1LUVA

Catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic and structural effects of amino acid substitution at histidine 30 in human manganese superoxide dismutase: insertion of valine C gamma into the substrate access channel
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1luvA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1luvA02
2GDSA 3BFRA 1IX9A 1BSMA 2CE4A 1GN6A 4GUNA 5A9GA 1EN4A 1AP6A 1WB8A 1PM9A 3RN4A 1I0HA 1XUQA 1MSDA 2RCVA 3K9SA 1EN6A 1AR4A 3CEIA 1B06A 1N0NA 1SZXA 1XILA 4JYYA 1D5NA 2CDYA 1I08A 3C3TA 1GN3A 3MDSA 2ADQB 3OT7A 2QKAA 1MA1A 1IXBA 1JR9A 1GN2A 3DC6A 1ZUQA 5AG2A 1VARA 3DC5A 1WB7A 4YIPA 1EM1A 1QNMA 3IC9A 1P7GA 4C7UA 1EN5A 1XDCA 3LSUA 1PL4A 1AR5A 3TJTA 1JA8A 3AK1A 3C3SA 1GN4A 1MNGA 1VEWA 4YIOA 4FFKA 3AK2A 3KKYA 1LUWA 3EVKA 3QVNA 1ZSPA 4E4EA 1MMMA 2AW9A 1IDSA 1XREA 1Y67A 2QKCA 4JZGA 1ZLZA 1BS3A 1N0JA 2ADPA 2P4KA 1KKCA 3AK3A 4X9QA 4JZ2A 1AVMA 1ZTEA 4F6EA 1LUVA 4BR6A 1BT8A 1AP5A
chains in the Genus database with same CATH superfamily
2GDSA 1V9PA 4DR7B 2JK5C 1IBKB 1HP8A 1NTMH 4LNUB 2VS0A 3T1HB 5A2QN 4DW0A 2V7QG 1RM1C 3CEIA 5EIBD 1M4UA 4JI8O 2HHHO 1PL0A 1DF4A 3BAAA 4XBFA 4YY3O 1KYOF 4FLTA 1CEZA 2Q69A 4X64O 2W6JG 1OCOB 4GX5A 2WAMA 5LGTA 2H94A 2HKOA 4JASA 5D5PA 2F4VB 4EFEA 1EBOA 4B3SB 3BEHA 4MT8A 5J2UA 1Z2GA 2ZR3A 4JYAB 2BE3A 3IFXA 4TT3G 3LDCA 3GVMA 2ZR2A 3E83A 3E22B 2F1MA 5B1NA 1JNBA 3QO5A 5KUKA 3CS5A 1H2GA 1MZEA 3C3SA 5GONB 1NZ6A 3L73H 4X64B 5CA0A 4JAAA 1Q82W 2HVJC 1QLNA 3ZJZA 1KUQA 2EIJC 4OX9B 1K92A 3CRCA 4X62O 3RYHA 4QPKA 4FFBA 4O4HB 4DRXB 5B5EZ 1W2BU 4GT1A 2Q0OC 3BRCA 1X59A 3JSLA 3KG2A 5LYJA 2OYQA 4O4LA 1BL8A 3HKBB 2M6YA 3PJSK 4X89A 5EC1C 1RP3B 4DV3B 4NTYA 3FX7A 4TWKA 2ADPA 1OCCC 4B3RO 2Y48A 1K9MW 1KKCA 4MS2A 4D6TH 2X6CA 1ZTEA 3RBZA 2DYRB 4P9OA 1VF6A 1R6KA 5B1BB 2PY5A 3K5NA 2CTQA 1AP6A 3JCZA 2XASA 3B40A 2EINC 1GRJA 2XAQA 4JI8B 2WLIA 2YI9A 3W7SA 4H37A 4A5UB 3ZN1A 1NBMG 5H5NA 2UUAO 4KFMA 1XMQO 4DR7O 2QKAA 2X7RB 1CPYA 5JWPA 2NLJC 2IJKA 4IHJA 3AG3C 4JI7O 2JS5A 2N04A 2YIAA 4LR3A 3B4SA 3SPHA 4ZOLA 4I4TA 4ZBMA 2IH1C 2XNDG 5LXTA 3RT3C 1V55B 3G80A 3ABMC 2KG7A 2UXNA 4FK5C 1SERA 2EILC 3CCQV 1GN4A 3CRAA 2Y69B 4YJ2A 1Q6HA 3OW2U 1K73W 1TAEA 2ITCC 1VF5B 2IW5A 4FPPA 5JQGB 2VQFB 3FD9A 1ZSPA 4E4EA 3ABTA 2QM8A 4LF6O 1I5XA 2F93B 5EC2C 2Q9LA 1RPOA 1URFA 1KBHA 1VQ9V 5EZYA 1J95A 2E5LO 4WF9V 1XOUA 1N0JA 3FB7C 4PDMA 1MABG 3U10A 5BMVA 1TGOA 2JGUA 2UUBO 3AK3A 1YJNV 2JVDA 4FLZA 1WAZA 2CK3G 1MZFA 4P9PA 1AILA 3D36A 1JVMA 4DK0A 2A3QA 2JJ1G 1AP5A 5IJ0B 2UXDO 2ZKOA 1IX9A 3D8CA 1GTOA 3IGAC 3BVOA 4JI5O 1OZ0A 3JAKA 3SYOA 1SQFA 3UO3A 4GKKO 3T4ZA 4BAYA 1M57C 1YF2A 1Q90D 3A2FA 5LP6B 4X20B 1SZXA 1Q86W 5JQGA 2FTKA 4O4HA 1VQ5V 5C93A 4UV9A 2LFSA 2E3CA 2IU0A 3E8FA 1TUEB 4GKKB 4LCUC 1QLEC 1HNZB 5KHJA 1JJ2U 4U3FH 1WA8B 1HWYA 4UCRA 1QNMA 3T1CA 1WJZA 4EFBA 1TA8A 3K03A 4O2BB 5DECA 4AI8A 1L1FA 2P90A 2HJFC 3M99B 3E89A 2Q0AA 5LMUO 2QWOB 3AK1A 5B1OA 4UCUA 1Q6IA 2IM9A 4HZ3A 1ROPA 3JAMN 3E8GA 2CTRA 4CBCA 4DR2O 3K57A 4UVAA 2VQEB 4BIZA 4I9QA 4FLUA 1RSOA 2Q5ZA 2EINB 3QF7A 2NNUA 5KMGA 3OEHG 4B3SO 4WFHA 4HYOA 3H1KH 4AQYO 4WBNB 3I55V 2PTMA 2WA3A 4QE9A 4X9QA 2UXDB 5BXZA 1DK1A 4TUYB 1FXKA 2R9IA 4NVPA 5GTIZ 3OAAG 2ZD9A 1Y4MA 3RW0A 5IYBO 3QO7A 2CE4A 1TUBB 5A9GA 3CCJV 2QWRB 2YXHA 5B1AB 4X66O 4KHPO 3RWRD 3THOA 4J7JA 3T1YO 3B8MA 1GO3F 3JARB 1E79G 3ABLB 5LYJB 2GTSA 1H5WA 1CXZB 1D5NA 4DR4O 5B1BC 2Q4PA 1LR1A 2CDYA 3K5MA 1YHQV 1YVWA 1XL4A 4DV3O 1VQNV 3BY6A 2UXCB 2DYSB 1YTFB 3CCLV 4ZI7A 1BQZA 2EIKC 5KMGB 2CH7B 3S3WA 5AG2A 3E22A 3E2EA 4WFGA 3ASOB 3H01A 3FYIB 1K4DC 1XEQA 1XDCA 2QR4A 2QDOA 1AR5A 5BMVB 5C8YB 4DR1B 1V55C 2E74B 1FXKC 1W59A 3JARA 2VQFO 1BQ0A 3A0RA 5JJJB 3CCVV 4U7OA 1PP9H 5LOVB 3K5OA 4J7ZA 5HFLA 3QTCA 3QVNA 3CE2A 2YIBA 1XMQB 1VMGA 4PA7A 4MW8A 3B2EE 5FNVA 5J2TB 2VWKA 3RYHB 1VF7A 2OCCB 2F4VO 4X1YA 4K8ZA 2JJ2G 4B08A 4YJ2B 3K59A 1R3JC 3M8AA 4DR5O 3SYPA 1R6NA 3APQA 5E1AC 2KB1A 3AG2B 3ZHSA 2W0XA 5L3EA 4XDKA 2DE0X 1HNWO 2X6BA 4FIPC 1IBMO 4F6EA 2ZINA 2Q73A 3CX5F 4DV6O 4AILC 1XNQO 5IE9A 2Z3YA 1WN7A 3C90A 1XI1A 4YHHO 3CJHA 1QQCA 3RYIA 1H2KA 4JI3B 5LGUA 3BPZA 1MSDA 1NKDA 1J5EO 3DTUB 4I0XB 5JCOA 4I50A 3ZIAG 1OCZB 3C3TA 2Y0IA 2WLMA 3NXSA 4GLXA 3CP1A 4IGGA 4Z2WA 4P30A 2WLKA 1RPRA 1MA1A 1N4CA 2DN9A 4WCEV 4KHPB 4TQFA 2EX3A 2VWJA 2CUGA 1K97A 1K4CC 1SQVH 5L3FA 3LDEA 4KUMA 2BTQA 5IJ9A 4B3MO 1VQKV 1JOYA 3TK1A 2F23A 5ITZB 2QSAA 3TGUH 1AJNA 4DV2O 1DGSA 3DXRB 1MNGA 2RN9A 2A7WA 2ZXWC 2EJ7A 1SA0B 2YEVA 3OE7G 2EJRA 1S0VA 3RYCB 3OUFA 1R3KC 3OTOO 2ITDC 1FXKB 4DV4O 4DV5O 3HKDA 3VOUA 5IJ0A 2KKWA 1AR1B 4JYAO 3RYFB 4LBEC 4JI7B 1ENVA 1GK9A 2DOSA 3NR7A 4MVUA 5B66Z 5IWAB 2IH3C 1L8DA 4UCSA 4JTCB 3WG7B 1Z5VA 1YDXA 5IDJA 5EYPA 3AG3B 4PJ0Z 1W0KG 2QM7A 1BHBA 4HNAA 5JVDA 1YJ9V 1GM7A 3AEIA 3HKEA 3HPLC 1Y66A 2G38A 2JRIA 2QE7G 2BOBC 4GUNA 2P06A 4O4IB 1PNKA 4CS3A 4DR5B 1SA0A 3ETDA 1PM9A 2CH7A 3H1IH 5JCOC 1I0HA 4FZ1A 1M90W 1XUQA 4FJCC 3SPIA 5JJNB 5CB4B 4DV1O 3X2QC 1AJQA 3JASA 2WLHA 5EYPB 2BCCH 1WA8A 4FVMA 2CAZC 4H0LB 5LHIA 3HR0A 2ILMA 3ABKB 3SPGA 2YIBD 4B7EA 1ZL8A 2QTSA 4WBNA 3GB7C 1BE3H 4P2ZA 3SJCC 2Q6AA 4UCTA 4CZZA 2OT5A 4DUZB 1XNRO 1UPGA 3SJBC 1QVGU 3JD3A 2VQEO 2LW1A 3UM7A 2H8PC 1NR7A 4GX2A 4C7UA 4JPRA 5IYCO 3O65A 1SETA 4DR6B 3OTOB 1MSWD 2WLLA 3ZMUA 3N2KB 1NU1H 1M93A 2M7WA 4LFBB 4I55B 1XNRB 4NR1A 1IXMA 1RSOB 5JH7A 4B3MB 3SPCA 4JI6O 4W4KA 1NH2B 2UU9B 4RQFA 1K5QA 5KUMA 1Y74A 3L9DA 4DV2B 2QM4A 4YY3B 1P84F 1OCCB 2X6AA 1K7DA 4Z1VA 1FAFA 1BMFG 4LF8O 1FJGB 1H8HG 4N23A 4J10A 4JZ2A 1AVMA 2ZNJA 4BIOA 2OTLV 4DO2A 3JAWB 3SYQA 4ZIBA 2PI4A 1BSMA 1DLBA 3HB3B 2IU3A 1EN4A 1BCCH 1M1KW 2R70A 5LOVA 5IWAO 2YEVB 4DV1B 1UJWB 3RN4A 2OCHA 1S5HC 5L3GA 2DYSC 2ZDIA 3L75H 3ABUA 1YTFD 2BTQB 1N0NA 1F23A 1H8EG 1Q81W 5GTHZ 4QGPA 3BABA 4RUFA 4AQYB 2ZIOA 1UFIA 3MDSA 2JEXA 3SJQC 2V4DA 1HNWB 3LNMB 1GN2A 3CCRV 2DMXA 2UUCB 2PI5A 4JV5B 5J9PC 1WB7A 4I0XA 5EZYB 3K58A 3IJ4A 1R6TA 1PNMA 2EZOA 1YEWA 2JDIG 4U3JB 3VQYA 3CD6V 3UT5A 1XBLA 4MVQA 3VQXA 4MTXA 3RYCA 2K1EA 3OFNG 2PGGA 1KP3A 3AK2A 3CC4V 4B7KA 2Z0AA 5L3DA 2Y69C 1N33B 4RUEA 4CC6A 1N8RW 3CB2A 2UXBB 3JD4A 4K8XA 4TV8A 3ABMB 4I4TB 3ETQA 1NR1A 2QKCA 3R66A 5EBWC 1F7YA 4X65O 1D5AA 4X1YB 2KQXA 2ZT9B 3J80N 4H33A 3S3XA 2RNBA 4NTWA 2AXTZ 1YXBA 4GYCB 4CH4A 1N32O 5LP6A 4ZOLB 4ZHQB 4TV8B 3ZRSA 2IBZH 4H13B 1AB3A 1I94O 4HBNA 1Q8IA 4NXNB 4F6RA 3W7UA 3I5DA 1H2MA 1K3EA 5HFMA 3ETEA 4LWSA 2UXXA 4LF8B 3N2GB 1KECA 3JD2A 3JATB 4O4JB 2QGNA 1E1QG 4ZKIA 2JGDA 2Y4TA 1HW7A 2FYUH 3P30A 4MVRA 3ETGA 1M56C 1NTKH 2QJ1A 4JI4B 2P4VA 3ZEDA 1B04A 4JAUA 1Y74B 4JF3A 1GKFA 3K08A 4CS4A 3G6BA 3RYFA 1B6QA 3KCXA 4D7TA 1P7GA 3LSSA 2JS3A 4YJ3B 4OPHA 1SRYA 2Q8VA 2DYRC 4N21A 4X1IB 1EZJA 2R9AA 3TJTA 2A9HA 4Z1MG 4LFBO 4CH5A 3R65A 2DQ3A 1JQ0A 3RVYA 2UUCO 4JV5O 4LF5O 5F2VO 2FMLA 1Y76B 2D3OW 4F4LA 4OX9O 1SQGA 2AW9A 3AG7A 1XREA 2HFEC 4PA4A 4J9ZB 4QIWF 4JI0O 2UUAB 5FPOA 4GCZA 1AI7A 1WP8A 3ZHTA 4QPJA 1NI8A 2WLNA 4JI5B 4TSFG 3SYCA 3IAYA 3MAQA 1F4MA 4FMTA 2LO1A 3N27A 4JI1B 4X20A 2F43G 5IT9N 1DTOA 2WSSG 3JALB 1P49A 4XDJA 2DW4A 4WFBV 2BSKA 3STZC 1GN6A 2C2AA 4UB8Z 3WB2A 2A0LA 2CGOA 3KZIZ 3MHHC 3FAVB 5FLXN 1SQBH 2X0LA 4EEQA 2IJHA 3K06A 4G28B 2UXCO 4R50A 4JYCA 2QEXV 3B09A 2RQ6A 2N05A 2R72A 3BCCH 2HHHB 1COWG 1G4YB 1I94B 4QJFB 2XAGA 5K1XA 1G6UA 2P6JA 3JSNA 2YXYA 1NH2D 1IXBA 1JR9A 3SYAA 2W0FC 1ZUQA 3K79A 4ASUG 2B9ZA 2RDCA 5LGNA 4YIPA 3ABKC 4X1IA 4DRXA 4DR1O 1L0NH 5CA1B 2HEPA 3OGIB 2YSUB 1L0LH 4JTAB 1V54B 1YITV 2EIKB 5IYZA 4DV7B 3CRQA 3K3WA 3SJAC 3ZCCA 5FPRA 2P7TC 1VEWA 4PV1B 3ZMZA 4FM0A 1THZA 3RVZA 5LA6A 3UCSC 5C8YA 1TVKA 3LDDA 1KD1W 4JAVA 1H2LA 3P3PA 2OCCC 4LF6B 4MW3A 4O2BA 2RJZA 2H3OA 2WLLB 4DV7O 3CMAV 1H38A 4LFAB 3LSQA 4DUZO 4CC5A 2PYJA 2ZE8A 2ZNIA 2R9RB 4UVCA 1FPOA 4YHHB 1S5LZ 1QLEB 5CA1A 1V54C 4UFZA 2KSDA 4O4LB 4NXNO 4WFFA 3FB8C 4JI3O 1Q7YW 1JJOA 3HKCB 2OTJV 5KHIA 4MTOA 5CBHA 2QWQB 2ZM6B 1YJWV 3BA9A 1VQ6V 2EIMB 4U7NA 1FD9A 3SDLA 5B3SC 5LHGA 3CRRA 2RCVA 1EN6A 4OXSA 4DYLA 2UU9O 1R73A 2P5OA 1N36O 4JYYA 5B1AC 4G27B 2N74A 2ZCEA 3U0ZA 1I08A 4X65B 3ZRVA 4DUYB 4PA3A 4TUYA 1FJGO 1WNSA 3RFRA 2EBOA 3E8BA 4IHJB 1W0JG 1VARA 1MG1A 1ZWIC 4U3JA 1F4NA 1U97A 1EM1A 3JALA 3UT5B 5KLVH 1KP2A 2YICA 3BA8A 3UQ8A 4LFCB 4ABMA 2LP7A 2FL4A 1S76D 1R3IC 4I9WA 1G8MA 3LSUA 5JH7B 1VIBA 1M57B 4LF5B 4FZ0A 4UUJC 2GBOA 4FLVA 3JAKB 1EFRG 5LMNO 2EULA 3D3QA 2PYLA 1FYJA 5IY5C 3A0BZ 3FKSG 1XHZA 3JD0A 4X88A 1NTZH 1J5EB 1IDSA 4RO2A 4HAMA 1KB9F 3ZX6A 3MHSC 1QBZA 1OCZC 2AHYA 2XAHA 4K0KO 1Q5OA 1YI2V 3B8NA 4EB6A 1NQTA 4MVZA 1N34O 1HR0B 4PD4F 4DV0B 1LUVA 4BR6A 4AHCA 1NJIW 1BT8A 3OR6C 4NKGB 4WFEA 1WPXA 3L74H 1NVPB 2BTOA 2DWEC 5CA0B 3LNNA 4UCVA 3G4SV 4DR3O 2QA4V 4KL1A 1JPXA 2Y0PA 4FLWA 4L8JA 4MVOA 3T1YB 2JGDB 4O4IA 2LJ2A 3ZMTA 1PPJH 1XILA 1O9GA 2F95B 3MD0A 3F5TA 5JVDB 2WWWA 3JATA 1VQ8V 4IIJB 5L3CA 1RFYA 2ZM6O 3CWBH 1VP7A 1H2SB 3JCUZ 5LA6B 3TETA 3CCMV 2CGNA 3N2GA 4LH6A 5JJEB 1Q3EA 1GM8A 3TXQA 1IJGA 5LBQA 1NVPD 3SR2C 1R1BA 2HVKC 3WB1A 4LF9O 2OIEA 3X2QB 2Q7HA 1F51A 3CCUV 5KX5A 3B77A 2LQTA 2XAJA 3K04A 1E1RG 5TISZ 1S72V 1JA8A 2AGAA 5DEDA 1K33A 1U96A 5FL7G 4EKWA 1YSCA 3CJHB 1ZL8B 3A8TA 1AJPA 3VQWA 1LUWA 3L71H 4NXMB 2GTAA 4R6ZA 4JI2O 3ML0A 4J80A 1I5YA 4O2AB 3JASB 2XAFA 4LF9B 4LFCO 4MTFA 5CB4A 1Q43A 2JEUA 2AZ2A 1QCEA 4GX0A 1B3QA 3E86A 3HKCA 1KQSU 3F5WC 1JFFA 4PDRA 2BOCC 3J7AU 3ZHVA 1M56B 1XNQB 1AI4A 3VBBA 5LL6Y 3OM3B 3RGBA 1WPBA 3KDRA 2A79B 1AROP 2GUZA 4DV0O 3F7YC 4DUYO 3G6EV 3FB6C 4LF7O 2Z5UA 5J2UB 3G71V 3ZN0A 4JTDB 4CH6A 3W7WA 3CPWU 4J9YB 1OV9A 2YIDA 3DGEA 3CCSV 1G1XB 4JI1O 3TXSA 1GAXA 4ZHQA 4O2AA 3ZBHA 3IC9A 3GWKC 3JAWA 3GWOA 5DN6G 3ABLC 3H1HH 4FFBB 4EB6B 1ORQC 3OUSA 3ZRWA 4NXMO 1FXHA 1OHHG 2ODMA 2YS8A 3SPJA 1VQOV 5EBMC 1M9NA 4KXRA 4MSWC 3H1LH 4DR2B 3ZHQA 2W6IG 3CSXA 3FYEB 2OIGA 2B1GA 2E75B 1KU9A 4TV9A 1BHAA 5B3SB 1IZ3A 1OJHA 2AHZA 2PZSA 1I7FA 1R3LC 3T1HO 3G67A 4JZGA 3RYIB 2OWOA 5CBFA 1BS3A 2VRZA 3SGIA 4IYIA 4ZI7B 1QR9A 4DXWA 5IYZB 1N36B 1KMIZ 4TV9B 3ZRXA 1ZAUA 3OMNB 3BHPA 4KP4A 4R8CA 4NYKA 4OPAA 3ASNC 1FS0G 3D36C 3JD1A 4TQDA 1SF9A 4PELA 3D3IA 2XTAA 3K9SA 2KG7B 3UKMA 1OCRB 1PNLA 1Y6XA 1VQMV 5KX5B 1VQLV 4BW5A 1BZKA 4FLXA 5BZBA 4K0KB 3TCUA 2ZXWB 5IYDO 1P4RA 2B1IA 4OGQB 2NN4A 3OGCC 3OT7A 1N34B 1HR0O 5KAFZ 3DC6A 3K0GA 3HKEB 4GX1A 2QWNB 3FFQA 5IJ9B 4IIJA 4LH7A 4WFAV 4LF4B 4RQEA 5EIBC 4X1KA 1MOFA 5KHGA 2EILB 1ZX3A 1SESA 3EFFK 3QO8A 3W7XA 1XHXA 3STLC 3T4DA 4I7ZB 4J7KA 3U11A 4FFKA 5EK0A 3KCYA 2Q7EA 4JI0B 4DV4B 5LMUB 1WLEA 2NR5A 4DV5B 4X8AA 3CCEV 1A32A 1Y67A 2YUAA 3ICXA 1HNXB 3P32A 4RWUA 5KHHA 4ICGA 5BR8O 3WFVA 3AG4B 4JI4O 2WLJA 3DXRA 2ZE6A 3K0DA 3OEEG 2E76B 4F6RB 4GKJB 3L72H 5H2FZ 2GV9A 1T5EA 2O57A 2YI8A 3CXCU 4G2KA 3I56V 3K9AA 3ZHUA 1KKDA 4TOIA 1FOUA 1FKAO 3W7TA 3APOA 4PI2A 1K8AW 3M7MX 1JMKC 4NB5A 2XUMA 4J42A 2D2CB 3JYCA 2ZE5A 4BIUA 4PI0A 2UXBO 4X1KB 1FFXB 1SKVA 2Q68A 4O4JA 2WLIB 1GN3A 5KA6A 2ZDIC 2WA4A 2QTOA 3L70H 1NS1A 1SS3A 2YXLA 3CRMA 4QNHB 1SZTA 3DC5A 4JI2B 2ETNA 4XDLA 4IT5A 2EZPA 2A06H 2CTPA 5KHKA 2MK3A 2E5LB 3OTFA 4RAIA 1GMGA 4DV6B 2V1DA 4B3RB 4R7CA 1FFXA 1PL4A 1JX9A 1IBLB 3ZRWB 1M5IA 4K35A 2Q67A 2FKXA 4DR6O 2ZE7A 3H1JH 3ZMSA 3UO2A 2P22C 5GW7A 1FFTB 3EVKA 1MMMA 4JI6B 5LHHA 3ZS8C 4Q6GA 1Y76A 2DQ0A 3WG7C 1FXVA 1K5SA 5EBLC 1ZLZA 1YIJV 2Q7GA 2JIZG 3HKBA 2WPDG 1TUBA 4LF7B 4GZRB 2GUZB 1YZBA 2LW7A 3BFRA 1VQPV 5H6RA 1TVKB 4J11A 1WB8A 1IBMB 1BGYH 3AG1C 3O9OA 3VQVA 1QR8A 2BSKB 4GKJO 4DK1A 2HG5C 3DSQA 1AR4A 2L35A 2EIMC 4FM2A 1XMOB 1B06A 2GSMB 4X66B 2CTWA 4UB6Z 3OR7C 4I55A 5DM6V 1IURA 3ASOC 3ASNB 5CMUA 2LFRA 3FB5C 4UCOA 1AI6A 4LC1A 4LWSB 3CHXA 5LP6C 1VQ7V 2Y4UA 2HP8A 4BW9A 2L6LA 3OMAB 1Z5WA 1LNQA 4FLYA 2K9PA 5BY1A 4IYHA 4Q20A 3AG4C 5CN0A 2DJVA 5LMNB 2IJIA 1EN5A 2F66C 1OCRC 5K1PA 4B3TB 1O9HA 5KA5A 2PUSA 3CMEV 1RM1B 4I5SA 4J41A 2ZIMA 1QHTA 4PHZA 3QG5A 3FAVA 3EXAA 5J2TA 5FNVB 3LUTB 2PF4E 1N33O 1OCOC 5D5QA 5H9CA 4I50B 1VQ4V 1S3JA 3OMIB 3J81N 4CH3A 4QE7A 1PD3A 2MW2B 1P7BA 3H9VA 3AG1B 4UV8A 1SQPH 4LP8A 3AG2C 3EHBB 1AI5A 2IJJA 1IBKO 5IY5B 4W4LA 2LGWA 4DR4B 2P4KA 1IVSA 4MTGA 1QVFU 1VF6C 2HLDG 2YC0A 1H2NA 3ZHRA 4HNAB 1DF5A 1N32B 1QU7A 2FB5A 1PKXA 3E35A 1HNZO 4YXWG 2EIJB 4D7SA 3WB0A 4JYBA 3IC7A 1WP7A 4PDLA 1XMOO 3OD4A 2QKSA 2XHBA 1S5JA 4MVSA 1JCHA 5E79Z 2UUBB 4IL6Z 2XT9A 4K3AA 5BR8B 4YJ3A 1XQ8A 5CA3A 2P67A 4NTXA 2B5UA 2HJDA 4L87A 1SQQH 1GM9A 2ADQB 4E2LA 2LGQA 4LFAO 1SQXH 5GONA 3CC7V 5ITZA 4X62B 1GH6A 1K34A 1HNXO 1IBLO 2YDEA 2AZ0A 5L3BA 1YCIA 3E8HA 4MVMA 3Q4HA 4CS2A 1HDJA 4DW1A 1X4TA 4UVBA 4YIOA 1CP9A 3ZMVA 3KKYA 2RMKB 4BWAA 2HR3A 1D2DA 2ZQMA 3Q4HB 2GHYA 2XOKG 4B3TO 3HKDB 4PA9A 1JFFB 1NT2B 5KAIZ 4UXNA 3A0HZ 5H6QA 4PA6A 1XL6A 2QWPB 3N2KA 3T2MA 2ATKC 1KC8W 3WU2Z 4LNUA 5CBGA 2DWDC 4LF4O 3CYOA 3K5LA 3CXHF 1Q6UA 4PDVA 1EZVH 3F7VC 4DR3B 1SC5B 5LXTB 3P3NA 4JGSA 4H44B 3QNEA 1S77D 1US6A 4FM1A 3PN1A 3CC2V 1PV0A 2ARHA
chains in the Genus database with same CATH topology
2GDSA 3BFRA 1IX9A 1BSMA 2CE4A 1GN6A 4GUNA 5A9GA 1EN4A 1AP6A 1WB8A 1PM9A 3RN4A 1I0HA 1XUQA 3KDRA 1MSDA 2RCVA 3K9SA 1EN6A 1AR4A 3CEIA 1B06A 1N0NA 1SZXA 1XILA 4JYYA 1D5NA 2CDYA 1I08A 3C3TA 1GN3A 3MDSA 2ADQB 3OT7A 2QKAA 1MA1A 1IXBA 1JR9A 1GN2A 3DC6A 1ZUQA 5AG2A 1VARA 3DC5A 1WB7A 4YIPA 1EM1A 1QNMA 3IC9A 1P7GA 4C7UA 1EN5A 1XDCA 3LSUA 1PL4A 1AR5A 3TJTA 1JA8A 3AK1A 3C3SA 1GN4A 1MNGA 1VEWA 4YIOA 4FFKA 3AK2A 3KKYA 1LUWA 3EVKA 3QVNA 1ZSPA 4E4EA 1MMMA 2AW9A 1IDSA 1XREA 1Y67A 2QKCA 4JZGA 1ZLZA 1BS3A 1N0JA 2ADPA 2P4KA 1KKCA 3AK3A 4X9QA 4JZ2A 1AVMA 1ZTEA 4F6EA 1LUVA 4BR6A 1BT8A 1AP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDS A;  3BFR A;  1IX9 A;  1BSM A;  2CE4 A;  1GN6 A;  4GUN A;  5A9G A;  1EN4 A;  1AP6 A;  1WB8 A;  1PM9 A;  3RN4 A;  1I0H A;  1XUQ A;  1MSD A;  2RCV A;  3K9S A;  1EN6 A;  1AR4 A;  3CEI A;  1B06 A;  1N0N A;  1SZX A;  1XIL A;  4JYY A;  1D5N A;  2CDY A;  1I08 A;  3C3T A;  1GN3 A;  3MDS A;  2ADQ B;  3OT7 A;  2QKA A;  1MA1 A;  1IXB A;  1JR9 A;  1GN2 A;  3DC6 A;  1ZUQ A;  5AG2 A;  1VAR A;  3DC5 A;  1WB7 A;  4YIP A;  1EM1 A;  1QNM A;  3IC9 A;  1P7G A;  4C7U A;  1EN5 A;  1XDC A;  3LSU A;  1PL4 A;  1AR5 A;  3TJT A;  1JA8 A;  3AK1 A;  3C3S A;  1GN4 A;  1MNG A;  1VEW A;  4YIO A;  4FFK A;  3AK2 A;  3KKY A;  1LUW A;  3EVK A;  3QVN A;  1ZSP A;  4E4E A;  1MMM A;  2AW9 A;  1IDS A;  1XRE A;  1Y67 A;  2QKC A;  4JZG A;  1ZLZ A;  1BS3 A;  1N0J A;  2ADP A;  2P4K A;  1KKC A;  3AK3 A;  4X9Q A;  4JZ2 A;  1AVM A;  1ZTE A;  4F6E A;  1LUV A;  4BR6 A;  1BT8 A;  1AP5 A; 
#chains in the Genus database with same CATH topology
 2GDS A;  1V9P A;  4DR7 B;  2JK5 C;  1IBK B;  1HP8 A;  1NTM H;  4LNU B;  2VS0 A;  3T1H B;  5A2Q N;  4DW0 A;  2V7Q G;  1RM1 C;  3CEI A;  5EIB D;  1M4U A;  4JI8 O;  2HHH O;  1PL0 A;  1DF4 A;  3BAA A;  4XBF A;  4YY3 O;  1KYO F;  4FLT A;  1CEZ A;  2Q69 A;  4X64 O;  2W6J G;  1OCO B;  4GX5 A;  2WAM A;  5LGT A;  2H94 A;  2HKO A;  4JAS A;  5D5P A;  2F4V B;  4EFE A;  1EBO A;  4B3S B;  3BEH A;  4MT8 A;  5J2U A;  1Z2G A;  2ZR3 A;  4JYA B;  2BE3 A;  3IFX A;  4TT3 G;  3LDC A;  3GVM A;  2ZR2 A;  3E83 A;  3E22 B;  2F1M A;  5B1N A;  1JNB A;  3QO5 A;  5KUK A;  3CS5 A;  1H2G A;  1MZE A;  3C3S A;  5GON B;  1NZ6 A;  3L73 H;  4X64 B;  5CA0 A;  4JAA A;  1Q82 W;  2HVJ C;  1QLN A;  3ZJZ A;  1KUQ A;  2EIJ C;  4OX9 B;  1K92 A;  3CRC A;  4X62 O;  3RYH A;  4QPK A;  4FFB A;  4O4H B;  4DRX B;  5B5E Z;  1W2B U;  4GT1 A;  2Q0O C;  3BRC A;  1X59 A;  3JSL A;  3KG2 A;  5LYJ A;  2OYQ A;  4O4L A;  1BL8 A;  3HKB B;  2M6Y A;  3PJS K;  4X89 A;  5EC1 C;  1RP3 B;  4DV3 B;  4NTY A;  3FX7 A;  4TWK A;  2ADP A;  1OCC C;  4B3R O;  2Y48 A;  1K9M W;  1KKC A;  4MS2 A;  4D6T H;  2X6C A;  1ZTE A;  3RBZ A;  2DYR B;  4P9O A;  1VF6 A;  1R6K A;  5B1B B;  2PY5 A;  3K5N A;  2CTQ A;  1AP6 A;  3JCZ A;  2XAS A;  3B40 A;  2EIN C;  1GRJ A;  2XAQ A;  4JI8 B;  2WLI A;  2YI9 A;  3W7S A;  4H37 A;  4A5U B;  3ZN1 A;  1NBM G;  5H5N A;  2UUA O;  4KFM A;  1XMQ O;  4DR7 O;  2QKA A;  2X7R B;  1CPY A;  5JWP A;  2NLJ C;  2IJK A;  4IHJ A;  3AG3 C;  4JI7 O;  2JS5 A;  2N04 A;  2YIA A;  4LR3 A;  3B4S A;  3SPH A;  4ZOL A;  4I4T A;  4ZBM A;  2IH1 C;  2XND G;  5LXT A;  3RT3 C;  1V55 B;  3G80 A;  3ABM C;  2KG7 A;  2UXN A;  4FK5 C;  1SER A;  2EIL C;  3CCQ V;  1GN4 A;  3CRA A;  2Y69 B;  4YJ2 A;  1Q6H A;  3OW2 U;  1K73 W;  1TAE A;  2ITC C;  1VF5 B;  2IW5 A;  4FPP A;  5JQG B;  2VQF B;  3FD9 A;  1ZSP A;  4E4E A;  3ABT A;  2QM8 A;  4LF6 O;  1I5X A;  2F93 B;  5EC2 C;  2Q9L A;  1RPO A;  1URF A;  1KBH A;  1VQ9 V;  5EZY A;  1J95 A;  2E5L O;  4WF9 V;  1XOU A;  1N0J A;  3FB7 C;  4PDM A;  1MAB G;  3U10 A;  5BMV A;  1TGO A;  2JGU A;  2UUB O;  3AK3 A;  1YJN V;  2JVD A;  4FLZ A;  1WAZ A;  2CK3 G;  1MZF A;  4P9P A;  1AIL A;  3D36 A;  1JVM A;  4DK0 A;  2A3Q A;  2JJ1 G;  1AP5 A;  5IJ0 B;  2UXD O;  2ZKO A;  1IX9 A;  3D8C A;  1GTO A;  3IGA C;  3BVO A;  4JI5 O;  1OZ0 A;  3JAK A;  3SYO A;  1SQF A;  3UO3 A;  4GKK O;  3T4Z A;  4BAY A;  1M57 C;  1YF2 A;  1Q90 D;  3A2F A;  5LP6 B;  4X20 B;  1SZX A;  1Q86 W;  5JQG A;  2FTK A;  4O4H A;  1VQ5 V;  5C93 A;  4UV9 A;  2LFS A;  2E3C A;  2IU0 A;  3E8F A;  1TUE B;  4GKK B;  4LCU C;  1QLE C;  1HNZ B;  5KHJ A;  1JJ2 U;  4U3F H;  1WA8 B;  1HWY A;  4UCR A;  1QNM A;  3T1C A;  1WJZ A;  4EFB A;  1TA8 A;  3K03 A;  4O2B B;  5DEC A;  4AI8 A;  1L1F A;  2P90 A;  2HJF C;  3M99 B;  3E89 A;  2Q0A A;  5LMU O;  2QWO B;  3AK1 A;  5B1O A;  4UCU A;  1Q6I A;  2IM9 A;  4HZ3 A;  1ROP A;  3JAM N;  3E8G A;  2CTR A;  4CBC A;  4DR2 O;  3K57 A;  4UVA A;  2VQE B;  4BIZ A;  4I9Q A;  4FLU A;  1RSO A;  2Q5Z A;  2EIN B;  3QF7 A;  2NNU A;  5KMG A;  3OEH G;  4B3S O;  4WFH A;  4HYO A;  3H1K H;  4AQY O;  4WBN B;  3I55 V;  2PTM A;  2WA3 A;  4QE9 A;  4X9Q A;  2UXD B;  5BXZ A;  1DK1 A;  4TUY B;  1FXK A;  2R9I A;  4NVP A;  5GTI Z;  3OAA G;  2ZD9 A;  1Y4M A;  3RW0 A;  5IYB O;  3QO7 A;  2CE4 A;  1TUB B;  5A9G A;  3CCJ V;  2QWR B;  2YXH A;  5B1A B;  4X66 O;  4KHP O;  3RWR D;  3THO A;  4J7J A;  3T1Y O;  3B8M A;  1GO3 F;  3JAR B;  1E79 G;  3ABL B;  5LYJ B;  2GTS A;  1H5W A;  1CXZ B;  1D5N A;  4DR4 O;  5B1B C;  2Q4P A;  1LR1 A;  2CDY A;  3K5M A;  1YHQ V;  1YVW A;  1XL4 A;  4DV3 O;  1VQN V;  3BY6 A;  2UXC B;  2DYS B;  1YTF B;  3CCL V;  4ZI7 A;  1BQZ A;  2EIK C;  5KMG B;  2CH7 B;  3S3W A;  5AG2 A;  3E22 A;  3E2E A;  4WFG A;  3ASO B;  3H01 A;  3FYI B;  1K4D C;  1XEQ A;  1XDC A;  2QR4 A;  2QDO A;  1AR5 A;  5BMV B;  5C8Y B;  4DR1 B;  1V55 C;  2E74 B;  1FXK C;  1W59 A;  3JAR A;  2VQF O;  1BQ0 A;  3A0R A;  5JJJ B;  3CCV V;  4U7O A;  1PP9 H;  5LOV B;  3K5O A;  4J7Z A;  5HFL A;  3QTC A;  3QVN A;  3CE2 A;  2YIB A;  1XMQ B;  1VMG A;  4PA7 A;  4MW8 A;  3B2E E;  5FNV A;  5J2T B;  2VWK A;  3RYH B;  1VF7 A;  2OCC B;  2F4V O;  4X1Y A;  4K8Z A;  2JJ2 G;  4B08 A;  4YJ2 B;  3K59 A;  1R3J C;  3M8A A;  4DR5 O;  3SYP A;  1R6N A;  3APQ A;  5E1A C;  2KB1 A;  3AG2 B;  3ZHS A;  2W0X A;  5L3E A;  4XDK A;  2DE0 X;  1HNW O;  2X6B A;  4FIP C;  1IBM O;  4F6E A;  2ZIN A;  2Q73 A;  3CX5 F;  4DV6 O;  4AIL C;  1XNQ O;  5IE9 A;  2Z3Y A;  1WN7 A;  3C90 A;  1XI1 A;  4YHH O;  3CJH A;  1QQC A;  3RYI A;  1H2K A;  4JI3 B;  5LGU A;  3BPZ A;  1MSD A;  1NKD A;  1J5E O;  3DTU B;  4I0X B;  5JCO A;  4I50 A;  3ZIA G;  1OCZ B;  3C3T A;  2Y0I A;  2WLM A;  3NXS A;  4GLX A;  3CP1 A;  4IGG A;  4Z2W A;  4P30 A;  2WLK A;  1RPR A;  1MA1 A;  1N4C A;  2DN9 A;  4WCE V;  4KHP B;  4TQF A;  2EX3 A;  2VWJ A;  2CUG A;  1K97 A;  1K4C C;  1SQV H;  5L3F A;  3LDE A;  4KUM A;  2BTQ A;  5IJ9 A;  4B3M O;  1VQK V;  1JOY A;  3TK1 A;  2F23 A;  5ITZ B;  2QSA A;  3TGU H;  1AJN A;  4DV2 O;  1DGS A;  3DXR B;  1MNG A;  2RN9 A;  2A7W A;  2ZXW C;  2EJ7 A;  1SA0 B;  2YEV A;  3OE7 G;  2EJR A;  1S0V A;  3RYC B;  3OUF A;  1R3K C;  3OTO O;  2ITD C;  1FXK B;  4DV4 O;  4DV5 O;  3HKD A;  3VOU A;  5IJ0 A;  2KKW A;  1AR1 B;  4JYA O;  3RYF B;  4LBE C;  4JI7 B;  1ENV A;  1GK9 A;  2DOS A;  3NR7 A;  4MVU A;  5B66 Z;  5IWA B;  2IH3 C;  1L8D A;  4UCS A;  4JTC B;  3WG7 B;  1Z5V A;  1YDX A;  5IDJ A;  5EYP A;  3AG3 B;  4PJ0 Z;  1W0K G;  2QM7 A;  1BHB A;  4HNA A;  5JVD A;  1YJ9 V;  1GM7 A;  3AEI A;  3HKE A;  3HPL C;  1Y66 A;  2G38 A;  2JRI A;  2QE7 G;  2BOB C;  4GUN A;  2P06 A;  4O4I B;  1PNK A;  4CS3 A;  4DR5 B;  1SA0 A;  3ETD A;  1PM9 A;  2CH7 A;  3H1I H;  5JCO C;  1I0H A;  4FZ1 A;  1M90 W;  1XUQ A;  4FJC C;  3SPI A;  5JJN B;  5CB4 B;  4DV1 O;  3X2Q C;  1AJQ A;  3JAS A;  2WLH A;  5EYP B;  2BCC H;  1WA8 A;  4FVM A;  2CAZ C;  4H0L B;  5LHI A;  3HR0 A;  2ILM A;  3ABK B;  3SPG A;  2YIB D;  4B7E A;  1ZL8 A;  2QTS A;  4WBN A;  3GB7 C;  1BE3 H;  4P2Z A;  3SJC C;  2Q6A A;  4UCT A;  4CZZ A;  2OT5 A;  4DUZ B;  1XNR O;  1UPG A;  3SJB C;  1QVG U;  3JD3 A;  2VQE O;  2LW1 A;  3UM7 A;  2H8P C;  1NR7 A;  4GX2 A;  4C7U A;  4JPR A;  5IYC O;  3O65 A;  1SET A;  4DR6 B;  3OTO B;  1MSW D;  2WLL A;  3ZMU A;  3N2K B;  1NU1 H;  1M93 A;  2M7W A;  4LFB B;  4I55 B;  1XNR B;  4NR1 A;  1IXM A;  1RSO B;  5JH7 A;  4B3M B;  3SPC A;  4JI6 O;  4W4K A;  1NH2 B;  2UU9 B;  4RQF A;  1K5Q A;  5KUM A;  1Y74 A;  3L9D A;  4DV2 B;  2QM4 A;  4YY3 B;  1P84 F;  1OCC B;  2X6A A;  1K7D A;  4Z1V A;  1FAF A;  1BMF G;  4LF8 O;  1FJG B;  1H8H G;  4N23 A;  4J10 A;  4JZ2 A;  1AVM A;  2ZNJ A;  4BIO A;  2OTL V;  4DO2 A;  3JAW B;  3SYQ A;  4ZIB A;  2PI4 A;  1BSM A;  1DLB A;  3HB3 B;  2IU3 A;  1EN4 A;  1BCC H;  1M1K W;  2R70 A;  5LOV A;  5IWA O;  2YEV B;  4DV1 B;  1UJW B;  3RN4 A;  2OCH A;  1S5H C;  5L3G A;  2DYS C;  2ZDI A;  3L75 H;  3ABU A;  1YTF D;  2BTQ B;  1N0N A;  1F23 A;  1H8E G;  1Q81 W;  5GTH Z;  4QGP A;  3BAB A;  4RUF A;  4AQY B;  2ZIO A;  1UFI A;  3MDS A;  2JEX A;  3SJQ C;  2V4D A;  1HNW B;  3LNM B;  1GN2 A;  3CCR V;  2DMX A;  2UUC B;  2PI5 A;  4JV5 B;  5J9P C;  1WB7 A;  4I0X A;  5EZY B;  3K58 A;  3IJ4 A;  1R6T A;  1PNM A;  2EZO A;  1YEW A;  2JDI G;  4U3J B;  3VQY A;  3CD6 V;  3UT5 A;  1XBL A;  4MVQ A;  3VQX A;  4MTX A;  3RYC A;  2K1E A;  3OFN G;  2PGG A;  1KP3 A;  3AK2 A;  3CC4 V;  4B7K A;  2Z0A A;  5L3D A;  2Y69 C;  1N33 B;  4RUE A;  4CC6 A;  1N8R W;  3CB2 A;  2UXB B;  3JD4 A;  4K8X A;  4TV8 A;  3ABM B;  4I4T B;  3ETQ A;  1NR1 A;  2QKC A;  3R66 A;  5EBW C;  1F7Y A;  4X65 O;  1D5A A;  4X1Y B;  2KQX A;  2ZT9 B;  3J80 N;  4H33 A;  3S3X A;  2RNB A;  4NTW A;  2AXT Z;  1YXB A;  4GYC B;  4CH4 A;  1N32 O;  5LP6 A;  4ZOL B;  4ZHQ B;  4TV8 B;  3ZRS A;  2IBZ H;  4H13 B;  1AB3 A;  1I94 O;  4HBN A;  1Q8I A;  4NXN B;  4F6R A;  3W7U A;  3I5D A;  1H2M A;  1K3E A;  5HFM A;  3ETE A;  4LWS A;  2UXX A;  4LF8 B;  3N2G B;  1KEC A;  3JD2 A;  3JAT B;  4O4J B;  2QGN A;  1E1Q G;  4ZKI A;  2JGD A;  2Y4T A;  1HW7 A;  2FYU H;  3P30 A;  4MVR A;  3ETG A;  1M56 C;  1NTK H;  2QJ1 A;  4JI4 B;  2P4V A;  3ZED A;  1B04 A;  4JAU A;  1Y74 B;  4JF3 A;  1GKF A;  3K08 A;  4CS4 A;  3G6B A;  3RYF A;  1B6Q A;  3KCX A;  4D7T A;  1P7G A;  3LSS A;  2JS3 A;  4YJ3 B;  4OPH A;  1SRY A;  2Q8V A;  2DYR C;  4N21 A;  4X1I B;  1EZJ A;  2R9A A;  3TJT A;  2A9H A;  4Z1M G;  4LFB O;  4CH5 A;  3R65 A;  2DQ3 A;  1JQ0 A;  3RVY A;  2UUC O;  4JV5 O;  4LF5 O;  5F2V O;  2FML A;  1Y76 B;  2D3O W;  4F4L A;  4OX9 O;  1SQG A;  2AW9 A;  3AG7 A;  1XRE A;  2HFE C;  4PA4 A;  4J9Z B;  4QIW F;  4JI0 O;  2UUA B;  5FPO A;  4GCZ A;  1AI7 A;  1WP8 A;  3ZHT A;  4QPJ A;  1NI8 A;  2WLN A;  4JI5 B;  4TSF G;  3SYC A;  3IAY A;  3MAQ A;  1F4M A;  4FMT A;  2LO1 A;  3N27 A;  4JI1 B;  4X20 A;  2F43 G;  5IT9 N;  1DTO A;  2WSS G;  3JAL B;  1P49 A;  4XDJ A;  2DW4 A;  4WFB V;  2BSK A;  3STZ C;  1GN6 A;  2C2A A;  4UB8 Z;  3WB2 A;  2A0L A;  2CGO A;  3KZI Z;  3MHH C;  3FAV B;  5FLX N;  1SQB H;  2X0L A;  4EEQ A;  2IJH A;  3K06 A;  4G28 B;  2UXC O;  4R50 A;  4JYC A;  2QEX V;  3B09 A;  2RQ6 A;  2N05 A;  2R72 A;  3BCC H;  2HHH B;  1COW G;  1G4Y B;  1I94 B;  4QJF B;  2XAG A;  5K1X A;  1G6U A;  2P6J A;  3JSN A;  2YXY A;  1NH2 D;  1IXB A;  1JR9 A;  3SYA A;  2W0F C;  1ZUQ A;  3K79 A;  4ASU G;  2B9Z A;  2RDC A;  5LGN A;  4YIP A;  3ABK C;  4X1I A;  4DRX A;  4DR1 O;  1L0N H;  5CA1 B;  2HEP A;  3OGI B;  2YSU B;  1L0L H;  4JTA B;  1V54 B;  1YIT V;  2EIK B;  5IYZ A;  4DV7 B;  3CRQ A;  3K3W A;  3SJA C;  3ZCC A;  5FPR A;  2P7T C;  1VEW A;  4PV1 B;  3ZMZ A;  4FM0 A;  1THZ A;  3RVZ A;  5LA6 A;  3UCS C;  5C8Y A;  1TVK A;  3LDD A;  1KD1 W;  4JAV A;  1H2L A;  3P3P A;  2OCC C;  4LF6 B;  4MW3 A;  4O2B A;  2RJZ A;  2H3O A;  2WLL B;  4DV7 O;  3CMA V;  1H38 A;  4LFA B;  3LSQ A;  4DUZ O;  4CC5 A;  2PYJ A;  2ZE8 A;  2ZNI A;  2R9R B;  4UVC A;  1FPO A;  4YHH B;  1S5L Z;  1QLE B;  5CA1 A;  1V54 C;  4UFZ A;  2KSD A;  4O4L B;  4NXN O;  4WFF A;  3FB8 C;  4JI3 O;  1Q7Y W;  1JJO A;  3HKC B;  2OTJ V;  5KHI A;  4MTO A;  5CBH A;  2QWQ B;  2ZM6 B;  1YJW V;  3BA9 A;  1VQ6 V;  2EIM B;  4U7N A;  1FD9 A;  3SDL A;  5B3S C;  5LHG A;  3CRR A;  2RCV A;  1EN6 A;  4OXS A;  4DYL A;  2UU9 O;  1R73 A;  2P5O A;  1N36 O;  4JYY A;  5B1A C;  4G27 B;  2N74 A;  2ZCE A;  3U0Z A;  1I08 A;  4X65 B;  3ZRV A;  4DUY B;  4PA3 A;  4TUY A;  1FJG O;  1WNS A;  3RFR A;  2EBO A;  3E8B A;  4IHJ B;  1W0J G;  1VAR A;  1MG1 A;  1ZWI C;  4U3J A;  1F4N A;  1U97 A;  1EM1 A;  3JAL A;  3UT5 B;  5KLV H;  1KP2 A;  2YIC A;  3BA8 A;  3UQ8 A;  4LFC B;  4ABM A;  2LP7 A;  2FL4 A;  1S76 D;  1R3I C;  4I9W A;  1G8M A;  3LSU A;  5JH7 B;  1VIB A;  1M57 B;  4LF5 B;  4FZ0 A;  4UUJ C;  2GBO A;  4FLV A;  3JAK B;  1EFR G;  5LMN O;  2EUL A;  3D3Q A;  2PYL A;  1FYJ A;  5IY5 C;  3A0B Z;  3FKS G;  1XHZ A;  3JD0 A;  4X88 A;  1NTZ H;  1J5E B;  1IDS A;  4RO2 A;  4HAM A;  1KB9 F;  3ZX6 A;  3MHS C;  1QBZ A;  1OCZ C;  2AHY A;  2XAH A;  4K0K O;  1Q5O A;  1YI2 V;  3B8N A;  4EB6 A;  1NQT A;  4MVZ A;  1N34 O;  1HR0 B;  4PD4 F;  4DV0 B;  1LUV A;  4BR6 A;  4AHC A;  1NJI W;  1BT8 A;  3OR6 C;  4NKG B;  4WFE A;  1WPX A;  3L74 H;  1NVP B;  2BTO A;  2DWE C;  5CA0 B;  3LNN A;  4UCV A;  3G4S V;  4DR3 O;  2QA4 V;  4KL1 A;  1JPX A;  2Y0P A;  4FLW A;  4L8J A;  4MVO A;  3T1Y B;  2JGD B;  4O4I A;  2LJ2 A;  3ZMT A;  1PPJ H;  1XIL A;  1O9G A;  2F95 B;  3MD0 A;  3F5T A;  5JVD B;  2WWW A;  3JAT A;  1VQ8 V;  4IIJ B;  5L3C A;  1RFY A;  2ZM6 O;  3CWB H;  1VP7 A;  1H2S B;  3JCU Z;  5LA6 B;  3TET A;  3CCM V;  2CGN A;  3N2G A;  4LH6 A;  5JJE B;  1Q3E A;  1GM8 A;  3TXQ A;  1IJG A;  5LBQ A;  1NVP D;  3SR2 C;  1R1B A;  2HVK C;  3WB1 A;  4LF9 O;  2OIE A;  3X2Q B;  2Q7H A;  1F51 A;  3CCU V;  5KX5 A;  3B77 A;  2LQT A;  2XAJ A;  3K04 A;  1E1R G;  5TIS Z;  1S72 V;  1JA8 A;  2AGA A;  5DED A;  1K33 A;  1U96 A;  5FL7 G;  4EKW A;  1YSC A;  3CJH B;  1ZL8 B;  3A8T A;  1AJP A;  3VQW A;  1LUW A;  3L71 H;  4NXM B;  2GTA A;  4R6Z A;  4JI2 O;  3ML0 A;  4J80 A;  1I5Y A;  4O2A B;  3JAS B;  2XAF A;  4LF9 B;  4LFC O;  4MTF A;  5CB4 A;  1Q43 A;  2JEU A;  2AZ2 A;  1QCE A;  4GX0 A;  1B3Q A;  3E86 A;  3HKC A;  1KQS U;  3F5W C;  1JFF A;  4PDR A;  2BOC C;  3J7A U;  3ZHV A;  1M56 B;  1XNQ B;  1AI4 A;  3VBB A;  5LL6 Y;  3OM3 B;  3RGB A;  1WPB A;  3KDR A;  2A79 B;  1ARO P;  2GUZ A;  4DV0 O;  3F7Y C;  4DUY O;  3G6E V;  3FB6 C;  4LF7 O;  2Z5U A;  5J2U B;  3G71 V;  3ZN0 A;  4JTD B;  4CH6 A;  3W7W A;  3CPW U;  4J9Y B;  1OV9 A;  2YID A;  3DGE A;  3CCS V;  1G1X B;  4JI1 O;  3TXS A;  1GAX A;  4ZHQ A;  4O2A A;  3ZBH A;  3IC9 A;  3GWK C;  3JAW A;  3GWO A;  5DN6 G;  3ABL C;  3H1H H;  4FFB B;  4EB6 B;  1ORQ C;  3OUS A;  3ZRW A;  4NXM O;  1FXH A;  1OHH G;  2ODM A;  2YS8 A;  3SPJ A;  1VQO V;  5EBM C;  1M9N A;  4KXR A;  4MSW C;  3H1L H;  4DR2 B;  3ZHQ A;  2W6I G;  3CSX A;  3FYE B;  2OIG A;  2B1G A;  2E75 B;  1KU9 A;  4TV9 A;  1BHA A;  5B3S B;  1IZ3 A;  1OJH A;  2AHZ A;  2PZS A;  1I7F A;  1R3L C;  3T1H O;  3G67 A;  4JZG A;  3RYI B;  2OWO A;  5CBF A;  1BS3 A;  2VRZ A;  3SGI A;  4IYI A;  4ZI7 B;  1QR9 A;  4DXW A;  5IYZ B;  1N36 B;  1KMI Z;  4TV9 B;  3ZRX A;  1ZAU A;  3OMN B;  3BHP A;  4KP4 A;  4R8C A;  4NYK A;  4OPA A;  3ASN C;  1FS0 G;  3D36 C;  3JD1 A;  4TQD A;  1SF9 A;  4PEL A;  3D3I A;  2XTA A;  3K9S A;  2KG7 B;  3UKM A;  1OCR B;  1PNL A;  1Y6X A;  1VQM V;  5KX5 B;  1VQL V;  4BW5 A;  1BZK A;  4FLX A;  5BZB A;  4K0K B;  3TCU A;  2ZXW B;  5IYD O;  1P4R A;  2B1I A;  4OGQ B;  2NN4 A;  3OGC C;  3OT7 A;  1N34 B;  1HR0 O;  5KAF Z;  3DC6 A;  3K0G A;  3HKE B;  4GX1 A;  2QWN B;  3FFQ A;  5IJ9 B;  4IIJ A;  4LH7 A;  4WFA V;  4LF4 B;  4RQE A;  5EIB C;  4X1K A;  1MOF A;  5KHG A;  2EIL B;  1ZX3 A;  1SES A;  3EFF K;  3QO8 A;  3W7X A;  1XHX A;  3STL C;  3T4D A;  4I7Z B;  4J7K A;  3U11 A;  4FFK A;  5EK0 A;  3KCY A;  2Q7E A;  4JI0 B;  4DV4 B;  5LMU B;  1WLE A;  2NR5 A;  4DV5 B;  4X8A A;  3CCE V;  1A32 A;  1Y67 A;  2YUA A;  3ICX A;  1HNX B;  3P32 A;  4RWU A;  5KHH A;  4ICG A;  5BR8 O;  3WFV A;  3AG4 B;  4JI4 O;  2WLJ A;  3DXR A;  2ZE6 A;  3K0D A;  3OEE G;  2E76 B;  4F6R B;  4GKJ B;  3L72 H;  5H2F Z;  2GV9 A;  1T5E A;  2O57 A;  2YI8 A;  3CXC U;  4G2K A;  3I56 V;  3K9A A;  3ZHU A;  1KKD A;  4TOI A;  1FOU A;  1FKA O;  3W7T A;  3APO A;  4PI2 A;  1K8A W;  3M7M X;  1JMK C;  4NB5 A;  2XUM A;  4J42 A;  2D2C B;  3JYC A;  2ZE5 A;  4BIU A;  4PI0 A;  2UXB O;  4X1K B;  1FFX B;  1SKV A;  2Q68 A;  4O4J A;  2WLI B;  1GN3 A;  5KA6 A;  2ZDI C;  2WA4 A;  2QTO A;  3L70 H;  1NS1 A;  1SS3 A;  2YXL A;  3CRM A;  4QNH B;  1SZT A;  3DC5 A;  4JI2 B;  2ETN A;  4XDL A;  4IT5 A;  2EZP A;  2A06 H;  2CTP A;  5KHK A;  2MK3 A;  2E5L B;  3OTF A;  4RAI A;  1GMG A;  4DV6 B;  2V1D A;  4B3R B;  4R7C A;  1FFX A;  1PL4 A;  1JX9 A;  1IBL B;  3ZRW B;  1M5I A;  4K35 A;  2Q67 A;  2FKX A;  4DR6 O;  2ZE7 A;  3H1J H;  3ZMS A;  3UO2 A;  2P22 C;  5GW7 A;  1FFT B;  3EVK A;  1MMM A;  4JI6 B;  5LHH A;  3ZS8 C;  4Q6G A;  1Y76 A;  2DQ0 A;  3WG7 C;  1FXV A;  1K5S A;  5EBL C;  1ZLZ A;  1YIJ V;  2Q7G A;  2JIZ G;  3HKB A;  2WPD G;  1TUB A;  4LF7 B;  4GZR B;  2GUZ B;  1YZB A;  2LW7 A;  3BFR A;  1VQP V;  5H6R A;  1TVK B;  4J11 A;  1WB8 A;  1IBM B;  1BGY H;  3AG1 C;  3O9O A;  3VQV A;  1QR8 A;  2BSK B;  4GKJ O;  4DK1 A;  2HG5 C;  3DSQ A;  1AR4 A;  2L35 A;  2EIM C;  4FM2 A;  1XMO B;  1B06 A;  2GSM B;  4X66 B;  2CTW A;  4UB6 Z;  3OR7 C;  4I55 A;  5DM6 V;  1IUR A;  3ASO C;  3ASN B;  5CMU A;  2LFR A;  3FB5 C;  4UCO A;  1AI6 A;  4LC1 A;  4LWS B;  3CHX A;  5LP6 C;  1VQ7 V;  2Y4U A;  2HP8 A;  4BW9 A;  2L6L A;  3OMA B;  1Z5W A;  1LNQ A;  4FLY A;  2K9P A;  5BY1 A;  4IYH A;  4Q20 A;  3AG4 C;  5CN0 A;  2DJV A;  5LMN B;  2IJI A;  1EN5 A;  2F66 C;  1OCR C;  5K1P A;  4B3T B;  1O9H A;  5KA5 A;  2PUS A;  3CME V;  1RM1 B;  4I5S A;  4J41 A;  2ZIM A;  1QHT A;  4PHZ A;  3QG5 A;  3FAV A;  3EXA A;  5J2T A;  5FNV B;  3LUT B;  2PF4 E;  1N33 O;  1OCO C;  5D5Q A;  5H9C A;  4I50 B;  1VQ4 V;  1S3J A;  3OMI B;  3J81 N;  4CH3 A;  4QE7 A;  1PD3 A;  2MW2 B;  1P7B A;  3H9V A;  3AG1 B;  4UV8 A;  1SQP H;  4LP8 A;  3AG2 C;  3EHB B;  1AI5 A;  2IJJ A;  1IBK O;  5IY5 B;  4W4L A;  2LGW A;  4DR4 B;  2P4K A;  1IVS A;  4MTG A;  1QVF U;  1VF6 C;  2HLD G;  2YC0 A;  1H2N A;  3ZHR A;  4HNA B;  1DF5 A;  1N32 B;  1QU7 A;  2FB5 A;  1PKX A;  3E35 A;  1HNZ O;  4YXW G;  2EIJ B;  4D7S A;  3WB0 A;  4JYB A;  3IC7 A;  1WP7 A;  4PDL A;  1XMO O;  3OD4 A;  2QKS A;  2XHB A;  1S5J A;  4MVS A;  1JCH A;  5E79 Z;  2UUB B;  4IL6 Z;  2XT9 A;  4K3A A;  5BR8 B;  4YJ3 A;  1XQ8 A;  5CA3 A;  2P67 A;  4NTX A;  2B5U A;  2HJD A;  4L87 A;  1SQQ H;  1GM9 A;  2ADQ B;  4E2L A;  2LGQ A;  4LFA O;  1SQX H;  5GON A;  3CC7 V;  5ITZ A;  4X62 B;  1GH6 A;  1K34 A;  1HNX O;  1IBL O;  2YDE A;  2AZ0 A;  5L3B A;  1YCI A;  3E8H A;  4MVM A;  3Q4H A;  4CS2 A;  1HDJ A;  4DW1 A;  1X4T A;  4UVB A;  4YIO A;  1CP9 A;  3ZMV A;  3KKY A;  2RMK B;  4BWA A;  2HR3 A;  1D2D A;  2ZQM A;  3Q4H B;  2GHY A;  2XOK G;  4B3T O;  3HKD B;  4PA9 A;  1JFF B;  1NT2 B;  5KAI Z;  4UXN A;  3A0H Z;  5H6Q A;  4PA6 A;  1XL6 A;  2QWP B;  3N2K A;  3T2M A;  2ATK C;  1KC8 W;  3WU2 Z;  4LNU A;  5CBG A;  2DWD C;  4LF4 O;  3CYO A;  3K5L A;  3CXH F;  1Q6U A;  4PDV A;  1EZV H;  3F7V C;  4DR3 B;  1SC5 B;  5LXT B;  3P3N A;  4JGS A;  4H44 B;  3QNE A;  1S77 D;  1US6 A;  4FM1 A;  3PN1 A;  3CC2 V;  1PV0 A;  2ARH A; 
#chains in the Genus database with same CATH homology
 2GDS A;  3BFR A;  1IX9 A;  1BSM A;  2CE4 A;  1GN6 A;  4GUN A;  5A9G A;  1EN4 A;  1AP6 A;  1WB8 A;  1PM9 A;  3RN4 A;  1I0H A;  1XUQ A;  3KDR A;  1MSD A;  2RCV A;  3K9S A;  1EN6 A;  1AR4 A;  3CEI A;  1B06 A;  1N0N A;  1SZX A;  1XIL A;  4JYY A;  1D5N A;  2CDY A;  1I08 A;  3C3T A;  1GN3 A;  3MDS A;  2ADQ B;  3OT7 A;  2QKA A;  1MA1 A;  1IXB A;  1JR9 A;  1GN2 A;  3DC6 A;  1ZUQ A;  5AG2 A;  1VAR A;  3DC5 A;  1WB7 A;  4YIP A;  1EM1 A;  1QNM A;  3IC9 A;  1P7G A;  4C7U A;  1EN5 A;  1XDC A;  3LSU A;  1PL4 A;  1AR5 A;  3TJT A;  1JA8 A;  3AK1 A;  3C3S A;  1GN4 A;  1MNG A;  1VEW A;  4YIO A;  4FFK A;  3AK2 A;  3KKY A;  1LUW A;  3EVK A;  3QVN A;  1ZSP A;  4E4E A;  1MMM A;  2AW9 A;  1IDS A;  1XRE A;  1Y67 A;  2QKC A;  4JZG A;  1ZLZ A;  1BS3 A;  1N0J A;  2ADP A;  2P4K A;  1KKC A;  3AK3 A;  4X9Q A;  4JZ2 A;  1AVM A;  1ZTE A;  4F6E A;  1LUV A;  4BR6 A;  1BT8 A;  1AP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...