1LUVA

Catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Catalytic and structural effects of amino acid substitution at histidine 30 in human manganese superoxide dismutase: insertion of valine C gamma into the substrate access channel
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1luvA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1luvA02
1D5NA 1GN4A 2GDSA 2AW9A 4JYYA 1ZLZA 1MNGA 1EN4A 1JA8A 3IC9A 3EVKA 1XUQA 1ZUQA 3C3TA 3RN4A 1AP5A 1XILA 1XREA 1ZSPA 1PM9A 3KKYA 3OT7A 1WB8A 2P4KA 1IX9A 4C7UA 4JZ2A 4BR6A 3AK2A 2CE4A 1I08A 4GUNA 1AR5A 3QVNA 4E4EA 3LSUA 1Y67A 4YIPA 2RCVA 1N0JA 1PL4A 1AR4A 1VARA 1N0NA 4JZGA 3AK1A 1WB7A 4FFKA 1KKCA 3CEIA 1MMMA 1QNMA 1I0HA 1P7GA 1VEWA 1BT8A 1JR9A 1MA1A 1AP6A 1BS3A 3MDSA 5A9GA 1BSMA 1B06A 3C3SA 3DC6A 4YIOA 1LUVA 1EN5A 2QKAA 1AVMA 4X9QA 2CDYA 3BFRA 1EM1A 1EN6A 2ADQB 1MSDA 1XDCA 1SZXA 1IXBA 1GN3A 1ZTEA 2QKCA 1LUWA 3AK3A 3DC5A 5AG2A 4F6EA 3K9SA 1GN2A 3TJTA 1IDSA 1GN6A 2ADPA
chains in the Genus database with same CATH superfamily
2HEPA 2VWKA 3BY6A 1K33A 1W2BU 2Q0AA 5BR8B 2EIKB 1H38A 1OCRC 1DTOA 3L74H 1XUQA 4O4HB 5B1NA 2HLDG 4UCSA 4B3MB 3JYCA 5E79Z 1M56B 1SETA 2PGGA 3JSLA 2F93B 4FZ1A 3LNMB 2PYJA 1WB8A 3CD6V 1WN7A 1SS3A 4LF8O 1S5LZ 3W7UA 3E22B 1OCOB 1AR5A 4LF7O 3MHHC 2AHZA 2AHYA 2LW1A 3ZRVA 1NH2D 2Q7HA 4J7KA 1XMQB 3OGIB 3W7SA 2P7TC 1RSOB 3SR2C 4JZGA 4DK1A 4FJCC 4JI2O 3RYCA 4KFMA 3T1CA 2Q9LA 1H8EG 5B1BC 1AI4A 3CEIA 1S5JA 2QM8A 3AG4C 2YXLA 2QGNA 4DR2O 1BT8A 3K03A 4O4HA 1BCCH 3ZJZA 4DV5B 1G1XB 4ZKIA 3L9DA 1VIBA 1JVMA 3G71V 1XHZA 1B06A 3T1HB 5KHIA 1Q6UA 3DC6A 1NS1A 1OCZB 3RYHB 1KD1W 4U7NA 4DUYB 2XOKG 3CXCU 2UUCO 5LGTA 4JI1O 4QE9A 3E22A 2R72A 4K35A 3ASOB 1DF5A 2ODMA 2DW4A 1RSOA 4XDLA 2W0XA 4RAIA 1MZEA 3FX7A 3SYQA 1QHTA 2MW2B 2XAFA 5EIBD 4J9YB 2A7WA 1XHXA 3ZHTA 1DLBA 1COWG 4DYLA 4WBNA 4YHHB 2EX3A 5D5QA 2Q69A 5K1PA 5JJNB 2Z0AA 1AI5A 1YZBA 5JVDA 4LFAB 1HWYA 4JYCA 5LYJB 2DMXA 2HR3A 2VS0A 2QTSA 2CTRA 2F4VO 2RMKB 3UM7A 3JD3A 1WP7A 1XNRO 4DR6O 1AJNA 2WSSG 4R50A 3SGIA 2CTPA 1SQBH 4MVZA 2X0LA 2KG7A 2WLJA 4ZI7B 4AQYO 3OMNB 2A79B 1NVPD 2D3OW 4CH4A 3IAYA 3ZHVA 4JZ2A 4BAYA 3ML0A 1AJPA 2YIBD 2FL4A 2VWJA 3I56V 3CCSV 2OWOA 5LHGA 1H2KA 1ZL8B 3SYAA 3JASB 5H5NA 3JAWB 3STZC 4FFKA 4PDLA 4LF6O 4J41A 2OIEA 1P7GA 4J80A 5H6RA 2L35A 3TCUA 4ASUG 1MA1A 1O9HA 2UXXA 4UXNA 5CBGA 3ZRSA 4YJ3B 5IDJA 1VQKV 2DYRC 2ZT9B 4J10A 4EFEA 3B77A 1SESA 2HJDA 4O2BA 1FXHA 4ZI7A 1YIJV 3CMEV 1W59A 3UT5A 4QPJA 1HR0B 2ATKC 1PV0A 1Y66A 1SZXA 1M5IA 2ZXWB 4RQFA 4O4JB 1ZL8A 3IGAC 2YS8A 4DV6O 1XL6A 4CS4A 2YI9A 1F4MA 2Z3YA 4PD4F 4FLUA 1M4UA 1MOFA 2ARHA 4TQDA 3FD9A 4FVMA 2ADPA 4QIWF 1W0KG 4EB6B 1VQ9V 4JTAB 4JYYA 2DWDC 2LJ2A 3K57A 4YY3B 3LDCA 1AILA 4LF8B 4TSFG 3JALA 3M99B 2FMLA 3RFRA 1BQZA 3J7AU 1PNMA 2NR5A 3ASNB 5CA0A 3CCMV 4LF7B 4PA9A 2L6LA 3U0ZA 3CC4V 3ICXA 1ZX3A 4JI2B 1OV9A 2PTMA 5KHJA 2DWEC 3TETA 5LBQA 4FLWA 2ZKOA 3D36A 2EILB 1OCCB 1G8MA 5EBWC 3FB8C 4DR2B 1SC5B 4RWUA 3QNEA 4PDMA 2WLNA 3ZX6A 3WB0A 1B6QA 2IW5A 1I94O 2ILMA 4UCVA 2Q73A 1SQVH 1FFXA 1EBOA 5FLXN 4B08A 3J81N 5DEDA 1H2GA 2KSDA 4CBCA 1WA8A 2UUCB 3R65A 4LR3A 4JI1B 1VQMV 4QE7A 1N32O 4WCEV 5GTIZ 1PKXA 1CPYA 1VF6A 1UPGA 2CUGA 4DR1B 4CS3A 4BW9A 5EZYB 1L0NH 1U97A 2WLHA 3LUTB 3E2EA 3BEHA 4DW0A 3K06A 1EN6A 2EIJC 1FYJA 4OX9O 4ZOLB 2DQ0A 1JOYA 1YSCA 3ABKB 5LXTB 3JAKA 5KMGB 3B40A 2YUAA 1LR1A 4I9QA 2F4VB 1XNRB 4DR6B 3IFXA 5CA1A 1KMIZ 4NTYA 4GX5A 4I55B 4W4LA 1QQCA 2XAQA 2M6YA 1VQ5V 1MNGA 2JGDB 4MTGA 1N34O 1N33O 4AQYB 4P30A 4LP8A 4NYKA 1YJNV 1RPOA 1R3KC 2OYQA 2YIAA 3ZMTA 4JI0B 2WLLA 1FXKC 2ZD9A 5EZYA 1UFIA 3KKYA 4OXSA 3LNNA 3BHPA 4JAUA 4O4IB 1M93A 1KQSU 3LDDA 3AK2A 1S0VA 4B7KA 1GM9A 1CXZB 1Q6IA 2CAZC 2Y0IA 2PYLA 3OFNG 4MTXA 5IJ0A 4LF6B 2UXDO 5KMGA 2YEVA 5IE9A 1Q90D 2QSAA 4DV3B 2KB1A 4UB6Z 5B1OA 4UCOA 2D2CB 3CRCA 1S3JA 4ABMA 4I55A 3CC2V 1Z5VA 5HFLA 2ITCC 2JGDA 1RPRA 1BL8A 4JI6O 2YIDA 3ABMB 2KKWA 1FD9A 1EZVH 3U11A 4X20B 2Q7EA 4IIJB 3CCEV 4O4IA 3ABTA 4LC1A 3OUSA 2QWPB 3GWOA 1V55B 2QWQB 4DV6B 1GH6A 3CRQA 5KLVH 5J2TB 4DV7O 1E79G 3BFRA 5JQGA 5IY5B 4O2AA 4ZHQB 3ABUA 4JAVA 4X88A 3P30A 1U96A 1Y76B 1J5EB 5EBMC 3JD0A 1GN6A 2RNBA 2E3CA 4FMTA 1GRJA 3ZMUA 4X1IB 5L3FA 1TVKA 1IXMA 2EIKC 3CCJV 3H9VA 1XNQO 2F66C 3HKCB 3E8BA 2V7QG 5GW7A 3ZMSA 3WG7B 1V54B 4IIJA 1GM8A 1QVGU 2B9ZA 4NTWA 4JI4O 2QWRB 3OTOO 4HAMA 3CCUV 5LA6B 4YJ2B 3SJBC 3K9AA 4X62B 1OCOC 4JYAO 3SPGA 4B7EA 2QM7A 3D8CA 1NH2B 5JCOA 1I94B 1Y67A 1Y76A 5C8YB 1H8HG 4I4TA 3AK1A 5FNVA 4D7TA 3JSNA 4X1IA 1TAEA 1QR8A 2ZQMA 2LGWA 1KYOF 4BIUA 4IHJA 1VQ8V 1N32B 3NR7A 3FB6C 1K9MW 1IBKO 4FLTA 3M7MX 1ENVA 3T4ZA 5A9GA 2XAHA 3G6BA 3TK1A 4NB5A 4DR4O 1VF5B 1WNSA 2CGOA 5L3CA 1KU9A 2YXHA 4JTDB 1JJOA 4H44B 1LUVA 1X4TA 4UFZA 4W4KA 2Q8VA 4IT5A 5CB4B 1NTMH 4OPHA 1DF4A 2H94A 3ASOC 3FAVA 2E5LB 4N23A 2QJ1A 3W7TA 1A32A 5C8YA 5IYZB 3OTFA 5CA3A 4LF9O 2N74A 1N33B 1K3EA 3CC7V 5JH7A 1VMGA 2VQFO 1GO3F 2WLMA 4IYHA 1ZLZA 3FYEB 3AG1B 1JA8A 4FM2A 2OT5A 3SJCC 4EEQA 1XI1A 2OTJV 3F5TA 4GX2A 2DYSB 2IBZH 2JVDA 1M90W 3SPCA 1WLEA 4K3AA 1Q6HA 2IJHA 1NVPB 4NXNO 3RYCB 4PI2A 4U3JB 1XMOO 5EYPA 4IL6Z 2DN9A 2HHHB 3HKDB 5IYZA 2LQTA 2R9IA 4PDVA 1PNLA 2RQ6A 4K0KO 4DUZO 4QJFB 4JI6B 1GAXA 3B4SA 1XBLA 4CZZA 1N4CA 1SQPH 1R6KA 3DGEA 1D2DA 3CCRV 1SQFA 2NNUA 4XDJA 4EFBA 1VEWA 1SQQH 4H33A 1JR9A 1RM1B 3A0HZ 5B1AC 4X66O 2P6JA 3QTCA 4WFAV 3SPJA 5LP6A 4WFGA 3STLC 3CPWU 3C3SA 2CK3G 1PP9H 3EXAA 3K04A 2XAGA 4WFHA 3H01A 4U3JA 3HB3B 1P84F 3FKSG 2X7RB 2YIBA 2ZXWC 3W7XA 4WBNB 3HKDA 4MVOA 4KHPO 2B1IA 4UCUA 2HP8A 5EC2C 3RT3C 5HFMA 5JVDB 3DC5A 5F2VO 1FXVA 4DV1O 4F4LA 2EJ7A 1XNQB 3JCZA 2V4DA 3TXSA 4OPAA 2CGNA 2KG7B 2OIGA 1P7BA 2LO1A 1FPOA 3IJ4A 1EN4A 4JI4B 3ETDA 1HP8A 2E76B 3S3XA 3MD0A 2JIZG 4DR5O 4JYAB 1XILA 2N05A 3SYOA 1AROP 1ZSPA 2N04A 1VF6C 2BOBC 1M57C 1YVWA 2RDCA 4DK0A 3ETGA 1V9PA 3X2QB 3NXSA 1DK1A 1SA0A 4BR6A 3KG2A 3L70H 1KECA 2EILC 2LP7A 1K7DA 2YI8A 3C90A 3ZN1A 1AB3A 1H2LA 2UXNA 1K97A 4FM0A 2FTKA 1N0JA 2ZDIC 3TXQA 1VQ4V 1URFA 1IBKB 2X6BA 1LNQA 4O2BB 5CMUA 1KKCA 3KCYA 5EK0A 1R3LC 2QWOB 1T5EA 2R70A 3UT5B 4DR4B 1YTFD 4JYBA 4JI5B 3K08A 1NT2B 1SRYA 4UCRA 4GZRB 3L73H 3E8FA 3LSQA 3HKEB 3P32A 4U7OA 4LF5B 2Y69B 1PL0A 1NBMG 1AVMA 4LF9B 4QGPA 4J11A 5TISZ 1JQ0A 4G2KA 4DV0O 3ABKC 2Q6AA 1NR7A 1LUWA 2VQFB 3E8HA 5LMUO 4MVMA 3K59A 1YJWV 1YCIA 2MK3A 3JALB 3K79A 4TT3G 1VP7A 3UO3A 4F6RB 1HNWB 1VQLV 1THZA 5CA0B 4X89A 4Z1MG 4LF4O 5KX5A 2AW9A 3GWKC 5C93A 2IU3A 4DV2B 1L8DA 4NXNB 2YDEA 4G28B 3HKEA 3ZN0A 1IBLO 1Q7YW 4MSWC 3C3TA 3WB1A 1XMOB 3UKMA 4BW5A 4JI3O 3BA8A 3B09A 3OEHG 4Z2WA 1RFYA 4DUZB 4P9PA 3AG4B 2W6IG 4UVBA 3SPHA 1H2SB 5B3SB 1VQPV 2Y48A 3CS5A 3QVNA 1FFXB 3N27A 1OZ0A 4ZIBA 1EZJA 1WA8B 4F6RA 2V1DA 4AILC 2QEXV 3AG2B 4X66B 2AZ2A 2P4VA 3WFVA 1MMMA 5CN0A 2IM9A 1R3IC 4KP4A 1E1RG 3QO8A 2HG5C 2A3QA 5JJEB 3T1YO 1SERA 4DR3O 4JI8O 1JNBA 1F51A 2GSMB 2E74B 3F7YC 1VQNV 1M1KW 2IJKA 3A0BZ 3K3WA 1IBMO 2K9PA 4TWKA 5LMNO 1NI8A 3VQYA 1V55C 1KKDA 3JAKB 4YIOA 4WFBV 3OUFA 4KL1A 2XASA 1GMGA 1Y74B 2Q67A 2EULA 4LH7A 2F23A 3DXRB 2GV9A 4RQEA 5IY5C 3VOUA 1JCHA 4DV1B 3CCLV 1MSDA 1JJ2U 5CA1B 5LGUA 3BABA 5LGNA 2LFRA 4B3TO 1FKAO 5FPOA 2ZINA 4JF3A 5DN6G 4B3SO 2F95B 3VQVA 4LNUB 2WLLB 4DR5B 3CCVV 1QCEA 3DTUB 3H1KH 3JATB 3CHXA 3ZS8C 4X65O 2JJ2G 3H1HH 3WG7C 1V54C 1NR1A 3OR6C 2EZPA 5IJ0B 2JGUA 4PV1B 4A5UB 2BTQA 2YEVB 1Y74A 3K0DA 3DXRA 5FL7G 2P4KA 5L3GA 2JRIA 5GONA 5K1XA 2EINB 4YXWG 3UCSC 1M9NA 3JARB 1OJHA 4FPPA 4LNUA 2XUMA 1BQ0A 3JATA 4JAAA 3BPZA 4FZ0A 3G80A 3Q4HA 1J95A 4BIOA 2QA4V 5JQGB 4O2AB 4FLVA 3OM3B 4DV4O 2K1EA 5EBLC 4X64O 1TUBA 1IZ3A 4DV0B 4FIPC 4PA3A 1AI6A 4LFBO 5LMUB 2QKAA 1FAFA 3S3WA 2CDYA 3H1LH 1YITV 4B3RO 1XOUA 2WWWA 2C2AA 1TVKB 1K73W 2AZ0A 5LHIA 3ZIAG 4LF4B 5EIBC 3K0GA 3JARA 1AR1B 3U10A 4WF9V 5IT9N 3B8NA 1IDSA 4IGGA 3ZRWA 1IBLB 3HPLC 1P49A 3AG1C 1R1BA 3LSSA 4GLXA 4JI3B 1MSWD 4LWSA 4CC6A 1BHBA 4HBNA 2Y4TA 5FPRA 2DYSC 3OMAB 4GT1A 3RN4A 4UVAA 2PY5A 2UU9O 2ZR2A 5LOVA 1IJGA 1NTKH 2BSKB 3AG3B 4I4TB 5FNVB 2BCCH 3BA9A 3K5OA 1Q5OA 1YHQV 4IHJB 2Q68A 2QDOA 1M56C 3SJAC 2UXCO 4YIPA 1KP2A 5H2FZ 3T1YB 2RCVA 2QTOA 4DR3B 1PL4A 4JI8B 1IVSA 1S72V 1Y6XA 4O4LA 1R6NA 4L87A 1IBMB 3WU2Z 5H6QA 2RN9A 2EJRA 5LMNB 3OEEG 1RM1C 1H5WA 2JS5A 3T1HO 5CBFA 3FAVB 2Z5UA 1MG1A 4LH6A 2BSKA 1D5AA 1L0LH 4GKJO 4BWAA 4I9WA 2VQEO 2YC0A 4B3TB 1QLEB 2ZIOA 2WA4A 4X1YA 5JH7B 2GTAA 1EM1A 3L71H 3RW0A 3P3NA 1BZKA 4B3SB 4TUYA 3CXHF 3EHBB 3G67A 5KAIZ 1JMKC 2PUSA 1QVFU 1OCZC 4OX9B 3ZHSA 4CH5A 4LBEC 1FXKB 2YSUB 4GX0A 3JAMN 5A2QN 2ZE7A 4HNAB 1BGYH 5ITZA 5LL6Y 2ZR3A 2PZSA 3FYIB 3MHSC 1Z5WA 2P22C 1B04A 4UV9A 4D7SA 1XQ8A 3VQWA 3RYFB 1MABG 5KA5A 2GHYA 5EYPB 3RWRD 3ABLB 4L8JA 4QNHB 2NLJC 1F7YA 4H13B 1HNZO 1N34B 2UXBO 2PF4E 1CEZA 1GKFA 3X2QC 2ZE5A 2WLIA 2ZCEA 3RVYA 4R8CA 5JJJB 3OMIB 2CTWA 1TGOA 2B5UA 2XTAA 2FB5A 5E1AC 2AGAA 2P90A 5KUMA 2JK5C 2B1GA 2ZNJA 3RYIA 3K5MA 1N36O 3CRRA 4NXMO 3HKBB 1FXKA 5LP6B 1WAZA 1WJZA 4DV4B 1K4DC 1SQGA 4HNAA 2UXDB 4EKWA 1YI2V 1YTFB 4NTXA 1ZAUA 5L3EA 3ZMZA 4LFBB 1SF9A 3RYFA 2GUZA 5EC1C 2WA3A 3MDSA 1BSMA 4B3RB 4RO2A 1HR0O 1YXBA 1Q86W 4XDKA 4UVCA 1US6A 1TA8A 4FFBA 3BCCH 2OCCB 1E1QG 2UUAO 2KQXA 1G4YB 2BOCC 3L72H 3J80N 2JEXA 3I55V 3CSXA 4PI0A 4DV7B 4U3FH 3HKBA 4GKKO 2YXYA 4AI8A 3H1JH 1GN2A 4YY3O 3ZHQA 4R6ZA 4DRXA 2P67A 2WLKA 2Y0PA 4FLXA 3F5WC 5J2UA 2IH1C 2UU9B 1CP9A 4MTOA 1Q82W 1R73A 1SA0B 3IC9A 5KA6A 2EIMB 3SYCA 2ZNIA 3ZRXA 2DOSA 2G38A 3D36C 1IURA 4I0XB 1Q43A 3D3IA 3OT7A 5BY1A 3E89A 4H0LB 1BE3H 3SJQC 2UXCB 2H8PC 1I5XA 1AJQA 1K5QA 1KP3A 2JEUA 4NR1A 1JPXA 4MW3A 3GVMA 4MVUA 1I5YA 2EBOA 5B3SC 4UUJC 5DECA 2P06A 1PPJH 2AXTZ 4E4EA 3OTOB 4TV8B 3W7WA 3B8MA 3AG2C 3ZBHA 3ASNC 2R9RB 1N0NA 3OW2U 5IWAO 1BHAA 5L3BA 3JCUZ 2GBOA 3WB2A 3ZMVA 1B3QA 4GKJB 4JI7O 2VQEB 3O65A 1AP6A 4GYCB 4DR1O 1OCCC 4I0XA 2A06H 5IYCO 1KUQA 1RP3B 1JFFB 1P4RA 1I7FA 1UJWB 3QG5A 4FK5C 1KBHA 3K58A 1EN5A 4H37A 1KC8W 2VRZA 2IH3C 1K92A 1Z2GA 4JPRA 5KX5B 1ORQC 4TV8A 2QKCA 1NJIW 4TQFA 3RVZA 4GCZA 4K8XA 3E86A 5AG2A 3JD2A 3RYHA 3K9SA 4CS2A 1PD3A 4DW1A 2DQ3A 1D5NA 4X1KB 5IYBO 1HNZB 3APOA 4JI0O 2UXBB 3DSQA 4PA4A 1Q81W 2XNDG 4G27B 2WAMA 1OCRB 1JFFA 3CJHB 3AG7A 3OGCC 3L75H 1S76D 1SKVA 2Q5ZA 3AEIA 1IX9A 3CX5F 3KZIZ 5BXZA 3A8TA 3CRAA 1N36B 4NXMB 2EINC 5LYJA 4PHZA 5KHKA 4DV3O 1I08A 2BE3A 4OGQB 4UCTA 5B1AB 3KDRA 3LSUA 3TGUH 3ETEA 3K5NA 2HVJC 1AR4A 4P9OA 1WB7A 4UV8A 4X1KA 2WPDG 4K0KB 1BMFG 5B1BB 4D6TH 2X6CA 4MW8A 3MAQA 2JDIG 2CTQA 4J9ZB 2UUAB 3JASA 3JAWA 2NN4A 3CJHA 1SZTA 4N21A 1WP8A 3OD4A 5H9CA 3F7VC 2UUBO 4PA7A 2Q7GA 4GKKB 1HW7A 3OE7G 3A0RA 3B2EE 1F4NA 4PJ0Z 3ABMC 1J5EO 3SDLA 4YJ3A 2ZIMA 5JWPA 3UQ8A 5J9PC 5DM6V 4AHCA 3G4SV 5LHHA 3TJTA 4KHPB 3GB7C 2BTQB 2Y4UA 3ZHUA 1VF7A 4PDRA 1M57B 2HVKC 1GN4A 1HNXO 3BAAA 4JTCB 2XT9A 4O4JA 4HYOA 5BZBA 2XAJA 5KHHA 5GONB 3FB7C 2PI5A 3E8GA 3SYPA 5JCOC 4J42A 2GTSA 3E83A 5KAFZ 2JS3A 4X62O 2O57A 2ZM6O 3AG3C 4EB6A 2M7WA 1Q8IA 1TUEB 2A0LA 3T4DA 3OAAG 1VQ6V 5IWAB 4JV5O 2IJIA 1N8RW 1PNKA 1VQ7V 4GUNA 3Q4HB 4MTFA 4QPKA 4KUMA 1R3JC 4WFFA 4JI7B 2H3OA 5GTHZ 1TUBB 3LDEA 1FFTB 2LFSA 4J7JA 1QNMA 4ICGA 4WFEA 3QO5A 2RJZA 4GX1A 1FOUA 1YDXA 1JX9A 5B66Z 1ROPA 2HFEC 2FYUH 2ZDIA 1F23A 1GM7A 4R7CA 2DYRB 4LCUC 1FJGO 1FS0G 1QLEC 2E5LO 2IU0A 2F43G 4ZBMA 1WPXA 3P3PA 1R6TA 2EZOA 1YF2A 3ZRWB 3CP1A 1G6UA 4Z1VA 3ZEDA 4MVQA 1GN3A 3PN1A 1ZTEA 3AK3A 3EFFK 4RUEA 4LWSB 3IC7A 2XHBA 2PI4A 3KCXA 4LFCO 4CH3A 4NKGB 2IJJA 3BRCA 3OR7C 4IYIA 5LOVB 4DR7O 3QO7A 1MZFA 1NU1H 3CRMA 4ZOLA 1NKDA 1YJ9V 5D5PA 1WPBA 1K5SA 5LXTA 1VQOV 3EVKA 1X59A 3ABLC 4UB8Z 3R66A 2LW7A 1AP5A 3A2FA 3ZCCA 3BVOA 1XREA 5L3DA 2DJVA 3ETQA 3M8AA 2HHHO 5BR8O 4I5SA 4DO2A 2BTOA 2QKSA 5B5EZ 4C7UA 1QBZA 4B3MO 4O4LB 1GTOA 3HR0A 4MVRA 5KHGA 2ETNA 3CWBH 4MT8A 4MS2A 4I50B 5KUKA 5BMVB 2A9HA 5CBHA 1Q3EA 5LP6C 5IJ9B 1HDJA 3T2MA 2E75B 4TV9B 2OTLV 3E35A 3FFQA 3PJSK 3RBZA 4TOIA 1I0HA 4X1YB 4RUFA 1XMQO 2UUBB 4XBFA 4PELA 1BS3A 2QM4A 2Q0OC 1L1FA 1XEQA 3JD4A 4TUYB 4JASA 3CMAV 2OCCC 1H2NA 4DV5O 2OCHA 1S77D 4CH6A 3QF7A 2FKXA 4FM1A 1QR9A 2ADQB 5ITZB 4I50A 1IXBA 2EIJB 5BMVA 3RGBA 4X20A 5IJ9A 2W0FC 4KXRA 1HNXB 3CE2A 3D3QA 4DUYO 4TV9A 1NQTA 1OHHG 5J2TA 3CCQV 1QLNA 2JJ1G 2HJFC 2QWNB 4BIZA 4ZHQA 1S5HC 4FLYA 2GDSA 3THOA 2EIMC 1EFRG 2DE0X 2WLIB 2ZM6B 4FLZA 2CH7B 2YICA 1ZUQA 4YHHO 3N2KB 3O9OA 1PM9A 2ITDC 4JV5B 3JD1A 1K4CC 4X65B 2R9AA 3N2GB 3RYIB 2W6JG 2P5OA 4LFAO 3VQXA 1ZWIC 4MVSA 1KB9F 4E2LA 1NZ6A 4DXWA 2CE4A 3HKCA 4Q6GA 2ZE6A 4J7ZA 3FB5C 5IYDO 2GUZB 3ZHRA 1NTZH 1DGSA 3H1IH 2Q4PA 4JI5O 1VARA 1Y4MA 5LA6A 4YJ2A 3APQA 4FFBB 3I5DA 2F1MA 1FJGB 4P2ZA 2CH7A 4NVPA 3CB2A 1O9GA 4LF5O 4I7ZB 1GK9A 1K34A 1XL4A 3N2KA 3SPIA 1YEWA 2LGQA 3N2GA 1SQXH 2ZE8A 4HZ3A 1H2MA 4PA6A 1K8AW 3K5LA 3G6EV 4X9QA 4X64B 4K8ZA 1W0JG 4DRXB 4LFCB 3VBBA 1XDCA 5J2UB 2X6AA 4DR7B 1QU7A 1HNWO 2QR4A 4F6EA 1AI7A 2Y69C 4CC5A 4DV2O 5CB4A 4JGSA 4X8AA 2HKOA 2QE7G 3CYOA 4Q20A 3UO2A
chains in the Genus database with same CATH topology
1D5NA 1GN4A 2GDSA 2AW9A 4JYYA 1ZLZA 1MNGA 1EN4A 1JA8A 3IC9A 3EVKA 1XUQA 1ZUQA 3C3TA 3RN4A 1AP5A 1XILA 1XREA 1ZSPA 1PM9A 3KKYA 3OT7A 1WB8A 2P4KA 1IX9A 4C7UA 4JZ2A 4BR6A 3AK2A 2CE4A 1I08A 4GUNA 1AR5A 3QVNA 4E4EA 3KDRA 3LSUA 1Y67A 4YIPA 2RCVA 1N0JA 1PL4A 1AR4A 1VARA 1N0NA 4JZGA 3AK1A 1WB7A 4FFKA 1KKCA 3CEIA 1MMMA 1QNMA 1I0HA 1P7GA 1VEWA 1BT8A 1JR9A 1MA1A 1AP6A 1BS3A 3MDSA 5A9GA 1BSMA 1B06A 3C3SA 3DC6A 4YIOA 1LUVA 1EN5A 2QKAA 1AVMA 4X9QA 2CDYA 3BFRA 1EM1A 1EN6A 2ADQB 1MSDA 1XDCA 1SZXA 1IXBA 1GN3A 1ZTEA 2QKCA 1LUWA 3AK3A 3DC5A 5AG2A 4F6EA 3K9SA 1GN2A 3TJTA 1IDSA 1GN6A 2ADPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D5N A;  1GN4 A;  2GDS A;  2AW9 A;  4JYY A;  1ZLZ A;  1MNG A;  1EN4 A;  1JA8 A;  3IC9 A;  3EVK A;  1XUQ A;  1ZUQ A;  3C3T A;  3RN4 A;  1AP5 A;  1XIL A;  1XRE A;  1ZSP A;  1PM9 A;  3KKY A;  3OT7 A;  1WB8 A;  2P4K A;  1IX9 A;  4C7U A;  4JZ2 A;  4BR6 A;  3AK2 A;  2CE4 A;  1I08 A;  4GUN A;  1AR5 A;  3QVN A;  4E4E A;  3LSU A;  1Y67 A;  4YIP A;  2RCV A;  1N0J A;  1PL4 A;  1AR4 A;  1VAR A;  1N0N A;  4JZG A;  3AK1 A;  1WB7 A;  4FFK A;  1KKC A;  3CEI A;  1MMM A;  1QNM A;  1I0H A;  1P7G A;  1VEW A;  1BT8 A;  1JR9 A;  1MA1 A;  1AP6 A;  1BS3 A;  3MDS A;  5A9G A;  1BSM A;  1B06 A;  3C3S A;  3DC6 A;  4YIO A;  1LUV A;  1EN5 A;  2QKA A;  1AVM A;  4X9Q A;  2CDY A;  3BFR A;  1EM1 A;  1EN6 A;  2ADQ B;  1MSD A;  1XDC A;  1SZX A;  1IXB A;  1GN3 A;  1ZTE A;  2QKC A;  1LUW A;  3AK3 A;  3DC5 A;  5AG2 A;  4F6E A;  3K9S A;  1GN2 A;  3TJT A;  1IDS A;  1GN6 A;  2ADP A; 
#chains in the Genus database with same CATH topology
 2HEP A;  2VWK A;  3BY6 A;  1K33 A;  1W2B U;  2Q0A A;  5BR8 B;  2EIK B;  1H38 A;  1OCR C;  1DTO A;  3L74 H;  1XUQ A;  4O4H B;  5B1N A;  2HLD G;  4UCS A;  4B3M B;  3JYC A;  5E79 Z;  1M56 B;  1SET A;  2PGG A;  3JSL A;  2F93 B;  4FZ1 A;  3LNM B;  2PYJ A;  1WB8 A;  3CD6 V;  1WN7 A;  1SS3 A;  4LF8 O;  1S5L Z;  3W7U A;  3E22 B;  1OCO B;  1AR5 A;  4LF7 O;  3MHH C;  2AHZ A;  2AHY A;  2LW1 A;  3ZRV A;  1NH2 D;  2Q7H A;  4J7K A;  1XMQ B;  3OGI B;  3W7S A;  2P7T C;  1RSO B;  3SR2 C;  4JZG A;  4DK1 A;  4FJC C;  4JI2 O;  3RYC A;  4KFM A;  3T1C A;  2Q9L A;  1H8E G;  5B1B C;  1AI4 A;  3CEI A;  1S5J A;  2QM8 A;  3AG4 C;  2YXL A;  2QGN A;  4DR2 O;  1BT8 A;  3K03 A;  4O4H A;  1BCC H;  3ZJZ A;  4DV5 B;  1G1X B;  4ZKI A;  3L9D A;  1VIB A;  1JVM A;  3G71 V;  1XHZ A;  1B06 A;  3T1H B;  5KHI A;  1Q6U A;  3DC6 A;  1NS1 A;  1OCZ B;  3RYH B;  1KD1 W;  4U7N A;  4DUY B;  2XOK G;  3CXC U;  2UUC O;  5LGT A;  4JI1 O;  4QE9 A;  3E22 A;  2R72 A;  4K35 A;  3ASO B;  1DF5 A;  2ODM A;  2DW4 A;  1RSO A;  4XDL A;  2W0X A;  4RAI A;  1MZE A;  3FX7 A;  3SYQ A;  1QHT A;  2MW2 B;  2XAF A;  5EIB D;  4J9Y B;  2A7W A;  1XHX A;  3ZHT A;  1DLB A;  1COW G;  4DYL A;  4WBN A;  4YHH B;  2EX3 A;  5D5Q A;  2Q69 A;  5K1P A;  5JJN B;  2Z0A A;  1AI5 A;  1YZB A;  5JVD A;  4LFA B;  1HWY A;  4JYC A;  5LYJ B;  2DMX A;  2HR3 A;  2VS0 A;  2QTS A;  2CTR A;  2F4V O;  2RMK B;  3UM7 A;  3JD3 A;  1WP7 A;  1XNR O;  4DR6 O;  1AJN A;  2WSS G;  4R50 A;  3SGI A;  2CTP A;  1SQB H;  4MVZ A;  2X0L A;  2KG7 A;  2WLJ A;  4ZI7 B;  4AQY O;  3OMN B;  2A79 B;  1NVP D;  2D3O W;  4CH4 A;  3IAY A;  3ZHV A;  4JZ2 A;  4BAY A;  3ML0 A;  1AJP A;  2YIB D;  2FL4 A;  2VWJ A;  3I56 V;  3CCS V;  2OWO A;  5LHG A;  1H2K A;  1ZL8 B;  3SYA A;  3JAS B;  5H5N A;  3JAW B;  3STZ C;  4FFK A;  4PDL A;  4LF6 O;  4J41 A;  2OIE A;  1P7G A;  4J80 A;  5H6R A;  2L35 A;  3TCU A;  4ASU G;  1MA1 A;  1O9H A;  2UXX A;  4UXN A;  5CBG A;  3ZRS A;  4YJ3 B;  5IDJ A;  1VQK V;  2DYR C;  2ZT9 B;  4J10 A;  4EFE A;  3B77 A;  1SES A;  2HJD A;  4O2B A;  1FXH A;  4ZI7 A;  1YIJ V;  3CME V;  1W59 A;  3UT5 A;  4QPJ A;  1HR0 B;  2ATK C;  1PV0 A;  1Y66 A;  1SZX A;  1M5I A;  2ZXW B;  4RQF A;  4O4J B;  1ZL8 A;  3IGA C;  2YS8 A;  4DV6 O;  1XL6 A;  4CS4 A;  2YI9 A;  1F4M A;  2Z3Y A;  4PD4 F;  4FLU A;  1M4U A;  1MOF A;  2ARH A;  4TQD A;  3FD9 A;  4FVM A;  2ADP A;  4QIW F;  1W0K G;  4EB6 B;  1VQ9 V;  4JTA B;  4JYY A;  2DWD C;  2LJ2 A;  3K57 A;  4YY3 B;  3LDC A;  1AIL A;  4LF8 B;  4TSF G;  3JAL A;  3M99 B;  2FML A;  3RFR A;  1BQZ A;  3J7A U;  1PNM A;  2NR5 A;  3ASN B;  5CA0 A;  3CCM V;  4LF7 B;  4PA9 A;  2L6L A;  3U0Z A;  3CC4 V;  3ICX A;  1ZX3 A;  4JI2 B;  1OV9 A;  2PTM A;  5KHJ A;  2DWE C;  3TET A;  5LBQ A;  4FLW A;  2ZKO A;  3D36 A;  2EIL B;  1OCC B;  1G8M A;  5EBW C;  3FB8 C;  4DR2 B;  1SC5 B;  4RWU A;  3QNE A;  4PDM A;  2WLN A;  3ZX6 A;  3WB0 A;  1B6Q A;  2IW5 A;  1I94 O;  2ILM A;  4UCV A;  2Q73 A;  1SQV H;  1FFX A;  1EBO A;  5FLX N;  4B08 A;  3J81 N;  5DED A;  1H2G A;  2KSD A;  4CBC A;  1WA8 A;  2UUC B;  3R65 A;  4LR3 A;  4JI1 B;  1VQM V;  4QE7 A;  1N32 O;  4WCE V;  5GTI Z;  1PKX A;  1CPY A;  1VF6 A;  1UPG A;  2CUG A;  4DR1 B;  4CS3 A;  4BW9 A;  5EZY B;  1L0N H;  1U97 A;  2WLH A;  3LUT B;  3E2E A;  3BEH A;  4DW0 A;  3K06 A;  1EN6 A;  2EIJ C;  1FYJ A;  4OX9 O;  4ZOL B;  2DQ0 A;  1JOY A;  1YSC A;  3ABK B;  5LXT B;  3JAK A;  5KMG B;  3B40 A;  2YUA A;  1LR1 A;  4I9Q A;  2F4V B;  1XNR B;  4DR6 B;  3IFX A;  5CA1 A;  1KMI Z;  4NTY A;  4GX5 A;  4I55 B;  4W4L A;  1QQC A;  2XAQ A;  2M6Y A;  1VQ5 V;  1MNG A;  2JGD B;  4MTG A;  1N34 O;  1N33 O;  4AQY B;  4P30 A;  4LP8 A;  4NYK A;  1YJN V;  1RPO A;  1R3K C;  2OYQ A;  2YIA A;  3ZMT A;  4JI0 B;  2WLL A;  1FXK C;  2ZD9 A;  5EZY A;  1UFI A;  3KKY A;  4OXS A;  3LNN A;  3BHP A;  4JAU A;  4O4I B;  1M93 A;  1KQS U;  3LDD A;  3AK2 A;  1S0V A;  4B7K A;  1GM9 A;  1CXZ B;  1Q6I A;  2CAZ C;  2Y0I A;  2PYL A;  3OFN G;  4MTX A;  5IJ0 A;  4LF6 B;  2UXD O;  5KMG A;  2YEV A;  5IE9 A;  1Q90 D;  2QSA A;  4DV3 B;  2KB1 A;  4UB6 Z;  5B1O A;  4UCO A;  2D2C B;  3CRC A;  1S3J A;  4ABM A;  4I55 A;  3CC2 V;  1Z5V A;  5HFL A;  2ITC C;  2JGD A;  1RPR A;  1BL8 A;  4JI6 O;  2YID A;  3ABM B;  2KKW A;  1FD9 A;  1EZV H;  3U11 A;  4X20 B;  2Q7E A;  4IIJ B;  3CCE V;  4O4I A;  3ABT A;  4LC1 A;  3OUS A;  2QWP B;  3GWO A;  1V55 B;  2QWQ B;  4DV6 B;  1GH6 A;  3CRQ A;  5KLV H;  5J2T B;  4DV7 O;  1E79 G;  3BFR A;  5JQG A;  5IY5 B;  4O2A A;  4ZHQ B;  3ABU A;  4JAV A;  4X88 A;  3P30 A;  1U96 A;  1Y76 B;  1J5E B;  5EBM C;  3JD0 A;  1GN6 A;  2RNB A;  2E3C A;  4FMT A;  1GRJ A;  3ZMU A;  4X1I B;  5L3F A;  1TVK A;  1IXM A;  2EIK C;  3CCJ V;  3H9V A;  1XNQ O;  2F66 C;  3HKC B;  3E8B A;  2V7Q G;  5GW7 A;  3ZMS A;  3WG7 B;  1V54 B;  4IIJ A;  1GM8 A;  1QVG U;  2B9Z A;  4NTW A;  4JI4 O;  2QWR B;  3OTO O;  4HAM A;  3CCU V;  5LA6 B;  4YJ2 B;  3SJB C;  3K9A A;  4X62 B;  1OCO C;  4JYA O;  3SPG A;  4B7E A;  2QM7 A;  3D8C A;  1NH2 B;  5JCO A;  1I94 B;  1Y67 A;  1Y76 A;  5C8Y B;  1H8H G;  4I4T A;  3AK1 A;  5FNV A;  4D7T A;  3JSN A;  4X1I A;  1TAE A;  1QR8 A;  2ZQM A;  2LGW A;  1KYO F;  4BIU A;  4IHJ A;  1VQ8 V;  1N32 B;  3NR7 A;  3FB6 C;  1K9M W;  1IBK O;  4FLT A;  3M7M X;  1ENV A;  3T4Z A;  5A9G A;  2XAH A;  3G6B A;  3TK1 A;  4NB5 A;  4DR4 O;  1VF5 B;  1WNS A;  2CGO A;  5L3C A;  1KU9 A;  2YXH A;  4JTD B;  1JJO A;  4H44 B;  1LUV A;  1X4T A;  4UFZ A;  4W4K A;  2Q8V A;  4IT5 A;  5CB4 B;  1NTM H;  4OPH A;  1DF4 A;  2H94 A;  3ASO C;  3FAV A;  2E5L B;  4N23 A;  2QJ1 A;  3W7T A;  1A32 A;  5C8Y A;  5IYZ B;  3OTF A;  5CA3 A;  4LF9 O;  2N74 A;  1N33 B;  1K3E A;  3CC7 V;  5JH7 A;  1VMG A;  2VQF O;  1GO3 F;  2WLM A;  4IYH A;  1ZLZ A;  3FYE B;  3AG1 B;  1JA8 A;  4FM2 A;  2OT5 A;  3SJC C;  4EEQ A;  1XI1 A;  2OTJ V;  3F5T A;  4GX2 A;  2DYS B;  2IBZ H;  2JVD A;  1M90 W;  3SPC A;  1WLE A;  4K3A A;  1Q6H A;  2IJH A;  1NVP B;  4NXN O;  3RYC B;  4PI2 A;  4U3J B;  1XMO O;  5EYP A;  4IL6 Z;  2DN9 A;  2HHH B;  3HKD B;  5IYZ A;  2LQT A;  2R9I A;  4PDV A;  1PNL A;  2RQ6 A;  4K0K O;  4DUZ O;  4QJF B;  4JI6 B;  1GAX A;  3B4S A;  1XBL A;  4CZZ A;  1N4C A;  1SQP H;  1R6K A;  3DGE A;  1D2D A;  3CCR V;  1SQF A;  2NNU A;  4XDJ A;  4EFB A;  1VEW A;  1SQQ H;  4H33 A;  1JR9 A;  1RM1 B;  3A0H Z;  5B1A C;  4X66 O;  2P6J A;  3QTC A;  4WFA V;  3SPJ A;  5LP6 A;  4WFG A;  3STL C;  3CPW U;  3C3S A;  2CK3 G;  1PP9 H;  3EXA A;  3K04 A;  2XAG A;  4WFH A;  3H01 A;  4U3J A;  3HB3 B;  1P84 F;  3FKS G;  2X7R B;  2YIB A;  2ZXW C;  3W7X A;  4WBN B;  3HKD A;  4MVO A;  4KHP O;  2B1I A;  4UCU A;  2HP8 A;  5EC2 C;  3RT3 C;  5HFM A;  5JVD B;  3DC5 A;  5F2V O;  1FXV A;  4DV1 O;  4F4L A;  2EJ7 A;  1XNQ B;  3JCZ A;  2V4D A;  3TXS A;  4OPA A;  2CGN A;  2KG7 B;  2OIG A;  1P7B A;  2LO1 A;  1FPO A;  3IJ4 A;  1EN4 A;  4JI4 B;  3ETD A;  1HP8 A;  2E76 B;  3S3X A;  3MD0 A;  2JIZ G;  4DR5 O;  4JYA B;  1XIL A;  2N05 A;  3SYO A;  1ARO P;  1ZSP A;  2N04 A;  1VF6 C;  2BOB C;  1M57 C;  1YVW A;  2RDC A;  4DK0 A;  3ETG A;  1V9P A;  3X2Q B;  3NXS A;  1DK1 A;  1SA0 A;  4BR6 A;  3KG2 A;  3L70 H;  1KEC A;  2EIL C;  2LP7 A;  1K7D A;  2YI8 A;  3C90 A;  3ZN1 A;  1AB3 A;  1H2L A;  2UXN A;  1K97 A;  4FM0 A;  2FTK A;  1N0J A;  2ZDI C;  3TXQ A;  1VQ4 V;  1URF A;  1IBK B;  2X6B A;  1LNQ A;  4O2B B;  5CMU A;  1KKC A;  3KCY A;  5EK0 A;  1R3L C;  2QWO B;  1T5E A;  2R70 A;  3UT5 B;  4DR4 B;  1YTF D;  4JYB A;  4JI5 B;  3K08 A;  1NT2 B;  1SRY A;  4UCR A;  4GZR B;  3L73 H;  3E8F A;  3LSQ A;  3HKE B;  3P32 A;  4U7O A;  4LF5 B;  2Y69 B;  1PL0 A;  1NBM G;  1AVM A;  4LF9 B;  4QGP A;  4J11 A;  5TIS Z;  1JQ0 A;  4G2K A;  4DV0 O;  3ABK C;  2Q6A A;  1NR7 A;  1LUW A;  2VQF B;  3E8H A;  5LMU O;  4MVM A;  3K59 A;  1YJW V;  1YCI A;  2MK3 A;  3JAL B;  3K79 A;  4TT3 G;  1VP7 A;  3UO3 A;  4F6R B;  1HNW B;  1VQL V;  1THZ A;  5CA0 B;  4X89 A;  4Z1M G;  4LF4 O;  5KX5 A;  2AW9 A;  3GWK C;  5C93 A;  2IU3 A;  4DV2 B;  1L8D A;  4NXN B;  2YDE A;  4G28 B;  3HKE A;  3ZN0 A;  1IBL O;  1Q7Y W;  4MSW C;  3C3T A;  3WB1 A;  1XMO B;  3UKM A;  4BW5 A;  4JI3 O;  3BA8 A;  3B09 A;  3OEH G;  4Z2W A;  1RFY A;  4DUZ B;  4P9P A;  3AG4 B;  2W6I G;  4UVB A;  3SPH A;  1H2S B;  5B3S B;  1VQP V;  2Y48 A;  3CS5 A;  3QVN A;  1FFX B;  3N27 A;  1OZ0 A;  4ZIB A;  1EZJ A;  1WA8 B;  4F6R A;  2V1D A;  4AIL C;  2QEX V;  3AG2 B;  4X66 B;  2AZ2 A;  2P4V A;  3WFV A;  1MMM A;  5CN0 A;  2IM9 A;  1R3I C;  4KP4 A;  1E1R G;  3QO8 A;  2HG5 C;  2A3Q A;  5JJE B;  3T1Y O;  1SER A;  4DR3 O;  4JI8 O;  1JNB A;  1F51 A;  2GSM B;  2E74 B;  3F7Y C;  1VQN V;  1M1K W;  2IJK A;  3A0B Z;  3K3W A;  1IBM O;  2K9P A;  4TWK A;  5LMN O;  1NI8 A;  3VQY A;  1V55 C;  1KKD A;  3JAK B;  4YIO A;  4WFB V;  3OUF A;  4KL1 A;  2XAS A;  1GMG A;  1Y74 B;  2Q67 A;  2EUL A;  4LH7 A;  2F23 A;  3DXR B;  2GV9 A;  4RQE A;  5IY5 C;  3VOU A;  1JCH A;  4DV1 B;  3CCL V;  1MSD A;  1JJ2 U;  5CA1 B;  5LGU A;  3BAB A;  5LGN A;  2LFR A;  4B3T O;  1FKA O;  5FPO A;  2ZIN A;  4JF3 A;  5DN6 G;  4B3S O;  2F95 B;  3VQV A;  4LNU B;  2WLL B;  4DR5 B;  3CCV V;  1QCE A;  3DTU B;  3H1K H;  3JAT B;  3CHX A;  3ZS8 C;  4X65 O;  2JJ2 G;  3H1H H;  3WG7 C;  1V54 C;  1NR1 A;  3OR6 C;  2EZP A;  5IJ0 B;  2JGU A;  4PV1 B;  4A5U B;  2BTQ A;  2YEV B;  1Y74 A;  3K0D A;  3DXR A;  5FL7 G;  2P4K A;  5L3G A;  2JRI A;  5GON A;  5K1X A;  2EIN B;  4YXW G;  3UCS C;  1M9N A;  3JAR B;  1OJH A;  4FPP A;  4LNU A;  2XUM A;  1BQ0 A;  3JAT A;  4JAA A;  3BPZ A;  4FZ0 A;  3G80 A;  3Q4H A;  1J95 A;  4BIO A;  2QA4 V;  5JQG B;  4O2A B;  4FLV A;  3OM3 B;  4DV4 O;  2K1E A;  5EBL C;  4X64 O;  1TUB A;  1IZ3 A;  4DV0 B;  4FIP C;  4PA3 A;  1AI6 A;  4LFB O;  5LMU B;  2QKA A;  1FAF A;  3S3W A;  2CDY A;  3H1L H;  1YIT V;  4B3R O;  1XOU A;  2WWW A;  2C2A A;  1TVK B;  1K73 W;  2AZ0 A;  5LHI A;  3ZIA G;  4LF4 B;  5EIB C;  3K0G A;  3JAR A;  1AR1 B;  3U10 A;  4WF9 V;  5IT9 N;  3B8N A;  1IDS A;  4IGG A;  3ZRW A;  1IBL B;  3HPL C;  1P49 A;  3AG1 C;  1R1B A;  3LSS A;  4GLX A;  4JI3 B;  1MSW D;  4LWS A;  4CC6 A;  1BHB A;  4HBN A;  2Y4T A;  5FPR A;  2DYS C;  3OMA B;  4GT1 A;  3RN4 A;  4UVA A;  2PY5 A;  2UU9 O;  2ZR2 A;  5LOV A;  1IJG A;  1NTK H;  2BSK B;  3AG3 B;  4I4T B;  5FNV B;  2BCC H;  3BA9 A;  3K5O A;  1Q5O A;  1YHQ V;  4IHJ B;  2Q68 A;  2QDO A;  1M56 C;  3SJA C;  2UXC O;  4YIP A;  1KP2 A;  5H2F Z;  3T1Y B;  2RCV A;  2QTO A;  4DR3 B;  1PL4 A;  4JI8 B;  1IVS A;  1S72 V;  1Y6X A;  4O4L A;  1R6N A;  4L87 A;  1IBM B;  3WU2 Z;  5H6Q A;  2RN9 A;  2EJR A;  5LMN B;  3OEE G;  1RM1 C;  1H5W A;  2JS5 A;  3T1H O;  5CBF A;  3FAV B;  2Z5U A;  1MG1 A;  4LH6 A;  2BSK A;  1D5A A;  1L0L H;  4GKJ O;  4BWA A;  4I9W A;  2VQE O;  2YC0 A;  4B3T B;  1QLE B;  2ZIO A;  2WA4 A;  4X1Y A;  5JH7 B;  2GTA A;  1EM1 A;  3L71 H;  3RW0 A;  3P3N A;  1BZK A;  4B3S B;  4TUY A;  3CXH F;  3EHB B;  3G67 A;  5KAI Z;  1JMK C;  2PUS A;  1QVF U;  1OCZ C;  4OX9 B;  3ZHS A;  4CH5 A;  4LBE C;  1FXK B;  2YSU B;  4GX0 A;  3JAM N;  5A2Q N;  2ZE7 A;  4HNA B;  1BGY H;  5ITZ A;  5LL6 Y;  2ZR3 A;  2PZS A;  3FYI B;  3MHS C;  1Z5W A;  2P22 C;  1B04 A;  4UV9 A;  4D7S A;  1XQ8 A;  3VQW A;  3RYF B;  1MAB G;  5KA5 A;  2GHY A;  5EYP B;  3RWR D;  3ABL B;  4L8J A;  4QNH B;  2NLJ C;  1F7Y A;  4H13 B;  1HNZ O;  1N34 B;  2UXB O;  2PF4 E;  1CEZ A;  1GKF A;  3X2Q C;  2ZE5 A;  2WLI A;  2ZCE A;  3RVY A;  4R8C A;  5JJJ B;  3OMI B;  2CTW A;  1TGO A;  2B5U A;  2XTA A;  2FB5 A;  5E1A C;  2AGA A;  2P90 A;  5KUM A;  2JK5 C;  2B1G A;  2ZNJ A;  3RYI A;  3K5M A;  1N36 O;  3CRR A;  4NXM O;  3HKB B;  1FXK A;  5LP6 B;  1WAZ A;  1WJZ A;  4DV4 B;  1K4D C;  1SQG A;  4HNA A;  2UXD B;  4EKW A;  1YI2 V;  1YTF B;  4NTX A;  1ZAU A;  5L3E A;  3ZMZ A;  4LFB B;  1SF9 A;  3RYF A;  2GUZ A;  5EC1 C;  2WA3 A;  3MDS A;  1BSM A;  4B3R B;  4RO2 A;  1HR0 O;  1YXB A;  1Q86 W;  4XDK A;  4UVC A;  1US6 A;  1TA8 A;  4FFB A;  3BCC H;  2OCC B;  1E1Q G;  2UUA O;  2KQX A;  1G4Y B;  2BOC C;  3L72 H;  3J80 N;  2JEX A;  3I55 V;  3CSX A;  4PI0 A;  4DV7 B;  4U3F H;  3HKB A;  4GKK O;  2YXY A;  4AI8 A;  3H1J H;  1GN2 A;  4YY3 O;  3ZHQ A;  4R6Z A;  4DRX A;  2P67 A;  2WLK A;  2Y0P A;  4FLX A;  3F5W C;  5J2U A;  2IH1 C;  2UU9 B;  1CP9 A;  4MTO A;  1Q82 W;  1R73 A;  1SA0 B;  3IC9 A;  5KA6 A;  2EIM B;  3SYC A;  2ZNI A;  3ZRX A;  2DOS A;  2G38 A;  3D36 C;  1IUR A;  4I0X B;  1Q43 A;  3D3I A;  3OT7 A;  5BY1 A;  3E89 A;  4H0L B;  1BE3 H;  3SJQ C;  2UXC B;  2H8P C;  1I5X A;  1AJQ A;  1K5Q A;  1KP3 A;  2JEU A;  4NR1 A;  1JPX A;  4MW3 A;  3GVM A;  4MVU A;  1I5Y A;  2EBO A;  5B3S C;  4UUJ C;  5DEC A;  2P06 A;  1PPJ H;  2AXT Z;  4E4E A;  3OTO B;  4TV8 B;  3W7W A;  3B8M A;  3AG2 C;  3ZBH A;  3ASN C;  2R9R B;  1N0N A;  3OW2 U;  5IWA O;  1BHA A;  5L3B A;  3JCU Z;  2GBO A;  3WB2 A;  3ZMV A;  1B3Q A;  4GKJ B;  4JI7 O;  2VQE B;  3O65 A;  1AP6 A;  4GYC B;  4DR1 O;  1OCC C;  4I0X A;  2A06 H;  5IYC O;  1KUQ A;  1RP3 B;  1JFF B;  1P4R A;  1I7F A;  1UJW B;  3QG5 A;  4FK5 C;  1KBH A;  3K58 A;  1EN5 A;  4H37 A;  1KC8 W;  2VRZ A;  2IH3 C;  1K92 A;  1Z2G A;  4JPR A;  5KX5 B;  1ORQ C;  4TV8 A;  2QKC A;  1NJI W;  4TQF A;  3RVZ A;  4GCZ A;  4K8X A;  3E86 A;  5AG2 A;  3JD2 A;  3RYH A;  3K9S A;  4CS2 A;  1PD3 A;  4DW1 A;  2DQ3 A;  1D5N A;  4X1K B;  5IYB O;  1HNZ B;  3APO A;  4JI0 O;  2UXB B;  3DSQ A;  4PA4 A;  1Q81 W;  2XND G;  4G27 B;  2WAM A;  1OCR B;  1JFF A;  3CJH B;  3AG7 A;  3OGC C;  3L75 H;  1S76 D;  1SKV A;  2Q5Z A;  3AEI A;  1IX9 A;  3CX5 F;  3KZI Z;  5BXZ A;  3A8T A;  3CRA A;  1N36 B;  4NXM B;  2EIN C;  5LYJ A;  4PHZ A;  5KHK A;  4DV3 O;  1I08 A;  2BE3 A;  4OGQ B;  4UCT A;  5B1A B;  3KDR A;  3LSU A;  3TGU H;  3ETE A;  3K5N A;  2HVJ C;  1AR4 A;  4P9O A;  1WB7 A;  4UV8 A;  4X1K A;  2WPD G;  4K0K B;  1BMF G;  5B1B B;  4D6T H;  2X6C A;  4MW8 A;  3MAQ A;  2JDI G;  2CTQ A;  4J9Z B;  2UUA B;  3JAS A;  3JAW A;  2NN4 A;  3CJH A;  1SZT A;  4N21 A;  1WP8 A;  3OD4 A;  5H9C A;  3F7V C;  2UUB O;  4PA7 A;  2Q7G A;  4GKK B;  1HW7 A;  3OE7 G;  3A0R A;  3B2E E;  1F4N A;  4PJ0 Z;  3ABM C;  1J5E O;  3SDL A;  4YJ3 A;  2ZIM A;  5JWP A;  3UQ8 A;  5J9P C;  5DM6 V;  4AHC A;  3G4S V;  5LHH A;  3TJT A;  4KHP B;  3GB7 C;  2BTQ B;  2Y4U A;  3ZHU A;  1VF7 A;  4PDR A;  1M57 B;  2HVK C;  1GN4 A;  1HNX O;  3BAA A;  4JTC B;  2XT9 A;  4O4J A;  4HYO A;  5BZB A;  2XAJ A;  5KHH A;  5GON B;  3FB7 C;  2PI5 A;  3E8G A;  3SYP A;  5JCO C;  4J42 A;  2GTS A;  3E83 A;  5KAF Z;  2JS3 A;  4X62 O;  2O57 A;  2ZM6 O;  3AG3 C;  4EB6 A;  2M7W A;  1Q8I A;  1TUE B;  2A0L A;  3T4D A;  3OAA G;  1VQ6 V;  5IWA B;  4JV5 O;  2IJI A;  1N8R W;  1PNK A;  1VQ7 V;  4GUN A;  3Q4H B;  4MTF A;  4QPK A;  4KUM A;  1R3J C;  4WFF A;  4JI7 B;  2H3O A;  5GTH Z;  1TUB B;  3LDE A;  1FFT B;  2LFS A;  4J7J A;  1QNM A;  4ICG A;  4WFE A;  3QO5 A;  2RJZ A;  4GX1 A;  1FOU A;  1YDX A;  1JX9 A;  5B66 Z;  1ROP A;  2HFE C;  2FYU H;  2ZDI A;  1F23 A;  1GM7 A;  4R7C A;  2DYR B;  4LCU C;  1FJG O;  1FS0 G;  1QLE C;  2E5L O;  2IU0 A;  2F43 G;  4ZBM A;  1WPX A;  3P3P A;  1R6T A;  2EZO A;  1YF2 A;  3ZRW B;  3CP1 A;  1G6U A;  4Z1V A;  3ZED A;  4MVQ A;  1GN3 A;  3PN1 A;  1ZTE A;  3AK3 A;  3EFF K;  4RUE A;  4LWS B;  3IC7 A;  2XHB A;  2PI4 A;  3KCX A;  4LFC O;  4CH3 A;  4NKG B;  2IJJ A;  3BRC A;  3OR7 C;  4IYI A;  5LOV B;  4DR7 O;  3QO7 A;  1MZF A;  1NU1 H;  3CRM A;  4ZOL A;  1NKD A;  1YJ9 V;  5D5P A;  1WPB A;  1K5S A;  5LXT A;  1VQO V;  3EVK A;  1X59 A;  3ABL C;  4UB8 Z;  3R66 A;  2LW7 A;  1AP5 A;  3A2F A;  3ZCC A;  3BVO A;  1XRE A;  5L3D A;  2DJV A;  3ETQ A;  3M8A A;  2HHH O;  5BR8 O;  4I5S A;  4DO2 A;  2BTO A;  2QKS A;  5B5E Z;  4C7U A;  1QBZ A;  4B3M O;  4O4L B;  1GTO A;  3HR0 A;  4MVR A;  5KHG A;  2ETN A;  3CWB H;  4MT8 A;  4MS2 A;  4I50 B;  5KUK A;  5BMV B;  2A9H A;  5CBH A;  1Q3E A;  5LP6 C;  5IJ9 B;  1HDJ A;  3T2M A;  2E75 B;  4TV9 B;  2OTL V;  3E35 A;  3FFQ A;  3PJS K;  3RBZ A;  4TOI A;  1I0H A;  4X1Y B;  4RUF A;  1XMQ O;  2UUB B;  4XBF A;  4PEL A;  1BS3 A;  2QM4 A;  2Q0O C;  1L1F A;  1XEQ A;  3JD4 A;  4TUY B;  4JAS A;  3CMA V;  2OCC C;  1H2N A;  4DV5 O;  2OCH A;  1S77 D;  4CH6 A;  3QF7 A;  2FKX A;  4FM1 A;  1QR9 A;  2ADQ B;  5ITZ B;  4I50 A;  1IXB A;  2EIJ B;  5BMV A;  3RGB A;  4X20 A;  5IJ9 A;  2W0F C;  4KXR A;  1HNX B;  3CE2 A;  3D3Q A;  4DUY O;  4TV9 A;  1NQT A;  1OHH G;  5J2T A;  3CCQ V;  1QLN A;  2JJ1 G;  2HJF C;  2QWN B;  4BIZ A;  4ZHQ A;  1S5H C;  4FLY A;  2GDS A;  3THO A;  2EIM C;  1EFR G;  2DE0 X;  2WLI B;  2ZM6 B;  4FLZ A;  2CH7 B;  2YIC A;  1ZUQ A;  4YHH O;  3N2K B;  3O9O A;  1PM9 A;  2ITD C;  4JV5 B;  3JD1 A;  1K4C C;  4X65 B;  2R9A A;  3N2G B;  3RYI B;  2W6J G;  2P5O A;  4LFA O;  3VQX A;  1ZWI C;  4MVS A;  1KB9 F;  4E2L A;  1NZ6 A;  4DXW A;  2CE4 A;  3HKC A;  4Q6G A;  2ZE6 A;  4J7Z A;  3FB5 C;  5IYD O;  2GUZ B;  3ZHR A;  1NTZ H;  1DGS A;  3H1I H;  2Q4P A;  4JI5 O;  1VAR A;  1Y4M A;  5LA6 A;  4YJ2 A;  3APQ A;  4FFB B;  3I5D A;  2F1M A;  1FJG B;  4P2Z A;  2CH7 A;  4NVP A;  3CB2 A;  1O9G A;  4LF5 O;  4I7Z B;  1GK9 A;  1K34 A;  1XL4 A;  3N2K A;  3SPI A;  1YEW A;  2LGQ A;  3N2G A;  1SQX H;  2ZE8 A;  4HZ3 A;  1H2M A;  4PA6 A;  1K8A W;  3K5L A;  3G6E V;  4X9Q A;  4X64 B;  4K8Z A;  1W0J G;  4DRX B;  4LFC B;  3VBB A;  1XDC A;  5J2U B;  2X6A A;  4DR7 B;  1QU7 A;  1HNW O;  2QR4 A;  4F6E A;  1AI7 A;  2Y69 C;  4CC5 A;  4DV2 O;  5CB4 A;  4JGS A;  4X8A A;  2HKO A;  2QE7 G;  3CYO A;  4Q20 A;  3UO2 A; 
#chains in the Genus database with same CATH homology
 1D5N A;  1GN4 A;  2GDS A;  2AW9 A;  4JYY A;  1ZLZ A;  1MNG A;  1EN4 A;  1JA8 A;  3IC9 A;  3EVK A;  1XUQ A;  1ZUQ A;  3C3T A;  3RN4 A;  1AP5 A;  1XIL A;  1XRE A;  1ZSP A;  1PM9 A;  3KKY A;  3OT7 A;  1WB8 A;  2P4K A;  1IX9 A;  4C7U A;  4JZ2 A;  4BR6 A;  3AK2 A;  2CE4 A;  1I08 A;  4GUN A;  1AR5 A;  3QVN A;  4E4E A;  3KDR A;  3LSU A;  1Y67 A;  4YIP A;  2RCV A;  1N0J A;  1PL4 A;  1AR4 A;  1VAR A;  1N0N A;  4JZG A;  3AK1 A;  1WB7 A;  4FFK A;  1KKC A;  3CEI A;  1MMM A;  1QNM A;  1I0H A;  1P7G A;  1VEW A;  1BT8 A;  1JR9 A;  1MA1 A;  1AP6 A;  1BS3 A;  3MDS A;  5A9G A;  1BSM A;  1B06 A;  3C3S A;  3DC6 A;  4YIO A;  1LUV A;  1EN5 A;  2QKA A;  1AVM A;  4X9Q A;  2CDY A;  3BFR A;  1EM1 A;  1EN6 A;  2ADQ B;  1MSD A;  1XDC A;  1SZX A;  1IXB A;  1GN3 A;  1ZTE A;  2QKC A;  1LUW A;  3AK3 A;  3DC5 A;  5AG2 A;  4F6E A;  3K9S A;  1GN2 A;  3TJT A;  1IDS A;  1GN6 A;  2ADP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...