3RT3 C;  1OCZ B;  2JS3 A;  2GBO A;  2PY5 A;  3P3P A;  4DV7 B;  2EX3 A;  2HJD A;  2LW1 A;  2QM8 A;  2RJZ A;  3K08 A;  4XDK A;  2HEP A;  4UCR A;  1BT8 A;  4GUN A;  4FMT A;  1Z2G A;  3LSU A;  3A0B Z;  2QTS A;  2Y0P A;  3SYP A;  4X20 A;  4FPP A;  4U3F H;  3LNN A;  2QGN A;  4HNA A;  4YXW G;  2LJ2 A;  5IYZ B;  2ZM6 B;  3SGI A;  1XHZ A;  5IJ9 B;  3SPH A;  2QDO A;  1JA8 A;  2OTL V;  1XMQ B;  3BCC H;  4PA3 A;  1DLB A;  1Y4M A;  3ZX6 A;  1VAR A;  4DR5 B;  3CP1 A;  4ICG A;  1XIL A;  2Y0I A;  5LA6 B;  3OTO O;  1K73 W;  2DJV A;  4JTD B;  3CEI A;  1AR5 A;  4X1I B;  3STZ C;  2YI9 A;  3GWO A;  3W7S A;  1W0K G;  4J9Y B;  1HNZ B;  4NXM B;  2P67 A;  2CGO A;  5B1A C;  4W4K A;  2HVK C;  1YI2 V;  3K5M A;  3ML0 A;  2WSS G;  3OMI B;  4GKJ B;  5CA1 A;  1WPB A;  2W6I G;  3QF7 A;  1E79 G;  5B3S B;  3RN4 A;  5CBH A;  1AR4 A;  1VQ6 V;  3JAS B;  4FFB B;  2GHY A;  4JI7 B;  1WN7 A;  5B1B C;  1H8E G;  1GN3 A;  4HBN A;  3JAM N;  3AG2 C;  3JAT A;  4GKJ O;  5LYJ A;  4FLY A;  2QSA A;  4E4E A;  2ADP A;  3AG7 A;  4J9Z B;  4B3M O;  4LF4 B;  4EFE A;  2W0F C;  2LFS A;  5B1N A;  1YSC A;  2EIJ C;  4LFA O;  3CCR V;  3G67 A;  5KMG B;  2JDI G;  1GN6 A;  1R73 A;  4YJ3 A;  3W7W A;  3T1H O;  4W4L A;  3CRA A;  5LBQ A;  2OWO A;  1IVS A;  1GM9 A;  2ZE6 A;  4X1K A;  4MVZ A;  3RFR A;  2EIK C;  1VQK V;  1YIJ V;  1O9G A;  1KC8 W;  1IJG A;  1UJW B;  3AG3 B;  4B7K A;  3CCS V;  4PD4 F;  2WPD G;  3ZHU A;  1H2L A;  4AI8 A;  2ZE8 A;  4B3T B;  4JTC B;  4JAV A;  4DV4 B;  1KMI Z;  2PI4 A;  4JV5 B;  4PI0 A;  4DR1 O;  4EB6 A;  3HB3 B;  5FLX N;  2Q73 A;  1BHB A;  1JOY A;  5IYZ A;  2YUA A;  4QGP A;  1YIT V;  1VQ8 V;  1SET A;  5CBF A;  3QVN A;  3J80 N;  3ZRS A;  5JH7 B;  3AK1 A;  4JAA A;  3JAW A;  5H2F Z;  4LC1 A;  3SJA C;  5A2Q N;  3I56 V;  4RQE A;  3JAS A;  5KX5 A;  2RMK B;  3LUT B;  2RNB A;  3GVM A;  3HKB A;  1W2B U;  4LFA B;  4C7U A;  2N05 A;  5CA1 B;  5DEC A;  1IBL B;  4PEL A;  1RM1 B;  4L87 A;  4BIO A;  1AR1 B;  4NTX A;  2IW5 A;  5BR8 O;  5L3C A;  2JVD A;  3RYC B;  5GON B;  4LCU C;  4LFB O;  1IDS A;  2ITD C;  5IWA B;  1G1X B;  3MDS A;  4JF3 A;  1Y76 A;  3BY6 A;  3KCX A;  5CMU A;  2Y48 A;  1OCR B;  5LYJ B;  3FYI B;  4JV5 O;  5JJJ B;  3R66 A;  1SQX H;  1FXH A;  1K92 A;  2Y4T A;  4JI1 B;  3OEE G;  1N33 O;  4BIU A;  4K0K O;  5EZY A;  2WLL B;  3W7X A;  1T5E A;  3RYH B;  1JCH A;  1XDC A;  4DV6 B;  2UUB O;  2P6J A;  2VWJ A;  4H37 A;  2CAZ C;  1TUE B;  1S72 V;  1RFY A;  1I94 O;  2XAS A;  1PPJ H;  3CB2 A;  2HG5 C;  4LFC B;  2K9P A;  3K3W A;  1QVG U;  1YDX A;  4Z2W A;  2RCV A;  1YTF D;  3RWR D;  4ZHQ B;  3OUS A;  1QR9 A;  3OFN G;  1XL6 A;  1ROP A;  3APQ A;  1AVM A;  4O2A B;  3ABT A;  1MA1 A;  3JAR B;  4LF4 O;  4LF8 B;  4O4J B;  1Q43 A;  1FPO A;  3TXQ A;  2P4V A;  1VF7 A;  5LL6 Y;  5H6R A;  3E8H A;  2ETN A;  1KP3 A;  2PUS A;  4ZIB A;  3BHP A;  5IDJ A;  2PF4 E;  2F23 A;  4TSF G;  4GX2 A;  2RDC A;  3K0G A;  3R65 A;  3SJC C;  1GKF A;  2ILM A;  2QJ1 A;  1F23 A;  1P84 F;  4TQD A;  1Q82 W;  2YEV B;  4BR6 A;  2FL4 A;  2YDE A;  4U3J A;  2DYS B;  1NTK H;  3CS5 A;  3A2F A;  2UXD O;  4JI8 O;  2CGN A;  1IBK O;  5FPR A;  2R9A A;  2Q7H A;  3NR7 A;  4D7T A;  2G38 A;  1NVP D;  1NR7 A;  3K58 A;  1PNM A;  1PL4 A;  4O4L B;  1OZ0 A;  4JI3 O;  4B08 A;  3UCS C;  2QWO B;  1DTO A;  5E1A C;  5EC1 C;  1M56 C;  3P3N A;  1MMM A;  3K57 A;  3KDR A;  3WU2 Z;  1IUR A;  2CH7 A;  1VQ5 V;  3BA8 A;  4DO2 A;  3FX7 A;  4MT8 A;  1L0L H;  1XNQ O;  4FJC C;  4DV3 O;  1TVK B;  3VQV A;  1TA8 A;  1XRE A;  3HKC B;  3ABU A;  3G80 A;  1WNS A;  3B8N A;  4JYA O;  1QHT A;  4RWU A;  5D5P A;  4QIW F;  4G28 B;  4LFC O;  3CRM A;  3RGB A;  5B3S C;  3CME V;  2M6Y A;  2KG7 A;  4RO2 A;  3HKB B;  3VBB A;  4R6Z A;  4MVU A;  4WCE V;  5LP6 A;  4F6R A;  3N2G B;  1AI5 A;  2GUZ A;  1AI4 A;  4DR6 B;  2LGQ A;  4ZI7 A;  2WLJ A;  3F7Y C;  1QLN A;  4LF7 O;  2QTO A;  3RYC A;  4FK5 C;  3NXS A;  2YID A;  1RSO A;  4EEQ A;  2IJJ A;  2QWN B;  1H8H G;  4DV3 B;  1H2S B;  3FAV A;  4FFK A;  4FZ0 A;  5KA6 A;  3EXA A;  1N32 B;  2H8P C;  2QKC A;  1F4M A;  5H5N A;  4G2K A;  4K8X A;  4RAI A;  5LOV B;  1N32 O;  1WA8 B;  3DC5 A;  4H33 A;  1FXK A;  3OM3 B;  3ABM C;  4UCT A;  1K4C C;  3AG1 C;  1EN5 A;  4O4I B;  2BOB C;  2L6L A;  2PYJ A;  2FB5 A;  4IIJ B;  1R3L C;  2EZP A;  4FM2 A;  3D36 A;  3U11 A;  3JAK A;  4X1Y A;  4JI2 O;  3G4S V;  4JI8 B;  4PJ0 Z;  3EHB B;  1SQV H;  5LMU B;  1SER A;  1GK9 A;  3J81 N;  2EZO A;  1M57 C;  5B1A B;  2YXH A;  3A0H Z;  3FB5 C;  4WFG A;  4J80 A;  2ODM A;  1IBM O;  1B6Q A;  4MW8 A;  1HR0 O;  1YJN V;  4O4J A;  1N33 B;  4JI1 O;  4DRX A;  1URF A;  2HP8 A;  3C3T A;  4QPJ A;  4BAY A;  4OX9 B;  4TT3 G;  2YIC A;  4JI6 B;  2CH7 B;  1FKA O;  2WLL A;  1IXM A;  3AG2 B;  3IFX A;  5LGN A;  1AP6 A;  2ZNJ A;  5B1B B;  3CC2 V;  4PDR A;  4LFB B;  1SQF A;  4JAU A;  2CDY A;  4DW1 A;  2LFR A;  3CXC U;  4JAS A;  3FYE B;  5LMN O;  4MVR A;  2YS8 A;  1B3Q A;  4TUY A;  3UT5 B;  3JD2 A;  2WLI B;  2IH1 C;  3G71 V;  3THO A;  3FB6 C;  2WLN A;  3DTU B;  2JIZ G;  1M5I A;  1DF4 A;  4GT1 A;  2Q8V A;  3VQY A;  2JGD B;  2QEX V;  1VQO V;  4GLX A;  1HNW B;  4OGQ B;  1ZWI C;  4FVM A;  2WA3 A;  4JTA B;  1Q81 W;  5D5Q A;  3JD0 A;  3ZN0 A;  1BQZ A;  3RYI A;  3ASO B;  2V7Q G;  3C3S A;  5ITZ A;  4JI4 B;  2ZXW B;  4D7S A;  4JI7 O;  3B77 A;  4MSW C;  1XBL A;  4X64 O;  3E8B A;  1LUW A;  1WA8 A;  1N36 B;  4DR3 O;  4NTW A;  1P7G A;  4H13 B;  3ZJZ A;  4CS2 A;  3LNM B;  2AXT Z;  2XOK G;  2Q6A A;  2H94 A;  3LDD A;  3N27 A;  3CJH A;  1XL4 A;  3JAK B;  3PJS K;  3SYA A;  1S5L Z;  1WP7 A;  4NXM O;  2ZNI A;  1SQG A;  3FB7 C;  2XHB A;  1PKX A;  1KU9 A;  1BCC H;  3AG1 B;  1BE3 H;  2FTK A;  4RUE A;  4F6R B;  1H2N A;  4L8J A;  5HFL A;  1Q90 D;  1W0J G;  4G27 B;  3ZHS A;  2JK5 C;  1N34 O;  3IGA C;  3SPJ A;  1D5A A;  2NR5 A;  3OW2 U;  4MTO A;  3E8F A;  2PTM A;  3BRC A;  3B2E E;  4HZ3 A;  3APO A;  4LH6 A;  1H5W A;  4K0K B;  5KAI Z;  3JYC A;  4TV8 A;  5BZB A;  1YF2 A;  1DK1 A;  4FLT A;  1SKV A;  3D3Q A;  5LXT B;  3IJ4 A;  4UCO A;  4X65 O;  1R1B A;  1SA0 A;  4B3T O;  5CA0 A;  4QE7 A;  5LHI A;  3WG7 B;  2CTW A;  3JD1 A;  4MVO A;  3X2Q C;  4X1Y B;  5L3F A;  4DUY O;  1ZSP A;  3N2G A;  4DUZ B;  1A32 A;  1LUV A;  2E74 B;  1HNZ O;  4AQY B;  5ITZ B;  4EKW A;  1FXV A;  4LF6 O;  2QM4 A;  4QNH B;  4CH6 A;  5C8Y B;  2F95 B;  2VWK A;  4IGG A;  1XI1 A;  1N0N A;  2VS0 A;  4CH3 A;  3HPL C;  4WF9 V;  3CMA V;  3AK3 A;  1LNQ A;  3WB2 A;  2YIB D;  2KB1 A;  2ZT9 B;  4X62 B;  4UB6 Z;  1JQ0 A;  2R9I A;  4P9O A;  2UXB B;  2Q0A A;  4JYC A; 
#chains in the Genus database with same CATH homology
 1SZX A;  1N0J A;  1WB7 A;  4E4E A;  2ADP A;  3MDS A;  1GN4 A;  1B06 A;  1PL4 A;  1KKC A;  1D5N A;  1EN6 A;  1I08 A;  1EN4 A;  3BFR A;  5AG2 A;  1Y67 A;  1BS3 A;  1GN6 A;  1XDC A;  1MMM A;  4F6E A;  3KDR A;  2AW9 A;  2P4K A;  3C3T A;  4JZG A;  1XRE A;  1BT8 A;  4GUN A;  3IC9 A;  4JZ2 A;  1AP6 A;  2RCV A;  3LSU A;  4X9Q A;  1VEW A;  2CDY A;  3AK2 A;  3OT7 A;  3EVK A;  2ADQ B;  3TJT A;  1AVM A;  1BSM A;  1JA8 A;  1MA1 A;  1MSD A;  3KKY A;  1VAR A;  3K9S A;  1XIL A;  3QVN A;  3CEI A;  1AR5 A;  4JYY A;  1ZSP A;  3AK1 A;  1GN2 A;  1IX9 A;  1LUV A;  1ZLZ A;  4YIP A;  4FFK A;  4YIO A;  5A9G A;  1WB8 A;  1AP5 A;  2QKC A;  1I0H A;  1JR9 A;  3RN4 A;  1N0N A;  3DC5 A;  3C3S A;  2CE4 A;  4C7U A;  1AR4 A;  3AK3 A;  1XUQ A;  1EM1 A;  1PM9 A;  3DC6 A;  4BR6 A;  1IXB A;  1EN5 A;  1LUW A;  2GDS A;  2QKA A;  1GN3 A;  1P7G A;  1ZTE A;  1QNM A;  1IDS A;  1ZUQ A;  1MNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...