1LUVA

Catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
publication title Catalytic and structural effects of amino acid substitution at histidine 30 in human manganese superoxide dismutase: insertion of valine C gamma into the substrate access channel
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1luvA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1luvA02
4GUNA 1WB8A 1BS3A 1MMMA 1LUWA 2QKAA 2QKCA 1QNMA 2CDYA 1N0NA 1BT8A 3RN4A 1LUVA 1JR9A 1I0HA 1IDSA 5A9GA 1PL4A 3K9SA 1VEWA 3MDSA 3DC6A 1AR4A 1MA1A 1P7GA 1AVMA 3KKYA 1Y67A 4X9QA 1XREA 1ZTEA 1GN6A 1MSDA 1GN3A 3DC5A 1IXBA 3AK1A 1KKCA 1ZUQA 5AG2A 1XDCA 2P4KA 1VARA 2RCVA 3BFRA 1EN6A 4F6EA 3LSUA 3TJTA 1B06A 1WB7A 3C3SA 1EN5A 3AK2A 1AR5A 2CE4A 1PM9A 1AP6A 1SZXA 1MNGA 1GN2A 1BSMA 2GDSA 1JA8A 2AW9A 1ZSPA 1EM1A 4JZ2A 4YIPA 1AP5A 1GN4A 1ZLZA 1N0JA 3C3TA 4FFKA 4BR6A 1I08A 2ADPA 1D5NA 4JYYA 3EVKA 3CEIA 3QVNA 1XUQA 3IC9A 1EN4A 3AK3A 1IX9A 1XILA 4E4EA 3OT7A 4C7UA 2ADQB 4JZGA 4YIOA
chains in the Genus database with same CATH superfamily
4WFAV 3JAMN 2H8PC 4X65O 1KB9F 1K5SA 1WNSA 1BCCH 2NN4A 3QO8A 5B1AB 4UV8A 4ZBMA 1NTMH 2XTAA 3BVOA 2XNDG 4FVMA 2UUBB 1F4NA 2QWRB 4X1KB 5KLVH 3RGBA 2GUZA 1JR9A 1IBLO 1Z2GA 3T4ZA 2E3CA 1Y74A 3T1HB 4NTWA 1FPOA 1GK9A 4IYHA 3JSNA 5LXTB 3L72H 2JEUA 5C8YA 5B3SC 4LF7O 4E2LA 3OEEG 3ZN1A 1WJZA 4NXMB 3RYFB 1VARA 1HW7A 5KHIA 1OCOB 1V55B 2HP8A 1GKFA 2LGQA 4F6EA 1SQQH 4WFFA 5FPRA 1Q81W 1ORQC 3UQ8A 4TOIA 1QLEB 4DV5O 4I0XB 5JH7A 3W7TA 5JQGA 1XNQO 5J2UA 1YCIA 2Q69A 1H2NA 2W6IG 1Q3EA 1OCZC 1VMGA 1XMQO 2OYQA 1FS0G 4LF6O 1N32O 1E79G 2EZPA 3CMEV 4I5SA 3T1YB 2Q7HA 1LR1A 1Q5OA 4DV1O 4MVMA 1N33B 4YJ3A 2X6BA 3ZBHA 4ZHQA 1FXVA 4UVCA 4X20A 3SR2C 3OFNG 3JASB 5BXZA 4LCUC 4DRXB 1S3JA 5CB4A 4NXNO 2XASA 1B04A 4HZ3A 3KZIZ 3DXRA 3AG3C 4JI8B 4D7TA 1SERA 2JIZG 3CCLV 3KDRA 1URFA 1DGSA 1YJWV 3OMNB 3APOA 3N2GA 4JI5B 1M1KW 3W7XA 4WFEA 2QA4V 2CDYA 1M4UA 1DK1A 1LUVA 2GV9A 1K8AW 1IDSA 4J9YB 2WLHA 2Q4PA 2YSUB 3RYHA 1I5XA 2RQ6A 4X1IA 1Y67A 4QE7A 3WB2A 1OCRB 1JOYA 3D36C 2YEVA 3FB6C 3B09A 3H1KH 1SF9A 1P4RA 1HP8A 2FB5A 1IBMB 3OTFA 4UB8Z 1JNBA 4JI4O 4OXSA 3K58A 1P7BA 4JV5O 1E1RG 2HHHB 1R3LC 4DV3O 2V1DA 4YJ2A 5IJ9A 3P3PA 2Y48A 3K3WA 4I50A 1VQ5V 1FJGB 1GN2A 1BSMA 1WP7A 3TK1A 3SYCA 5TISZ 2AW9A 1ZSPA 1K7DA 4IYIA 3B8NA 4O2BB 5J2UB 2JJ1G 1HNWO 4FLZA 4X89A 4X64O 1F51A 4B3TB 1X59A 4G28B 5IYZA 4PI0A 2R9IA 4LF8B 1OCCC 4DR4B 4NTYA 2BSKA 3IC9A 4JTAB 1EN4A 4MTXA 4YJ3B 1NKDA 2HJFC 4ZHQB 3E8BA 2OIEA 4C7UA 4FLYA 5HFMA 3ZHSA 1XNRO 4JTDB 2BOBC 4JZGA 5KX5A 2LQTA 3VQVA 5CB4B 1IZ3A 3QF7A 1WB8A 3DXRB 3UCSC 1XMOB 1Q90D 1NTKH 4LH7A 3F5WC 3Q4HA 3RYCB 4NVPA 3OTOB 1FXKC 5GTIZ 2D3OW 1GM9A 2NR5A 3HB3B 2ZE7A 4CS3A 1NS1A 2KSDA 4X8AA 2DQ3A 3K06A 3N2GB 4JF3A 3A0HZ 2IU3A 3B40A 4G27B 1HDJA 1N34O 1I7FA 1FXHA 4LFCO 2ZINA 3CJHA 1PL4A 2PZSA 4LFAO 1FKAO 2A79B 1I94B 4O4LB 1NTZH 2QTSA 4KL1A 2EINC 3C90A 3RYHB 1IBKO 3J81N 2F95B 4KP4A 4A5UB 2KG7A 1US6A 4RUFA 1L1FA 4TV9A 3CRRA 3RVZA 3UM7A 3BFRA 3RFRA 4JI2B 1JJ2U 4DV0B 1EBOA 1CXZB 3TJTA 3TCUA 1O9HA 2IW5A 2WWWA 1AR5A 4LH6A 2CAZC 2CE4A 4O4JA 4NYKA 4O4HA 4YJ2B 2YIBA 5IJ9B 4MVZA 1H2MA 5LYJA 2Z0AA 1DLBA 1EFRG 2K1EA 1YI2V 2DJVA 2AXTZ 4DR6B 2ZD9A 1XI1A 5LP6A 3BA8A 4RO2A 4G2KA 2ZDIA 4ICGA 3LDEA 1I5YA 1ZX3A 1F7YA 3F7YC 4Z2WA 2X6CA 3UKMA 1D2DA 3CSXA 2YIDA 2BSKB 3SYOA 4E4EA 2N05A 1G8MA 1M9NA 3H01A 5IE9A 4CC6A 1Y76A 4NB5A 1FFXA 1COWG 3AEIA 4FMTA 1NVPD 2ZDIC 4DR7O 4UB6Z 2QKAA 3L9DA 4GX0A 1BE3H 1MZFA 1PNMA 3Q4HB 1B3QA 3H1JH 3O65A 2YDEA 1ZWIC 2A3QA 2QKSA 3W7UA 2P67A 1YZBA 2IH3C 2WAMA 1I0HA 5A9GA 3DC6A 3VQXA 5LBQA 4GZRB 2L6LA 2VWJA 4LF5O 2CTWA 3SPHA 3O9OA 3CJHB 2CK3G 2WLNA 4X65B 1YDXA 2LGWA 1JFFB 5GONB 1Q6IA 1Y66A 2ZNJA 1N36O 2KG7B 4B08A 2WPDG 2PUSA 2ARHA 4K0KO 1S76D 4I9QA 2ZKOA 4CZZA 1VQMV 1IBLB 1K4DC 2F1MA 3ZS8C 4LWSA 3WFVA 3B4SA 3E8GA 1IVSA 4O4JB 2QDOA 4GKJB 1XEQA 2JDIG 1GN4A 2CTRA 1XOUA 3RBZA 5LYJB 2EX3A 3C3TA 3SPIA 1YTFD 4CH3A 1YJNV 3CXHF 3CP1A 5IY5B 4DR5O 1M57C 5LP6B 5A2QN 2PTMA 2E74B 5HFLA 1SC5B 1LNQA 3CCRV 3T2MA 1XNQB 3G4SV 4MVUA 1Q8IA 2ZE5A 3LSSA 1XMQB 4LF6B 1AROP 2JJ2G 2F66C 4N21A 1Y76B 4JI7O 5B66Z 2O57A 5L3EA 1Y6XA 3H1IH 2QGNA 2ZR2A 3CC4V 5C93A 4YY3O 1V9PA 2M6YA 2OIGA 4MS2A 1BL8A 2QM8A 2OCHA 3CCQV 3ZN0A 1J5EB 1P7GA 4NXNB 2YIBD 4W4KA 1HR0O 2RJZA 3HKDA 1EZJA 1QQCA 3E8HA 4LF9O 4X1KA 1JVMA 4BIUA 1H2SB 2VQEO 5EYPA 4EFBA 2P4KA 4KHPO 2DOSA 4PELA 4JI1O 3WB1A 4B3RB 3KCYA 2GSMB 3LSUA 1SQXH 3LDDA 2EIJB 2FMLA 2PF4E 3MHHC 3P30A 2IJJA 2MW2B 3A8TA 1H2GA 5B1AC 5CA3A 2ZQMA 3L75H 4YIPA 4BAYA 1VIBA 4LBEC 2IU0A 4W4LA 4F6RA 3BHPA 2Q8VA 5BR8O 2QE7G 3VQYA 3VQWA 1F4MA 1GRJA 2UXBB 4IGGA 4AILC 4JI4B 3LNNA 4BR6A 3IAYA 3ETDA 2QWNB 3G67A 2QWQB 4DV3B 1YHQV 4UXNA 3FAVA 4P9PA 1NT2B 3BPZA 2DWEC 3UT5A 2JVDA 1NU1H 3G71V 1K97A 2Y4UA 1XILA 4JASA 2N04A 1U96A 1MABG 1OCOC 1SQGA 1V55C 5LGNA 4MW3A 2OCCB 3SYQA 3FYEB 4LR3A 3GB7C 3ZHTA 1KP3A 2NNUA 1LUWA 4UCOA 4PA7A 1QLEC 3K79A 3JASA 1YIJV 4DRXA 5F2VO 2AHZA 1M93A 3SDLA 1O9GA 3D3QA 1K34A 1R6KA 2Q6AA 3B77A 2QM4A 1KYOF 4GX2A 2UUAB 4LFBO 3K0DA 4GKKB 4X66O 3AG2B 2F23A 4DV4O 1MSDA 4TSFG 1SS3A 1S77D 3RVYA 1MOFA 3GWOA 1Q7YW 3HKDB 1FFTB 3CX5F 4FLVA 1YF2A 4MVOA 5GW7A 1QBZA 3HKEB 5EYPB 1DF4A 1BQZA 2IJKA 4B3SB 2XAQA 3C3SA 4DV7B 4CH6A 2Q7GA 4LFAB 1N8RW 3ML0A 5EZYB 3R66A 4J11A 1QVFU 1NQTA 3K9AA 1IBKB 4JI0B 2IJIA 1R73A 5DECA 4F6RB 1TA8A 1R6TA 1FAFA 4JYCA 4BWAA 4KUMA 3T1CA 2YI9A 2XAJA 1OCRC 1M56B 1BHAA 2IBZH 1SQFA 3RYIB 3QVNA 1XUQA 4LNUA 4O2BA 2EILB 2JK5C 3N2KB 2ZXWB 3U10A 1JJOA 4FZ1A 1K73W 4TQDA 3FAVB 2IM9A 3JD1A 4R7CA 4GLXA 1AJQA 3UT5B 4U3JA 2ZM6O 3U11A 2R70A 1QHTA 4GUNA 2OWOA 4DXWA 1XQ8A 2CH7A 1H38A 4PDLA 2DYRB 1QU7A 1BMFG 3OMIB 1G4YB 3ZMSA 5B1NA 4B3MO 3CYOA 1R3JC 4UVAA 2UUCB 1CEZA 4FFBA 3LDCA 2EULA 5LHGA 2XUMA 4DR1B 4FM2A 3RYCA 2XOKG 1YVWA 3K0GA 3W7SA 3I55V 2C2AA 1DF5A 2HVKC 5B1BB 1D5AA 3E83A 3CRCA 4OX9O 2Z5UA 3E22A 3JD4A 3CRAA 3DGEA 4DR7B 3JSLA 3JCZA 3SPJA 1XL4A 1NR7A 2QM7A 3K57A 1YITV 1PPJH 3MHSC 3CCUV 4O4LA 3ZJZA 1B06A 4QGPA 2XAFA 3AK2A 3M7MX 2A0LA 3JYCA 1F23A 4HAMA 4YHHO 2G38A 3X2QB 2FTKA 1GM7A 1AILA 3BY6A 4UCUA 5EIBC 5IDJA 4GCZA 4WCEV 1N36B 4IL6Z 4PDVA 5JJEB 2B9ZA 3RW0A 2LW1A 4JI3O 1Z5WA 2YXYA 3WB0A 1FD9A 4DUYO 4DW1A 3CC2V 2Q9LA 3AK3A 4LNUB 4DV6O 3ZMZA 2WA4A 3OD4A 4NKGB 4U3JB 3MD0A 1L0LH 1RSOA 1KUQA 5KHJA 2Y69B 1BS3A 5JVDB 4DR5B 2KQXA 4Q20A 2CH7B 5KMGA 1WN7A 2PYJA 3J80N 1VQKV 4MVSA 2WLMA 4DR3O 1HNZO 2WA3A 3FB8C 1QCEA 3ZHUA 2VQFO 3K9SA 4FFBB 3M8AA 3KKYA 3KCXA 2IH1C 3U0ZA 2MK3A 2LFRA 1ZAUA 1XREA 4JI7B 5EK0A 3THOA 3E22B 1XDCA 3H1HH 5L3GA 1EN6A 3ABKB 3OR7C 4DO2A 3OMAB 2EBOA 2P22C 5KUKA 4QPJA 3EXAA 2R72A 1JFFA 4PA3A 3CD6V 3SJCC 5GONA 2HFEC 2L35A 3CMAV 1Z5VA 2JGUA 1HR0B 1AP5A 3APQA 3K5NA 1FOUA 5FNVB 2P7TC 1NVPB 2BTQA 1W0JG 2UXDO 2ZIOA 3T1HO 3S3WA 1R3KC 2VQEB 4ZIBA 1HNXB 2UXXA 2YC0A 3ASNC 3K5MA 2BE3A 3S3XA 1AI4A 4JI1B 5LOVA 1YEWA 1KU9A 5IYDO 2N74A 3P32A 4CS2A 3ETQA 4B7EA 2XAGA 4WBNA 1SRYA 2HJDA 2PY5A 4FLWA 1KMIZ 2HLDG 2ADQB 2F4VO 1AI5A 3ABLC 5BR8B 3AG4C 5BMVA 3BEHA 3OUSA 4Z1VA 5BZBA 3ZHRA 1V54B 4CS4A 3JATB 2PI5A 1RSOB 4NR1A 4RQEA 1QNMA 5E1AC 1K92A 5LHHA 3AG1B 1BZKA 3F7VC 4UVBA 4FPPA 2ODMA 4H0LB 3E35A 5KMGB 1BT8A 2F93B 2YS8A 2UXCB 2DYSC 1KQSU 3K59A 1AR4A 5LGUA 4L87A 1AVMA 3EHBB 4LF4O 4R6ZA 5IY5C 3JD3A 4X9QA 5LP6C 5DEDA 1YTFB 2YIAA 2P6JA 4X62O 2RCVA 4JI8O 1ENVA 1PL0A 2YI8A 4K35A 1NBMG 1P49A 1H5WA 1H8EG 3CPWU 3QG5A 5KAIZ 2KKWA 4R8CA 3FX7A 4JGSA 3ABMB 4JI5O 3B2EE 1K3EA 1Q6HA 4HNAB 4LFBB 5KHGA 1AJPA 4HBNA 3UO2A 4X66B 1EM1A 4DV4B 2HVJC 2PI4A 4PJ0Z 5ITZB 1TUEB 1VF6A 4J10A 2BTQB 3ZRXA 3FKSG 2IJHA 1UJWB 2P90A 4WFBV 1D5NA 1R1BA 3WU2Z 2JEXA 1IBMO 2PYLA 2CGNA 5LOVB 2DWDC 4LF7B 4WBNB 5LMUO 3ZRWA 4L8JA 1QLNA 4PI2A 1TVKB 2QEXV 3RT3C 3D3IA 4JAAA 3K04A 2FKXA 5BMVB 1WPXA 2QKCA 4BW9A 3OAAG 4DV5B 4PA6A 4JAUA 3I56V 3ZHQA 2CTQA 2D2CB 3BCCH 4AQYO 1NZ6A 4J7KA 2ZNIA 1N32B 3GVMA 2Q0OC 4EB6A 2CTPA 1SETA 2ZE8A 5H5NA 3ZX6A 1PP9H 2A7WA 4J7JA 3L73H 3OUFA 4QJFB 1TGOA 1GN3A 5LA6B 4DV1B 2Y0IA 4BIZA 3CRMA 4RAIA 4B3MB 4EFEA 1W0KG 1XMOO 5BY1A 4JYAO 2EIMB 2AHYA 5CBHA 1EZVH 3NXSA 2OCCC 2RMKB 1VP7A 5LHIA 2HG5C 2W6JG 1AJNA 3JAWA 4RUEA 5L3DA 2X0LA 5CMUA 1Q6UA 4K8ZA 2JGDB 4J7ZA 4OX9B 1R3IC 4X88A 4WFGA 3ZMTA 3H9VA 3CB2A 3HKEA 2EIKB 2WLJA 5FL7G 3J7AU 1N0JA 1GH6A 1NJIW 3BABA 4FFKA 4DK1A 5EZYA 2ADPA 3VBBA 5B5EZ 3AG2C 3CEIA 4JPRA 4NTXA 2ZIMA 3K08A 4JI2O 5CA0B 2LP7A 4CH5A 4YHHB 1IX9A 2Z3YA 3SJQC 1OZ0A 3IJ4A 5CA1A 3FD9A 2LJ2A 3A0BZ 3FFQA 3ZRWB 3JARB 3RYIA 4JV5B 1IJGA 1JPXA 1AB3A 3N2KA 2Q68A 1S5LZ 5K1XA 3ASOB 3WG7B 4DUYB 2R9AA 2VS0A 3QTCA 3RN4A 3QO5A 2XHBA 1UPGA 4H44B 5FLXN 1HNWB 5KA6A 4X64B 1MA1A 4AHCA 5CN0A 4DV6B 2GTSA 2X6AA 4MTGA 4Q6GA 4EB6B 3E89A 2AGAA 3P3NA 1M56C 1S5HC 1K5QA 1S72V 1W59A 2YXHA 1VQ9V 1SQPH 3K5OA 2EILC 1YSCA 2ZXWC 4ZOLB 3HKCB 2WLLB 1VQLV 1OV9A 2JRIA 2ATKC 2WLIA 5EC1C 1MSWD 4O4IB 4BW5A 1IXMA 4MVQA 5IYBO 4DR3B 2RDCA 1HNZB 1XNRB 1MNGA 5J2TB 1OJHA 3LNMB 4PV1B 3R65A 1JA8A 3UO3A 2DYRC 3JAWB 3BA9A 4F4LA 1UFIA 3EFFK 3PJSK 2OTJV 3HR0A 4I4TB 5LL6Y 3HKBA 3SGIA 4XDLA 4FM1A 4FK5C 3ETGA 1N34B 1SQVH 5L3FA 3JAKA 4LFCB 3JD0A 2YICA 4U7NA 5B1BC 5IT9N 4CBCA 1VQ6V 4ZKIA 5D5PA 1RM1B 5K1PA 4UCRA 1K9MW 3G6EV 2H3OA 1XBLA 3CS5A 5J9PC 1PNKA 4FM0A 1KECA 4JAVA 2UXDB 5CA1B 5H2FZ 4GKJO 2V7QG 1MMMA 4IHJA 5EBWC 3K5LA 2XAHA 3X2QC 1KP2A 3ZMUA 5CBFA 1P84F 4WF9V 2WLKA 1VF5B 5JWPA 2E75B 3W7WA 5JJNB 1AI7A 2E76B 3ABUA 4I55A 4RWUA 2YUAA 2F4VB 5JVDA 1SA0B 3T4DA 3ZHVA 3ZRSA 4O2AB 3CCSV 1QR9A 4X1YB 1VQ8V 2QJ1A 1Q43A 1R6NA 1H2KA 3DC5A 1IXBA 3IC7A 2EJRA 4DV2O 1WA8A 4IIJB 1BQ0A 1JMKC 2QWOB 3OGIB 1AI6A 2WLIB 1VQ4V 1WB7A 5DM6V 1W2BU 1SZXA 2Y69C 5IWAO 1VQ7V 4LF4B 4DR2O 1NR1A 4JZ2A 4XDJA 1GMGA 1GO3F 3MAQA 5KUMA 1J5EO 1SESA 3D36A 4X62B 1PV0A 4TQFA 3HKBB 1S0VA 3SYPA 3SPGA 5B3SB 4N23A 4LF5B 4PD4F 5LGTA 4P30A 2BOCC 3JAKB 5FNVA 1JQ0A 4ASUG 1M90W 2K9PA 3OW2U 4JI6O 4B3RO 5LMNO 4LP8A 4HYOA 4FLUA 2Q5ZA 2BTOA 1Q86W 2GUZB 4FLTA 3ABKC 3H1LH 4YIOA 5IJ0A 1VQNV 1L8DA 4K0KB 1WAZA 4ABMA 3SJBC 1Y74B 5GTHZ 2ZT9B 4J9ZB 4PA9A 4K3AA 2WSSG 2LFSA 1OCZB 4IHJB 5C8YB 1H2LA 2UXBO 2UU9O 4YXWG 1JCHA 2B1GA 5LMUB 3JATA 4DUZO 4I55B 2BCCH 2CGOA 1L0NH 3ETEA 2E5LO 4EEQA 2FYUH 3F5TA 3FB5C 3AG7A 4B7KA 3AK1A 5JH7B 1NH2B 1J95A 1YJ9V 3JALA 5JQGB 2EJ7A 2VRZA 3JCUZ 4TV8A 1PD3A 3FB7C 1WA8B 3AG3B 5B1OA 1Y4MA 4MT8A 1FXKA 1WP8A 3OEHG 4AQYB 3STZC 3CRQA 1PM9A 2ZCEA 1QVGU 3NR7A 5JCOA 1V54C 4KXRA 4GYCB 5E79Z 3E8FA 4QPKA 1QR8A 4RQFA 3TGUH 4TT3G 3AG1C 4GT1A 4X20B 5L3BA 2UUAO 2KB1A 1K33A 4YY3B 4GKKO 2M7WA 1RP3B 1XHZA 5L3CA 3HPLC 3DSQA 1I08A 2V4DA 4HNAA 4MSWC 4JYAB 2DQ0A 1H8HG 1RPOA 1XHXA 2OTLV 1CPYA 5H6RA 2UUBO 2NLJC 1WPBA 1VF7A 2LO1A 5ITZA 5JCOC 2ZE6A 1JX9A 3LUTB 1IURA 4LF9B 3OT7A 5EC2C 4B3SO 4DV7O 1KC8W 4P2ZA 4KHPB 5KHHA 2HKOA 1NH2D 5H6QA 1MG1A 1RPRA 2P5OA 3ABMC 4FLXA 4X1IB 4JI0O 5IJ0B 3I5DA 2YEVB 2A9HA 4NXMO 1AR1B 1U97A 3RWRD 3SJAC 3FYIB 1TVKA 3A0RA 4DW0A 4GX5A 2B5UA 1VEWA 2DE0X 4IT5A 1M5IA 2DW4A 1OCCB 2DN9A 1ROPA 1GN6A 4I50B 3QO7A 4XDKA 4TUYA 2CUGA 1KKCA 1XL6A 2GBOA 1KD1W 1VQPV 4D7SA 2ZR3A 3JALB 3T1YO 1RFYA 4OPHA 4TV8B 1N33O 2Q7EA 5EIBD 1FXKB 5JJJB 1AP6A 5LA6A 3LSQA 1BHBA 1N4CA 5IYZB 1PNLA 2UUCO 1THZA 1TUBA 4DR1O 1ZLZA 3L70H 3QNEA 3ZRVA 1WLEA 2RN9A 4QIWF 1G6UA 5FPOA 3ABTA 3CWBH 2EINB 2JGDA 2H94A 5KX5B 4JYYA 4KFMA 4WFHA 4MTOA 3SYAA 3ICXA 2OT5A 3ZCCA 2B1IA 3GWKC 3N27A 3ASNB 2AZ0A 2ITCC 4I9WA 2HEPA 3OM3B 2ITDC 1SQBH 3ZMVA 4EKWA 4UCVA 2EIMC 1G1XB 1X4TA 5KAFZ 4UCTA 1NI8A 2Q67A 2Y4TA 3ZIAG 4CC5A 5CA0A 1B6QA 3PN1A 4LC1A 1S5JA 1TAEA 2QWPB 5IYCO 2HHHO 4TV9B 3ABLB 1DTOA 1PKXA 2EIKC 3G80A 4FZ0A 4U3FH 3AG4B 3JARA 3MDSA 4BIOA 1FJGO 4MVRA 5KA5A 1VF6C 2DMXA 2JS3A 2EIJC 3OGCC 4UCSA 1ZTEA 2RNBA 2Q0AA 4O4HB 3TXQA 4I7ZB 1ZUQA 2QTOA 4H13B 1MZEA 4TUYB 2R9RB 2DYSB 4B3TO 4LF8O 4DR4O 1GM8A 3IFXA 1CP9A 2ZM6B 2ETNA 3D8CA 2GDSA 4H33A 3BAAA 4ZOLA 3HKCA 2WLLA 2LW7A 4ZI7A 4JYBA 3ASOC 3KG2A 3WG7C 4DV2B 1E1QG 1TUBB 2GTAA 2W0FC 4O4IA 4XBFA 3OTOO 2F43G 2YXLA 3CCMV 5J2TA 2FL4A 1FFXB 4DK0A 3EVKA 3CHXA 1ZL8A 3VOUA 1GAXA 1FYJA 4JTCB 4MW8A 4CH4A 4UV9A 4I4TA 5IWAB 4MTFA 2UXNA 1K4CC 4PA4A 5EBLC 4DR2B 4QNHB 1I94O 2A06H 2X7RB 4OPAA 3ZEDA 4J80A 2P06A 4Z1MG 3E2EA 4R50A 3CCEV 3DTUB 1HNXO 1GTOA 4U7OA 4OGQB 3TETA 4QE9A 1N0NA 4DV0O 3K03A 3B8MA 5H9CA 2XT9A 4JI6B 4J42A 4J41A 5EBMC 5LXTA 5LMNB 1M57B 3CCVV 3CCJV 1VQOV 2ILMA 4JI3B 2QSAA 3STLC 3RYFA 4P9OA 4D6TH 4LWSB 4DR6O 5AG2A 2JS5A 1KBHA 1A32A 4H37A 4AI8A 4PDMA 3A2FA 1RM1C 5CBGA 1SA0A 3CE2A 4O2AA 1KKDA 2Y0PA 4I0XA 4K8XA 2UU9B 4X1YA 1EN5A 1T5EA 4PDRA 4FJCC 3M99B 4DUZB 5KHKA 3IGAC 4IIJA 1SZTA 2E5LB 3L74H 2UXCO 2Q73A 2PGGA 1SKVA 4ZI7B 1Q82W 3CXCU 3BRCA 4TWKA 4DYLA 2HR3A 3L71H 2GHYA 2EZOA 2VQFB 1HWYA 2AZ2A 4UUJC 5D5QA 2VWKA 3SPCA 1OHHG 3CC7V 3OE7G 1ZL8B 3E86A 1BGYH 4GX1A 4UFZA 2QR4A 4FIPC 2P4VA 2W0XA 1YXBA 4PHZA 3G6BA 3JD2A 3TXSA 5DN6G 3OR6C
chains in the Genus database with same CATH topology
4GUNA 1WB8A 1BS3A 3KDRA 1MMMA 1LUWA 2QKAA 2QKCA 1QNMA 2CDYA 1N0NA 1BT8A 3RN4A 1LUVA 1JR9A 1I0HA 1IDSA 5A9GA 1PL4A 3K9SA 1VEWA 3MDSA 3DC6A 1AR4A 1MA1A 1P7GA 1AVMA 3KKYA 1Y67A 4X9QA 1XREA 1ZTEA 1GN6A 1MSDA 1GN3A 3DC5A 1IXBA 3AK1A 1KKCA 1ZUQA 5AG2A 1XDCA 2P4KA 1VARA 2RCVA 3BFRA 1EN6A 4F6EA 3LSUA 3TJTA 1B06A 1WB7A 3C3SA 1EN5A 3AK2A 1AR5A 2CE4A 1PM9A 1AP6A 1SZXA 1MNGA 1GN2A 1BSMA 2GDSA 1JA8A 2AW9A 1ZSPA 1EM1A 4JZ2A 4YIPA 1AP5A 1GN4A 1ZLZA 1N0JA 3C3TA 4FFKA 4BR6A 1I08A 2ADPA 1D5NA 4JYYA 3EVKA 3CEIA 3QVNA 1XUQA 3IC9A 1EN4A 3AK3A 1IX9A 1XILA 4E4EA 3OT7A 4C7UA 2ADQB 4JZGA 4YIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GUN A;  1WB8 A;  1BS3 A;  1MMM A;  1LUW A;  2QKA A;  2QKC A;  1QNM A;  2CDY A;  1N0N A;  1BT8 A;  3RN4 A;  1LUV A;  1JR9 A;  1I0H A;  1IDS A;  5A9G A;  1PL4 A;  3K9S A;  1VEW A;  3MDS A;  3DC6 A;  1AR4 A;  1MA1 A;  1P7G A;  1AVM A;  3KKY A;  1Y67 A;  4X9Q A;  1XRE A;  1ZTE A;  1GN6 A;  1MSD A;  1GN3 A;  3DC5 A;  1IXB A;  3AK1 A;  1KKC A;  1ZUQ A;  5AG2 A;  1XDC A;  2P4K A;  1VAR A;  2RCV A;  3BFR A;  1EN6 A;  4F6E A;  3LSU A;  3TJT A;  1B06 A;  1WB7 A;  3C3S A;  1EN5 A;  3AK2 A;  1AR5 A;  2CE4 A;  1PM9 A;  1AP6 A;  1SZX A;  1MNG A;  1GN2 A;  1BSM A;  2GDS A;  1JA8 A;  2AW9 A;  1ZSP A;  1EM1 A;  4JZ2 A;  4YIP A;  1AP5 A;  1GN4 A;  1ZLZ A;  1N0J A;  3C3T A;  4FFK A;  4BR6 A;  1I08 A;  2ADP A;  1D5N A;  4JYY A;  3EVK A;  3CEI A;  3QVN A;  1XUQ A;  3IC9 A;  1EN4 A;  3AK3 A;  1IX9 A;  1XIL A;  4E4E A;  3OT7 A;  4C7U A;  2ADQ B;  4JZG A;  4YIO A; 
#chains in the Genus database with same CATH topology
 4WFA V;  3JAM N;  2H8P C;  4X65 O;  1KB9 F;  1K5S A;  1WNS A;  1BCC H;  2NN4 A;  3QO8 A;  5B1A B;  4UV8 A;  4ZBM A;  1NTM H;  2XTA A;  3BVO A;  2XND G;  4FVM A;  2UUB B;  1F4N A;  2QWR B;  4X1K B;  5KLV H;  3RGB A;  2GUZ A;  1JR9 A;  1IBL O;  1Z2G A;  3T4Z A;  2E3C A;  1Y74 A;  3T1H B;  4NTW A;  1FPO A;  1GK9 A;  4IYH A;  3JSN A;  5LXT B;  3L72 H;  2JEU A;  5C8Y A;  5B3S C;  4LF7 O;  4E2L A;  3OEE G;  3ZN1 A;  1WJZ A;  4NXM B;  3RYF B;  1VAR A;  1HW7 A;  5KHI A;  1OCO B;  1V55 B;  2HP8 A;  1GKF A;  2LGQ A;  4F6E A;  1SQQ H;  4WFF A;  5FPR A;  1Q81 W;  1ORQ C;  3UQ8 A;  4TOI A;  1QLE B;  4DV5 O;  4I0X B;  5JH7 A;  3W7T A;  5JQG A;  1XNQ O;  5J2U A;  1YCI A;  2Q69 A;  1H2N A;  2W6I G;  1Q3E A;  1OCZ C;  1VMG A;  1XMQ O;  2OYQ A;  1FS0 G;  4LF6 O;  1N32 O;  1E79 G;  2EZP A;  3CME V;  4I5S A;  3T1Y B;  2Q7H A;  1LR1 A;  1Q5O A;  4DV1 O;  4MVM A;  1N33 B;  4YJ3 A;  2X6B A;  3ZBH A;  4ZHQ A;  1FXV A;  4UVC A;  4X20 A;  3SR2 C;  3OFN G;  3JAS B;  5BXZ A;  4LCU C;  4DRX B;  1S3J A;  5CB4 A;  4NXN O;  2XAS A;  1B04 A;  4HZ3 A;  3KZI Z;  3DXR A;  3AG3 C;  4JI8 B;  4D7T A;  1SER A;  2JIZ G;  3CCL V;  3KDR A;  1URF A;  1DGS A;  1YJW V;  3OMN B;  3APO A;  3N2G A;  4JI5 B;  1M1K W;  3W7X A;  4WFE A;  2QA4 V;  2CDY A;  1M4U A;  1DK1 A;  1LUV A;  2GV9 A;  1K8A W;  1IDS A;  4J9Y B;  2WLH A;  2Q4P A;  2YSU B;  3RYH A;  1I5X A;  2RQ6 A;  4X1I A;  1Y67 A;  4QE7 A;  3WB2 A;  1OCR B;  1JOY A;  3D36 C;  2YEV A;  3FB6 C;  3B09 A;  3H1K H;  1SF9 A;  1P4R A;  1HP8 A;  2FB5 A;  1IBM B;  3OTF A;  4UB8 Z;  1JNB A;  4JI4 O;  4OXS A;  3K58 A;  1P7B A;  4JV5 O;  1E1R G;  2HHH B;  1R3L C;  4DV3 O;  2V1D A;  4YJ2 A;  5IJ9 A;  3P3P A;  2Y48 A;  3K3W A;  4I50 A;  1VQ5 V;  1FJG B;  1GN2 A;  1BSM A;  1WP7 A;  3TK1 A;  3SYC A;  5TIS Z;  2AW9 A;  1ZSP A;  1K7D A;  4IYI A;  3B8N A;  4O2B B;  5J2U B;  2JJ1 G;  1HNW O;  4FLZ A;  4X89 A;  4X64 O;  1F51 A;  4B3T B;  1X59 A;  4G28 B;  5IYZ A;  4PI0 A;  2R9I A;  4LF8 B;  1OCC C;  4DR4 B;  4NTY A;  2BSK A;  3IC9 A;  4JTA B;  1EN4 A;  4MTX A;  4YJ3 B;  1NKD A;  2HJF C;  4ZHQ B;  3E8B A;  2OIE A;  4C7U A;  4FLY A;  5HFM A;  3ZHS A;  1XNR O;  4JTD B;  2BOB C;  4JZG A;  5KX5 A;  2LQT A;  3VQV A;  5CB4 B;  1IZ3 A;  3QF7 A;  1WB8 A;  3DXR B;  3UCS C;  1XMO B;  1Q90 D;  1NTK H;  4LH7 A;  3F5W C;  3Q4H A;  3RYC B;  4NVP A;  3OTO B;  1FXK C;  5GTI Z;  2D3O W;  1GM9 A;  2NR5 A;  3HB3 B;  2ZE7 A;  4CS3 A;  1NS1 A;  2KSD A;  4X8A A;  2DQ3 A;  3K06 A;  3N2G B;  4JF3 A;  3A0H Z;  2IU3 A;  3B40 A;  4G27 B;  1HDJ A;  1N34 O;  1I7F A;  1FXH A;  4LFC O;  2ZIN A;  3CJH A;  1PL4 A;  2PZS A;  4LFA O;  1FKA O;  2A79 B;  1I94 B;  4O4L B;  1NTZ H;  2QTS A;  4KL1 A;  2EIN C;  3C90 A;  3RYH B;  1IBK O;  3J81 N;  2F95 B;  4KP4 A;  4A5U B;  2KG7 A;  1US6 A;  4RUF A;  1L1F A;  4TV9 A;  3CRR A;  3RVZ A;  3UM7 A;  3BFR A;  3RFR A;  4JI2 B;  1JJ2 U;  4DV0 B;  1EBO A;  1CXZ B;  3TJT A;  3TCU A;  1O9H A;  2IW5 A;  2WWW A;  1AR5 A;  4LH6 A;  2CAZ C;  2CE4 A;  4O4J A;  4NYK A;  4O4H A;  4YJ2 B;  2YIB A;  5IJ9 B;  4MVZ A;  1H2M A;  5LYJ A;  2Z0A A;  1DLB A;  1EFR G;  2K1E A;  1YI2 V;  2DJV A;  2AXT Z;  4DR6 B;  2ZD9 A;  1XI1 A;  5LP6 A;  3BA8 A;  4RO2 A;  4G2K A;  2ZDI A;  4ICG A;  3LDE A;  1I5Y A;  1ZX3 A;  1F7Y A;  3F7Y C;  4Z2W A;  2X6C A;  3UKM A;  1D2D A;  3CSX A;  2YID A;  2BSK B;  3SYO A;  4E4E A;  2N05 A;  1G8M A;  1M9N A;  3H01 A;  5IE9 A;  4CC6 A;  1Y76 A;  4NB5 A;  1FFX A;  1COW G;  3AEI A;  4FMT A;  1NVP D;  2ZDI C;  4DR7 O;  4UB6 Z;  2QKA A;  3L9D A;  4GX0 A;  1BE3 H;  1MZF A;  1PNM A;  3Q4H B;  1B3Q A;  3H1J H;  3O65 A;  2YDE A;  1ZWI C;  2A3Q A;  2QKS A;  3W7U A;  2P67 A;  1YZB A;  2IH3 C;  2WAM A;  1I0H A;  5A9G A;  3DC6 A;  3VQX A;  5LBQ A;  4GZR B;  2L6L A;  2VWJ A;  4LF5 O;  2CTW A;  3SPH A;  3O9O A;  3CJH B;  2CK3 G;  2WLN A;  4X65 B;  1YDX A;  2LGW A;  1JFF B;  5GON B;  1Q6I A;  1Y66 A;  2ZNJ A;  1N36 O;  2KG7 B;  4B08 A;  2WPD G;  2PUS A;  2ARH A;  4K0K O;  1S76 D;  4I9Q A;  2ZKO A;  4CZZ A;  1VQM V;  1IBL B;  1K4D C;  2F1M A;  3ZS8 C;  4LWS A;  3WFV A;  3B4S A;  3E8G A;  1IVS A;  4O4J B;  2QDO A;  4GKJ B;  1XEQ A;  2JDI G;  1GN4 A;  2CTR A;  1XOU A;  3RBZ A;  5LYJ B;  2EX3 A;  3C3T A;  3SPI A;  1YTF D;  4CH3 A;  1YJN V;  3CXH F;  3CP1 A;  5IY5 B;  4DR5 O;  1M57 C;  5LP6 B;  5A2Q N;  2PTM A;  2E74 B;  5HFL A;  1SC5 B;  1LNQ A;  3CCR V;  3T2M A;  1XNQ B;  3G4S V;  4MVU A;  1Q8I A;  2ZE5 A;  3LSS A;  1XMQ B;  4LF6 B;  1ARO P;  2JJ2 G;  2F66 C;  4N21 A;  1Y76 B;  4JI7 O;  5B66 Z;  2O57 A;  5L3E A;  1Y6X A;  3H1I H;  2QGN A;  2ZR2 A;  3CC4 V;  5C93 A;  4YY3 O;  1V9P A;  2M6Y A;  2OIG A;  4MS2 A;  1BL8 A;  2QM8 A;  2OCH A;  3CCQ V;  3ZN0 A;  1J5E B;  1P7G A;  4NXN B;  2YIB D;  4W4K A;  1HR0 O;  2RJZ A;  3HKD A;  1EZJ A;  1QQC A;  3E8H A;  4LF9 O;  4X1K A;  1JVM A;  4BIU A;  1H2S B;  2VQE O;  5EYP A;  4EFB A;  2P4K A;  4KHP O;  2DOS A;  4PEL A;  4JI1 O;  3WB1 A;  4B3R B;  3KCY A;  2GSM B;  3LSU A;  1SQX H;  3LDD A;  2EIJ B;  2FML A;  2PF4 E;  3MHH C;  3P30 A;  2IJJ A;  2MW2 B;  3A8T A;  1H2G A;  5B1A C;  5CA3 A;  2ZQM A;  3L75 H;  4YIP A;  4BAY A;  1VIB A;  4LBE C;  2IU0 A;  4W4L A;  4F6R A;  3BHP A;  2Q8V A;  5BR8 O;  2QE7 G;  3VQY A;  3VQW A;  1F4M A;  1GRJ A;  2UXB B;  4IGG A;  4AIL C;  4JI4 B;  3LNN A;  4BR6 A;  3IAY A;  3ETD A;  2QWN B;  3G67 A;  2QWQ B;  4DV3 B;  1YHQ V;  4UXN A;  3FAV A;  4P9P A;  1NT2 B;  3BPZ A;  2DWE C;  3UT5 A;  2JVD A;  1NU1 H;  3G71 V;  1K97 A;  2Y4U A;  1XIL A;  4JAS A;  2N04 A;  1U96 A;  1MAB G;  1OCO C;  1SQG A;  1V55 C;  5LGN A;  4MW3 A;  2OCC B;  3SYQ A;  3FYE B;  4LR3 A;  3GB7 C;  3ZHT A;  1KP3 A;  2NNU A;  1LUW A;  4UCO A;  4PA7 A;  1QLE C;  3K79 A;  3JAS A;  1YIJ V;  4DRX A;  5F2V O;  2AHZ A;  1M93 A;  3SDL A;  1O9G A;  3D3Q A;  1K34 A;  1R6K A;  2Q6A A;  3B77 A;  2QM4 A;  1KYO F;  4GX2 A;  2UUA B;  4LFB O;  3K0D A;  4GKK B;  4X66 O;  3AG2 B;  2F23 A;  4DV4 O;  1MSD A;  4TSF G;  1SS3 A;  1S77 D;  3RVY A;  1MOF A;  3GWO A;  1Q7Y W;  3HKD B;  1FFT B;  3CX5 F;  4FLV A;  1YF2 A;  4MVO A;  5GW7 A;  1QBZ A;  3HKE B;  5EYP B;  1DF4 A;  1BQZ A;  2IJK A;  4B3S B;  2XAQ A;  3C3S A;  4DV7 B;  4CH6 A;  2Q7G A;  4LFA B;  1N8R W;  3ML0 A;  5EZY B;  3R66 A;  4J11 A;  1QVF U;  1NQT A;  3K9A A;  1IBK B;  4JI0 B;  2IJI A;  1R73 A;  5DEC A;  4F6R B;  1TA8 A;  1R6T A;  1FAF A;  4JYC A;  4BWA A;  4KUM A;  3T1C A;  2YI9 A;  2XAJ A;  1OCR C;  1M56 B;  1BHA A;  2IBZ H;  1SQF A;  3RYI B;  3QVN A;  1XUQ A;  4LNU A;  4O2B A;  2EIL B;  2JK5 C;  3N2K B;  2ZXW B;  3U10 A;  1JJO A;  4FZ1 A;  1K73 W;  4TQD A;  3FAV B;  2IM9 A;  3JD1 A;  4R7C A;  4GLX A;  1AJQ A;  3UT5 B;  4U3J A;  2ZM6 O;  3U11 A;  2R70 A;  1QHT A;  4GUN A;  2OWO A;  4DXW A;  1XQ8 A;  2CH7 A;  1H38 A;  4PDL A;  2DYR B;  1QU7 A;  1BMF G;  3OMI B;  1G4Y B;  3ZMS A;  5B1N A;  4B3M O;  3CYO A;  1R3J C;  4UVA A;  2UUC B;  1CEZ A;  4FFB A;  3LDC A;  2EUL A;  5LHG A;  2XUM A;  4DR1 B;  4FM2 A;  3RYC A;  2XOK G;  1YVW A;  3K0G A;  3W7S A;  3I55 V;  2C2A A;  1DF5 A;  2HVK C;  5B1B B;  1D5A A;  3E83 A;  3CRC A;  4OX9 O;  2Z5U A;  3E22 A;  3JD4 A;  3CRA A;  3DGE A;  4DR7 B;  3JSL A;  3JCZ A;  3SPJ A;  1XL4 A;  1NR7 A;  2QM7 A;  3K57 A;  1YIT V;  1PPJ H;  3MHS C;  3CCU V;  4O4L A;  3ZJZ A;  1B06 A;  4QGP A;  2XAF A;  3AK2 A;  3M7M X;  2A0L A;  3JYC A;  1F23 A;  4HAM A;  4YHH O;  2G38 A;  3X2Q B;  2FTK A;  1GM7 A;  1AIL A;  3BY6 A;  4UCU A;  5EIB C;  5IDJ A;  4GCZ A;  4WCE V;  1N36 B;  4IL6 Z;  4PDV A;  5JJE B;  2B9Z A;  3RW0 A;  2LW1 A;  4JI3 O;  1Z5W A;  2YXY A;  3WB0 A;  1FD9 A;  4DUY O;  4DW1 A;  3CC2 V;  2Q9L A;  3AK3 A;  4LNU B;  4DV6 O;  3ZMZ A;  2WA4 A;  3OD4 A;  4NKG B;  4U3J B;  3MD0 A;  1L0L H;  1RSO A;  1KUQ A;  5KHJ A;  2Y69 B;  1BS3 A;  5JVD B;  4DR5 B;  2KQX A;  4Q20 A;  2CH7 B;  5KMG A;  1WN7 A;  2PYJ A;  3J80 N;  1VQK V;  4MVS A;  2WLM A;  4DR3 O;  1HNZ O;  2WA3 A;  3FB8 C;  1QCE A;  3ZHU A;  2VQF O;  3K9S A;  4FFB B;  3M8A A;  3KKY A;  3KCX A;  2IH1 C;  3U0Z A;  2MK3 A;  2LFR A;  1ZAU A;  1XRE A;  4JI7 B;  5EK0 A;  3THO A;  3E22 B;  1XDC A;  3H1H H;  5L3G A;  1EN6 A;  3ABK B;  3OR7 C;  4DO2 A;  3OMA B;  2EBO A;  2P22 C;  5KUK A;  4QPJ A;  3EXA A;  2R72 A;  1JFF A;  4PA3 A;  3CD6 V;  3SJC C;  5GON A;  2HFE C;  2L35 A;  3CMA V;  1Z5V A;  2JGU A;  1HR0 B;  1AP5 A;  3APQ A;  3K5N A;  1FOU A;  5FNV B;  2P7T C;  1NVP B;  2BTQ A;  1W0J G;  2UXD O;  2ZIO A;  3T1H O;  3S3W A;  1R3K C;  2VQE B;  4ZIB A;  1HNX B;  2UXX A;  2YC0 A;  3ASN C;  3K5M A;  2BE3 A;  3S3X A;  1AI4 A;  4JI1 B;  5LOV A;  1YEW A;  1KU9 A;  5IYD O;  2N74 A;  3P32 A;  4CS2 A;  3ETQ A;  4B7E A;  2XAG A;  4WBN A;  1SRY A;  2HJD A;  2PY5 A;  4FLW A;  1KMI Z;  2HLD G;  2ADQ B;  2F4V O;  1AI5 A;  3ABL C;  5BR8 B;  3AG4 C;  5BMV A;  3BEH A;  3OUS A;  4Z1V A;  5BZB A;  3ZHR A;  1V54 B;  4CS4 A;  3JAT B;  2PI5 A;  1RSO B;  4NR1 A;  4RQE A;  1QNM A;  5E1A C;  1K92 A;  5LHH A;  3AG1 B;  1BZK A;  3F7V C;  4UVB A;  4FPP A;  2ODM A;  4H0L B;  3E35 A;  5KMG B;  1BT8 A;  2F93 B;  2YS8 A;  2UXC B;  2DYS C;  1KQS U;  3K59 A;  1AR4 A;  5LGU A;  4L87 A;  1AVM A;  3EHB B;  4LF4 O;  4R6Z A;  5IY5 C;  3JD3 A;  4X9Q A;  5LP6 C;  5DED A;  1YTF B;  2YIA A;  2P6J A;  4X62 O;  2RCV A;  4JI8 O;  1ENV A;  1PL0 A;  2YI8 A;  4K35 A;  1NBM G;  1P49 A;  1H5W A;  1H8E G;  3CPW U;  3QG5 A;  5KAI Z;  2KKW A;  4R8C A;  3FX7 A;  4JGS A;  3ABM B;  4JI5 O;  3B2E E;  1K3E A;  1Q6H A;  4HNA B;  4LFB B;  5KHG A;  1AJP A;  4HBN A;  3UO2 A;  4X66 B;  1EM1 A;  4DV4 B;  2HVJ C;  2PI4 A;  4PJ0 Z;  5ITZ B;  1TUE B;  1VF6 A;  4J10 A;  2BTQ B;  3ZRX A;  3FKS G;  2IJH A;  1UJW B;  2P90 A;  4WFB V;  1D5N A;  1R1B A;  3WU2 Z;  2JEX A;  1IBM O;  2PYL A;  2CGN A;  5LOV B;  2DWD C;  4LF7 B;  4WBN B;  5LMU O;  3ZRW A;  4L8J A;  1QLN A;  4PI2 A;  1TVK B;  2QEX V;  3RT3 C;  3D3I A;  4JAA A;  3K04 A;  2FKX A;  5BMV B;  1WPX A;  2QKC A;  4BW9 A;  3OAA G;  4DV5 B;  4PA6 A;  4JAU A;  3I56 V;  3ZHQ A;  2CTQ A;  2D2C B;  3BCC H;  4AQY O;  1NZ6 A;  4J7K A;  2ZNI A;  1N32 B;  3GVM A;  2Q0O C;  4EB6 A;  2CTP A;  1SET A;  2ZE8 A;  5H5N A;  3ZX6 A;  1PP9 H;  2A7W A;  4J7J A;  3L73 H;  3OUF A;  4QJF B;  1TGO A;  1GN3 A;  5LA6 B;  4DV1 B;  2Y0I A;  4BIZ A;  3CRM A;  4RAI A;  4B3M B;  4EFE A;  1W0K G;  1XMO O;  5BY1 A;  4JYA O;  2EIM B;  2AHY A;  5CBH A;  1EZV H;  3NXS A;  2OCC C;  2RMK B;  1VP7 A;  5LHI A;  2HG5 C;  2W6J G;  1AJN A;  3JAW A;  4RUE A;  5L3D A;  2X0L A;  5CMU A;  1Q6U A;  4K8Z A;  2JGD B;  4J7Z A;  4OX9 B;  1R3I C;  4X88 A;  4WFG A;  3ZMT A;  3H9V A;  3CB2 A;  3HKE A;  2EIK B;  2WLJ A;  5FL7 G;  3J7A U;  1N0J A;  1GH6 A;  1NJI W;  3BAB A;  4FFK A;  4DK1 A;  5EZY A;  2ADP A;  3VBB A;  5B5E Z;  3AG2 C;  3CEI A;  4JPR A;  4NTX A;  2ZIM A;  3K08 A;  4JI2 O;  5CA0 B;  2LP7 A;  4CH5 A;  4YHH B;  1IX9 A;  2Z3Y A;  3SJQ C;  1OZ0 A;  3IJ4 A;  5CA1 A;  3FD9 A;  2LJ2 A;  3A0B Z;  3FFQ A;  3ZRW B;  3JAR B;  3RYI A;  4JV5 B;  1IJG A;  1JPX A;  1AB3 A;  3N2K A;  2Q68 A;  1S5L Z;  5K1X A;  3ASO B;  3WG7 B;  4DUY B;  2R9A A;  2VS0 A;  3QTC A;  3RN4 A;  3QO5 A;  2XHB A;  1UPG A;  4H44 B;  5FLX N;  1HNW B;  5KA6 A;  4X64 B;  1MA1 A;  4AHC A;  5CN0 A;  4DV6 B;  2GTS A;  2X6A A;  4MTG A;  4Q6G A;  4EB6 B;  3E89 A;  2AGA A;  3P3N A;  1M56 C;  1S5H C;  1K5Q A;  1S72 V;  1W59 A;  2YXH A;  1VQ9 V;  1SQP H;  3K5O A;  2EIL C;  1YSC A;  2ZXW C;  4ZOL B;  3HKC B;  2WLL B;  1VQL V;  1OV9 A;  2JRI A;  2ATK C;  2WLI A;  5EC1 C;  1MSW D;  4O4I B;  4BW5 A;  1IXM A;  4MVQ A;  5IYB O;  4DR3 B;  2RDC A;  1HNZ B;  1XNR B;  1MNG A;  5J2T B;  1OJH A;  3LNM B;  4PV1 B;  3R65 A;  1JA8 A;  3UO3 A;  2DYR C;  3JAW B;  3BA9 A;  4F4L A;  1UFI A;  3EFF K;  3PJS K;  2OTJ V;  3HR0 A;  4I4T B;  5LL6 Y;  3HKB A;  3SGI A;  4XDL A;  4FM1 A;  4FK5 C;  3ETG A;  1N34 B;  1SQV H;  5L3F A;  3JAK A;  4LFC B;  3JD0 A;  2YIC A;  4U7N A;  5B1B C;  5IT9 N;  4CBC A;  1VQ6 V;  4ZKI A;  5D5P A;  1RM1 B;  5K1P A;  4UCR A;  1K9M W;  3G6E V;  2H3O A;  1XBL A;  3CS5 A;  5J9P C;  1PNK A;  4FM0 A;  1KEC A;  4JAV A;  2UXD B;  5CA1 B;  5H2F Z;  4GKJ O;  2V7Q G;  1MMM A;  4IHJ A;  5EBW C;  3K5L A;  2XAH A;  3X2Q C;  1KP2 A;  3ZMU A;  5CBF A;  1P84 F;  4WF9 V;  2WLK A;  1VF5 B;  5JWP A;  2E75 B;  3W7W A;  5JJN B;  1AI7 A;  2E76 B;  3ABU A;  4I55 A;  4RWU A;  2YUA A;  2F4V B;  5JVD A;  1SA0 B;  3T4D A;  3ZHV A;  3ZRS A;  4O2A B;  3CCS V;  1QR9 A;  4X1Y B;  1VQ8 V;  2QJ1 A;  1Q43 A;  1R6N A;  1H2K A;  3DC5 A;  1IXB A;  3IC7 A;  2EJR A;  4DV2 O;  1WA8 A;  4IIJ B;  1BQ0 A;  1JMK C;  2QWO B;  3OGI B;  1AI6 A;  2WLI B;  1VQ4 V;  1WB7 A;  5DM6 V;  1W2B U;  1SZX A;  2Y69 C;  5IWA O;  1VQ7 V;  4LF4 B;  4DR2 O;  1NR1 A;  4JZ2 A;  4XDJ A;  1GMG A;  1GO3 F;  3MAQ A;  5KUM A;  1J5E O;  1SES A;  3D36 A;  4X62 B;  1PV0 A;  4TQF A;  3HKB B;  1S0V A;  3SYP A;  3SPG A;  5B3S B;  4N23 A;  4LF5 B;  4PD4 F;  5LGT A;  4P30 A;  2BOC C;  3JAK B;  5FNV A;  1JQ0 A;  4ASU G;  1M90 W;  2K9P A;  3OW2 U;  4JI6 O;  4B3R O;  5LMN O;  4LP8 A;  4HYO A;  4FLU A;  2Q5Z A;  2BTO A;  1Q86 W;  2GUZ B;  4FLT A;  3ABK C;  3H1L H;  4YIO A;  5IJ0 A;  1VQN V;  1L8D A;  4K0K B;  1WAZ A;  4ABM A;  3SJB C;  1Y74 B;  5GTH Z;  2ZT9 B;  4J9Z B;  4PA9 A;  4K3A A;  2WSS G;  2LFS A;  1OCZ B;  4IHJ B;  5C8Y B;  1H2L A;  2UXB O;  2UU9 O;  4YXW G;  1JCH A;  2B1G A;  5LMU B;  3JAT A;  4DUZ O;  4I55 B;  2BCC H;  2CGO A;  1L0N H;  3ETE A;  2E5L O;  4EEQ A;  2FYU H;  3F5T A;  3FB5 C;  3AG7 A;  4B7K A;  3AK1 A;  5JH7 B;  1NH2 B;  1J95 A;  1YJ9 V;  3JAL A;  5JQG B;  2EJ7 A;  2VRZ A;  3JCU Z;  4TV8 A;  1PD3 A;  3FB7 C;  1WA8 B;  3AG3 B;  5B1O A;  1Y4M A;  4MT8 A;  1FXK A;  1WP8 A;  3OEH G;  4AQY B;  3STZ C;  3CRQ A;  1PM9 A;  2ZCE A;  1QVG U;  3NR7 A;  5JCO A;  1V54 C;  4KXR A;  4GYC B;  5E79 Z;  3E8F A;  4QPK A;  1QR8 A;  4RQF A;  3TGU H;  4TT3 G;  3AG1 C;  4GT1 A;  4X20 B;  5L3B A;  2UUA O;  2KB1 A;  1K33 A;  4YY3 B;  4GKK O;  2M7W A;  1RP3 B;  1XHZ A;  5L3C A;  3HPL C;  3DSQ A;  1I08 A;  2V4D A;  4HNA A;  4MSW C;  4JYA B;  2DQ0 A;  1H8H G;  1RPO A;  1XHX A;  2OTL V;  1CPY A;  5H6R A;  2UUB O;  2NLJ C;  1WPB A;  1VF7 A;  2LO1 A;  5ITZ A;  5JCO C;  2ZE6 A;  1JX9 A;  3LUT B;  1IUR A;  4LF9 B;  3OT7 A;  5EC2 C;  4B3S O;  4DV7 O;  1KC8 W;  4P2Z A;  4KHP B;  5KHH A;  2HKO A;  1NH2 D;  5H6Q A;  1MG1 A;  1RPR A;  2P5O A;  3ABM C;  4FLX A;  4X1I B;  4JI0 O;  5IJ0 B;  3I5D A;  2YEV B;  2A9H A;  4NXM O;  1AR1 B;  1U97 A;  3RWR D;  3SJA C;  3FYI B;  1TVK A;  3A0R A;  4DW0 A;  4GX5 A;  2B5U A;  1VEW A;  2DE0 X;  4IT5 A;  1M5I A;  2DW4 A;  1OCC B;  2DN9 A;  1ROP A;  1GN6 A;  4I50 B;  3QO7 A;  4XDK A;  4TUY A;  2CUG A;  1KKC A;  1XL6 A;  2GBO A;  1KD1 W;  1VQP V;  4D7S A;  2ZR3 A;  3JAL B;  3T1Y O;  1RFY A;  4OPH A;  4TV8 B;  1N33 O;  2Q7E A;  5EIB D;  1FXK B;  5JJJ B;  1AP6 A;  5LA6 A;  3LSQ A;  1BHB A;  1N4C A;  5IYZ B;  1PNL A;  2UUC O;  1THZ A;  1TUB A;  4DR1 O;  1ZLZ A;  3L70 H;  3QNE A;  3ZRV A;  1WLE A;  2RN9 A;  4QIW F;  1G6U A;  5FPO A;  3ABT A;  3CWB H;  2EIN B;  2JGD A;  2H94 A;  5KX5 B;  4JYY A;  4KFM A;  4WFH A;  4MTO A;  3SYA A;  3ICX A;  2OT5 A;  3ZCC A;  2B1I A;  3GWK C;  3N27 A;  3ASN B;  2AZ0 A;  2ITC C;  4I9W A;  2HEP A;  3OM3 B;  2ITD C;  1SQB H;  3ZMV A;  4EKW A;  4UCV A;  2EIM C;  1G1X B;  1X4T A;  5KAF Z;  4UCT A;  1NI8 A;  2Q67 A;  2Y4T A;  3ZIA G;  4CC5 A;  5CA0 A;  1B6Q A;  3PN1 A;  4LC1 A;  1S5J A;  1TAE A;  2QWP B;  5IYC O;  2HHH O;  4TV9 B;  3ABL B;  1DTO A;  1PKX A;  2EIK C;  3G80 A;  4FZ0 A;  4U3F H;  3AG4 B;  3JAR A;  3MDS A;  4BIO A;  1FJG O;  4MVR A;  5KA5 A;  1VF6 C;  2DMX A;  2JS3 A;  2EIJ C;  3OGC C;  4UCS A;  1ZTE A;  2RNB A;  2Q0A A;  4O4H B;  3TXQ A;  4I7Z B;  1ZUQ A;  2QTO A;  4H13 B;  1MZE A;  4TUY B;  2R9R B;  2DYS B;  4B3T O;  4LF8 O;  4DR4 O;  1GM8 A;  3IFX A;  1CP9 A;  2ZM6 B;  2ETN A;  3D8C A;  2GDS A;  4H33 A;  3BAA A;  4ZOL A;  3HKC A;  2WLL A;  2LW7 A;  4ZI7 A;  4JYB A;  3ASO C;  3KG2 A;  3WG7 C;  4DV2 B;  1E1Q G;  1TUB B;  2GTA A;  2W0F C;  4O4I A;  4XBF A;  3OTO O;  2F43 G;  2YXL A;  3CCM V;  5J2T A;  2FL4 A;  1FFX B;  4DK0 A;  3EVK A;  3CHX A;  1ZL8 A;  3VOU A;  1GAX A;  1FYJ A;  4JTC B;  4MW8 A;  4CH4 A;  4UV9 A;  4I4T A;  5IWA B;  4MTF A;  2UXN A;  1K4C C;  4PA4 A;  5EBL C;  4DR2 B;  4QNH B;  1I94 O;  2A06 H;  2X7R B;  4OPA A;  3ZED A;  4J80 A;  2P06 A;  4Z1M G;  3E2E A;  4R50 A;  3CCE V;  3DTU B;  1HNX O;  1GTO A;  4U7O A;  4OGQ B;  3TET A;  4QE9 A;  1N0N A;  4DV0 O;  3K03 A;  3B8M A;  5H9C A;  2XT9 A;  4JI6 B;  4J42 A;  4J41 A;  5EBM C;  5LXT A;  5LMN B;  1M57 B;  3CCV V;  3CCJ V;  1VQO V;  2ILM A;  4JI3 B;  2QSA A;  3STL C;  3RYF A;  4P9O A;  4D6T H;  4LWS B;  4DR6 O;  5AG2 A;  2JS5 A;  1KBH A;  1A32 A;  4H37 A;  4AI8 A;  4PDM A;  3A2F A;  1RM1 C;  5CBG A;  1SA0 A;  3CE2 A;  4O2A A;  1KKD A;  2Y0P A;  4I0X A;  4K8X A;  2UU9 B;  4X1Y A;  1EN5 A;  1T5E A;  4PDR A;  4FJC C;  3M99 B;  4DUZ B;  5KHK A;  3IGA C;  4IIJ A;  1SZT A;  2E5L B;  3L74 H;  2UXC O;  2Q73 A;  2PGG A;  1SKV A;  4ZI7 B;  1Q82 W;  3CXC U;  3BRC A;  4TWK A;  4DYL A;  2HR3 A;  3L71 H;  2GHY A;  2EZO A;  2VQF B;  1HWY A;  2AZ2 A;  4UUJ C;  5D5Q A;  2VWK A;  3SPC A;  1OHH G;  3CC7 V;  3OE7 G;  1ZL8 B;  3E86 A;  1BGY H;  4GX1 A;  4UFZ A;  2QR4 A;  4FIP C;  2P4V A;  2W0X A;  1YXB A;  4PHZ A;  3G6B A;  3JD2 A;  3TXS A;  5DN6 G;  3OR6 C; 
#chains in the Genus database with same CATH homology
 4GUN A;  1WB8 A;  1BS3 A;  3KDR A;  1MMM A;  1LUW A;  2QKA A;  2QKC A;  1QNM A;  2CDY A;  1N0N A;  1BT8 A;  3RN4 A;  1LUV A;  1JR9 A;  1I0H A;  1IDS A;  5A9G A;  1PL4 A;  3K9S A;  1VEW A;  3MDS A;  3DC6 A;  1AR4 A;  1MA1 A;  1P7G A;  1AVM A;  3KKY A;  1Y67 A;  4X9Q A;  1XRE A;  1ZTE A;  1GN6 A;  1MSD A;  1GN3 A;  3DC5 A;  1IXB A;  3AK1 A;  1KKC A;  1ZUQ A;  5AG2 A;  1XDC A;  2P4K A;  1VAR A;  2RCV A;  3BFR A;  1EN6 A;  4F6E A;  3LSU A;  3TJT A;  1B06 A;  1WB7 A;  3C3S A;  1EN5 A;  3AK2 A;  1AR5 A;  2CE4 A;  1PM9 A;  1AP6 A;  1SZX A;  1MNG A;  1GN2 A;  1BSM A;  2GDS A;  1JA8 A;  2AW9 A;  1ZSP A;  1EM1 A;  4JZ2 A;  4YIP A;  1AP5 A;  1GN4 A;  1ZLZ A;  1N0J A;  3C3T A;  4FFK A;  4BR6 A;  1I08 A;  2ADP A;  1D5N A;  4JYY A;  3EVK A;  3CEI A;  3QVN A;  1XUQ A;  3IC9 A;  1EN4 A;  3AK3 A;  1IX9 A;  1XIL A;  4E4E A;  3OT7 A;  4C7U A;  2ADQ B;  4JZG A;  4YIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...