1LUVA

Catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Catalytic and structural effects of amino acid substitution at histidine 30 in human manganese superoxide dismutase: insertion of valine C gamma into the substrate access channel
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1luvA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1luvA02
1EN6A 2CE4A 1Y67A 1AP5A 4YIPA 2ADPA 1B06A 1ZSPA 1JR9A 3MDSA 4E4EA 4C7UA 1LUWA 4JYYA 4JZ2A 2QKAA 2P4KA 5AG2A 2QKCA 3C3SA 1MA1A 1IX9A 1AR4A 1QNMA 1VARA 1PM9A 1I0HA 1VEWA 4X9QA 1WB8A 4FFKA 1GN3A 3TJTA 1XDCA 1N0JA 1KKCA 1XREA 1MSDA 1N0NA 1P7GA 4F6EA 1ZLZA 1GN6A 3DC6A 3KKYA 3C3TA 1AP6A 3OT7A 1MMMA 1D5NA 1MNGA 3DC5A 3AK1A 4BR6A 1XILA 1ZTEA 2CDYA 2RCVA 1WB7A 4YIOA 4GUNA 1GN4A 3CEIA 1JA8A 1GN2A 3K9SA 2ADQB 1AVMA 3AK2A 3RN4A 1EN4A 1EN5A 2AW9A 1SZXA 1IXBA 1PL4A 3AK3A 1AR5A 3IC9A 4JZGA 1BT8A 1BSMA 2GDSA 1EM1A 1ZUQA 3QVNA 1LUVA 3EVKA 5A9GA 1IDSA 3BFRA 3LSUA 1XUQA 1BS3A 1I08A
chains in the Genus database with same CATH superfamily
3D36A 3CXCU 2ADPA 4DO2A 2PI5A 4PJ0Z 5LMUB 1XMQO 1BQ0A 2OCCB 2P6JA 2PF4E 4DR6B 1THZA 2GSMB 2AZ2A 1HNWO 3J81N 2E3CA 4NB5A 2Y48A 4TV8A 1N36O 5IY5B 4FFBA 4N21A 4O4JA 3AG3C 3KZIZ 2Q0OC 3OR7C 1YZBA 1RPRA 1WAZA 4K8XA 4JAAA 1SETA 1PNLA 2Z0AA 3N2GB 1QVFU 1IBLB 1MSDA 1COWG 3EFFK 1JOYA 4DV6O 1W0JG 3ZHVA 5ITZB 5KMGB 2DWEC 2E5LB 1Y4MA 1NR1A 2V7QG 2WLKA 1LNQA 3ABTA 5L3DA 4Z1MG 2Y0PA 2UXBO 4U7NA 1NTKH 2Q73A 3ICXA 4R50A 4RAIA 2DWDC 1N8RW 1VQ6V 1H8HG 3A0BZ 2LGQA 4J7ZA 1KP2A 1HNZO 1XNRO 1SQQH 1TUBB 4EFBA 2BSKB 4IL6Z 4UCSA 1HW7A 2V1DA 4JI5B 3JARB 4UB6Z 1M57B 3RYIB 5EBMC 5IJ9B 4MTGA 2PGGA 1AR5A 5IYDO 1JFFB 3CCVV 2QEXV 5JVDA 2EX3A 3H9VA 3K57A 2AHYA 1FXHA 1OCOC 3K0GA 4DYLA 4WFGA 5ITZA 2JGUA 5LMUO 3LNNA 1QLNA 2EULA 4JAVA 4LCUC 4R7CA 1ZWIC 4U3JA 4X1IA 3FX7A 4EFEA 4WFEA 5EYPB 1K3EA 5CB4B 1Q43A 4DR1B 1S3JA 2RNBA 1FFTB 1FXVA 2R9AA 3VQYA 4X64B 3F5WC 4LFCB 2BSKA 4MTFA 3NXSA 1SA0B 5JJEB 1IBLO 2WLMA 2AXTZ 3DC6A 4HYOA 4K3AA 5KAFZ 4LFAB 4D7TA 5F2VO 3P30A 1W0KG 4RUEA 5CA1B 1DF5A 2DQ0A 1OZ0A 3ETQA 1JFFA 3GWKC 4HNAA 1KMIZ 4LF4B 3RYCB 5B3SC 4DR2B 1VQOV 2YXYA 3UKMA 5D5QA 4G28B 5BMVA 4B3TB 1H2NA 1WJZA 1WB7A 4LNUB 2QWRB 4NR1A 2UXNA 3H1KH 2CGNA 2UUAO 3RYHA 3OGCC 3JATA 3LSQA 3OMAB 1K92A 4KUMA 3CHXA 5GONB 3SJAC 4UUJC 4WFHA 5EZYA 3JD4A 2YI9A 3F5TA 3JYCA 3CRCA 4CS3A 5DEDA 1ZUQA 3CJHA 3M99B 4ZI7B 3I56V 1J5EB 4RO2A 3W7WA 1I08A 2Q67A 2GUZA 3AG3B 2Y0IA 1SA0A 2F23A 1B06A 3JAKA 4LWSA 2VQFO 4O4IB 4J7JA 3JAWB 4AILC 1QR8A 3MAQA 2XAGA 1K8AW 5KUMA 1TVKB 1X4TA 5K1XA 4GZRB 4JV5B 5LXTB 4GX5A 2CAZC 2IJJA 3FD9A 1SQPH 2ZM6B 2JEXA 3AG4C 3GWOA 1NKDA 1BCCH 1VQ7V 4X1KB 1N0JA 3BCCH 4X64O 3ZHSA 2IJKA 2G38A 4CS2A 3JCUZ 4LFCO 2KSDA 1P7GA 4I9QA 4OPAA 5CBFA 1VF6C 2LQTA 2Y4UA 3AG1C 3RVZA 2YS8A 4GX0A 3OGIB 1R73A 3PJSK 4KL1A 1F23A 3BY6A 1QHTA 4FZ0A 2LW7A 4JAUA 4DR3B 1KECA 4LF4O 1XILA 4DR2O 4HBNA 2CGOA 2CTQA 4I9WA 1MG1A 4QE9A 4YIOA 4DW0A 4YHHB 1FPOA 2BOBC 2N74A 2UUCB 3APQA 1VMGA 2P06A 4LBEC 1NQTA 1TVKA 4KP4A 1NH2B 4X66O 3FAVA 3HKEA 3JALA 3KDRA 3IC9A 5H9CA 4FPPA 3ASOC 1N4CA 2DYRB 4AHCA 2UXDB 3ZMZA 4X1KA 5L3BA 3T1YB 3U0ZA 2ZDIC 3IGAC 2OTLV 1J5EO 4P9OA 1YHQV 5J2UB 1NBMG 4FK5C 4ASUG 2NR5A 4H33A 5KHHA 2EZOA 1Q6IA 4Q20A 3K04A 3BEHA 3B40A 4E2LA 2WA3A 5IT9N 1WNSA 2QKCA 1IX9A 3LNMB 5BXZA 1MZFA 1SRYA 4DUZB 1Q82W 5A2QN 1WA8A 4YJ2A 4QNHB 2ZM6O 2ZXWC 1US6A 3KG2A 1F4NA 1S5JA 2A06H 1I94B 3A8TA 3ASNC 1KU9A 3ZRWA 5GTIZ 1KKCA 2F95B 3AG2C 3X2QC 1CEZA 1YF2A 3CCMV 3TGUH 5KUKA 4FLXA 3OD4A 5B1AC 2WA4A 3SPJA 4EB6B 3L73H 3P32A 1F4MA 4JI8B 2JEUA 1OCZB 1ROPA 2JRIA 1Y6XA 1KKDA 1PV0A 2HVJC 2EIKB 3RYFB 2Q8VA 2WPDG 1ZL8A 2CTWA 2OCCC 3CCLV 2WWWA 4BIUA 1R6TA 2ZR3A 4ZIBA 2X0LA 2YIDA 5IY5C 2BE3A 1NTMH 4O4LA 2MK3A 4MW3A 4DV3B 3CEIA 4HZ3A 4TQFA 4YHHO 5LMNB 3SJBC 2UUCO 1R3IC 2AGAA 2Z5UA 3CMEV 5J9PC 2IH3C 1R6KA 1PL4A 2JDIG 1K4DC 1KUQA 3K79A 3HKCB 2VWKA 3JSLA 3WB1A 3ZRXA 4UV8A 1FXKB 1IDSA 3BFRA 2EINC 2UXDO 5FPOA 1H8EG 1F51A 3T1YO 3SYAA 2CE4A 2JJ1G 4BW5A 3AG4B 2YIAA 1UJWB 1AJPA 1VF5B 3QO5A 4LR3A 4JI2B 4X65B 5BR8B 1FD9A 4YJ3A 1SC5B 1YEWA 2GHYA 2HR3A 3SYOA 5KAIZ 1I7FA 3UO2A 3ZHQA 1KBHA 5L3CA 4GKJB 4DV0B 1XMOB 3AG1B 4DUZO 3K0DA 2ITDC 3TETA 1XHXA 1AILA 4MVUA 1Z5VA 2XNDG 1N32O 3SPHA 3QO8A 1RM1C 2WLIB 1I94O 4EKWA 2O57A 4PV1B 5K1PA 2E75B 5EIBC 5B5EZ 4FLZA 2HJDA 3OT7A 4ZHQB 1KP3A 3J80N 1K9MW 1H2SB 1XNQB 1NVPB 1F7YA 2KQXA 2KKWA 5IYCO 4FLYA 3ZCCA 1LR1A 3UT5A 4G2KA 4IIJA 4MVZA 3CC4V 1M93A 1WPXA 1AI7A 3MHSC 3FYEB 4P9PA 4X89A 4DV3O 4NXNB 2Y4TA 3BAAA 3CCUV 4PA6A 2N04A 4Z1VA 5GTHZ 2M6YA 4O2AA 2PYLA 1VF6A 4JZGA 2OCHA 1MOFA 1G4YB 1VF7A 4FM2A 1S72V 2L6LA 2Q0AA 1Y74B 1LUVA 3UO3A 4JI3B 4UCOA 1BS3A 2BTOA 5FNVB 3ZS8C 4I0XA 4YIPA 4PHZA 2ZXWB 1K73W 1CPYA 1QLEB 4PDRA 3WB2A 3LDCA 2DN9A 4TV9A 3APOA 4JI2O 4IYIA 4NXMB 1S5LZ 2E74B 4X65O 5BR8O 2CUGA 2FMLA 4L87A 5KX5B 2YI8A 5HFLA 1FOUA 3THOA 4CBCA 3WU2Z 2QE7G 3OR6C 1PM9A 1SZTA 4DV0O 2B1GA 5LHIA 1XMOO 3CCEV 4WFAV 4UCUA 3ABLB 4FLWA 1K7DA 5LA6A 4I50A 3HKDA 2ZDIA 1N0NA 3DSQA 2YEVA 4Z2WA 1P7BA 1Y76A 3C3TA 1AP6A 3E22B 3BVOA 2LP7A 3T1CA 5KA6A 1XL6A 3PN1A 1MMMA 1D5NA 4X88A 1K97A 3CRQA 4UVBA 3ZIAG 3SDLA 3UQ8A 3ZMVA 5JWPA 1XNQO 4H44B 2IU0A 3DXRA 1H2GA 4DV2O 5FNVA 2GTAA 2CDYA 4ZBMA 4OX9B 3F7VC 1RFYA 3BABA 5IDJA 2W6JG 2EILB 4LF7B 1S76D 3E8FA 2R70A 2EINB 5LYJB 4R8CA 4B3SB 4JPRA 1Q8IA 2ADQB 1JQ0A 3HKBB 3A0HZ 1XHZA 2ZCEA 2RQ6A 4NXNO 2AW9A 3SJCC 3WFVA 1N33B 2DYSB 3OUSA 3H01A 2L35A 3O65A 1BT8A 1XBLA 1EBOA 4ZOLB 1KD1W 4LFBB 5LGTA 1YTFB 3FB7C 3OTOB 4DR5B 1M5IA 5EC1C 2GBOA 1H38A 1U96A 3W7XA 1K5QA 3TXSA 1I5XA 5IYZB 5EC2C 1RM1B 5JQGB 1XI1A 5J2TB 4KHPB 2P4KA 5DM6V 2EIJC 4B3MB 1MA1A 1V9PA 2ZR2A 1MSWD 2UU9B 3GVMA 3N2GA 4NKGB 2ZE7A 5JJNB 4D6TH 5TISZ 4UCVA 4FZ1A 3M8AA 1SQGA 3OEEG 2W0XA 5KMGA 5LYJA 2UXCB 5LBQA 4DR7B 1JMKC 1TUEB 4P30A 2DYRC 1ZLZA 4JI1B 2BTQB 1MABG 2DJVA 4DR6O 4CH3A 4LF8B 2Q9LA 2B5UA 1W2BU 3D3QA 1L8DA 2HJFC 3ML0A 3JD2A 4Q6GA 4DRXB 3K3WA 3CCRV 5JJJB 1TUBA 1WN7A 5EBLC 4BIOA 5FLXN 3ETGA 3JARA 4QPKA 4AI8A 3RYIA 5IJ9A 2NN4A 2WLLB 5L3GA 1HDJA 3K9AA 2E5LO 1CP9A 2NLJC 3AEIA 2FKXA 2RN9A 3M7MX 4FLVA 3RGBA 1GTOA 1N33O 2ZKOA 2QWPB 1AROP 3QVNA 2QTSA 4B08A 1DLBA 2HHHB 3OTFA 4OGQB 1YCIA 1KC8W 4TQDA 4LFBO 1PP9H 4BWAA 5LOVB 4XDJA 1OCZC 5IE9A 1JCHA 3OTOO 2EIKC 4JI5O 1BE3H 4I55B 2VQEB 3Q4HB 3LDDA 3QO7A 3CD6V 1R6NA 5EYPA 2QWOB 4JZ2A 4X1YB 5CB4A 4JI6B 1S0VA 4J9YB 1QCEA 4B3MO 3JSNA 4KFMA 3OAAG 1FKAO 2UU9O 1WB8A 5IWAB 2FTKA 4DUYB 1L0LH 4ZKIA 2R9RB 4B3RB 1OCCC 5H6RA 1GO3F 1SKVA 5CA1A 3P3NA 4JI4B 2QJ1A 1BZKA 2UXCO 1FXKC 2K1EA 3BHPA 4JI1O 3L74H 1M56C 4O2BB 2LFSA 4N23A 3RYCA 4LF8O 4QPJA 3R65A 2ZE6A 4DR1O 1XL4A 4LNUA 2ZIOA 4GCZA 4J7KA 1PPJH 2OIGA 1PNKA 1ZAUA 5GONA 4LFAO 2D3OW 2PZSA 1VQMV 3ZMUA 4ZI7A 5B1OA 3W7UA 4R6ZA 1P84F 4PA9A 1VQ8V 1DTOA 3ZJZA 1Q7YW 4FLTA 5C8YB 2EIJB 1GRJA 3G80A 4B3TO 2HHHO 4UFZA 4O4IA 2OYQA 4A5UB 2JGDB 3I55V 3ZMSA 3JAWA 4B7EA 3RWRD 2V4DA 3SYQA 2IJHA 4PELA 5LHGA 3E8BA 5LXTA 2VQEO 1LUWA 5GW7A 3VOUA 3H1HH 1DF4A 4MVOA 3K5NA 4QGPA 4JI6O 2WSSG 4QIWF 1AR4A 1G6UA 4FJCC 3DTUB 4X9QA 2XAFA 2P4VA 2A7WA 1XDCA 2ZD9A 3CXHF 5IWAO 1HWYA 2YIBA 2W6IG 1ORQC 3N2KB 2A0LA 4B3RO 1O9HA 4X62B 1FFXB 1RPOA 4JI4O 4UCRA 3G71V 1H5WA 3ZX6A 3IJ4A 3W7TA 1NU1H 4JV5O 3CPWU 2Y69C 2C2AA 4RQFA 4DV5B 1Q90D 1QLEC 2WAMA 3A2FA 2GTSA 1E79G 2B9ZA 2QM8A 5JH7B 3FKSG 4GX2A 1WP8A 1GN2A 4ABMA 2IU3A 5E1AC 3RN4A 3SPGA 5L3FA 2QWNB 3ABLC 3TK1A 1TGOA 3AK3A 4K35A 3CX5F 3ZBHA 1VQ4V 3L72H 4DR3O 3W7SA 1OCRB 5J2UA 4PI0A 4G27B 3STLC 3U10A 2X6BA 1R3KC 1PD3A 1YDXA 1MZEA 2Q6AA 1Q5OA 2RMKB 3ABKB 3MDSA 4E4EA 4CH6A 3GB7C 2CK3G 2QGNA 4NVPA 1YI2V 5LGUA 2K9PA 2Q69A 2Q7GA 2R72A 1OCCB 1OV9A 2ITCC 3ZRSA 5KHIA 1H2KA 2EILC 4OXSA 2R9IA 3ZN1A 2JVDA 3CCQV 4J11A 2XHBA 1M56B 1VARA 1A32A 4X20B 2QM4A 1RSOB 2P90A 4O4HB 3K58A 4WBNB 4MTOA 3K5LA 1HR0B 4DK0A 3BRCA 1YXBA 2DYSC 2YSUB 1OJHA 4BIZA 4EB6A 4JI7B 4JI0B 3KKYA 3BPZA 4J41A 1NR7A 2A3QA 4LF5B 2HVKC 2WLJA 3RYFA 1HNXB 1SF9A 2ZQMA 3G6EV 3K5OA 3FFQA 3SPIA 2YXHA 4DV5O 2ZE5A 4LF6B 1MNGA 2JIZG 1PNMA 1EFRG 4DR4B 3JAMN 5CA0B 5B66Z 4LF9B 4I4TB 3JD3A 3B8NA 4J9ZB 2EIMB 4MVQA 3G4SV 3OEHG 2H8PC 1HP8A 4CZZA 1YVWA 4JI8O 2BCCH 3HKCA 3CCSV 2KG7B 4U7OA 4EEQA 1FXKA 1HNWB 2ZNIA 4UXNA 3KCYA 4PA3A 2CH7B 1IJGA 1GM7A 3DGEA 1WP7A 4DXWA 3RFRA 4JGSA 1N34B 1NVPD 1BQZA 3B2EE 1AI5A 2DW4A 1AJNA 3R66A 4F6RB 3CRRA 3K5MA 1AB3A 3SPCA 1GKFA 1ZSPA 1EZVH 1XQ8A 2KB1A 3FB8C 1J95A 5LMNO 1Q3EA 3E8GA 1NI8A 3BA9A 4JYYA 1P49A 3CYOA 1R3LC 3JD1A 3RVYA 4NTWA 3C3SA 1Q6UA 2LFRA 1JVMA 4AQYB 1IBKB 2PYJA 2WLIA 1VEWA 2Y69B 3LDEA 1U97A 4TV8B 3ETEA 4FFBB 3CC2V 3E83A 1SERA 3TJTA 2CTPA 1HR0O 4PA7A 2D2CB 4ZHQA 2HFEC 4CH4A 1GN6A 4J80A 1GMGA 3D3IA 4UB8Z 2QWQB 4WF9V 2KG7A 4JI0O 4XBFA 1QBZA 3SGIA 4XDLA 3WG7B 5KLVH 1G1XB 4GKJO 3E35A 3MD0A 4CH5A 4XDKA 4HAMA 2EJRA 4FM1A 1H2MA 1IURA 1R3JC 4TUYB 2JK5C 5B1BB 4WCEV 4LF6O 3JD0A 2RCVA 1K4CC 4GX1A 2A9HA 4H13B 4DR4O 2M7WA 5BY1A 4LF9O 2VS0A 5DN6G 4FLUA 3K9SA 1KQSU 3J7AU 1JJOA 4TT3G 3B8MA 2IBZH 2FYUH 1Y74A 5LHHA 3CMAV 3CS5A 1YIJV 4JYCA 1FYJA 4D7SA 2OIEA 5KHKA 1N34O 1Y67A 1IBMB 5JVDB 5FL7G 1BL8A 2HKOA 3OMNB 1JPXA 3ABMB 4JTDB 5KX5A 2OWOA 1R1BA 4NTXA 1GK9A 2P67A 3OFNG 4NTYA 4IT5A 2QKAA 1RP3B 4QJFB 1FS0G 2YDEA 1BHAA 4RQEA 4TUYA 3VBBA 1WPBA 4JTCB 5CMUA 1SS3A 5D5PA 4JI3O 4F4LA 4AQYO 2XOKG 1IBKO 3QF7A 4U3JB 4X1IB 1BHBA 1VP7A 3HR0A 3K06A 5LGNA 3P3PA 1JX9A 3E22A 3OM3B 1VQ9V 1V54C 4F6EA 5IYBO 2F43G 3EHBB 3K08A 4NXMO 1YTFD 3WB0A 2CTRA 2UUAB 4GYCB 1NJIW 3OUFA 1VQKV 4IGGA 2PY5A 3K03A 1PL0A 1SESA 3STZC 1UFIA 1V55C 2QR4A 4DV1B 1FAFA 3AK1A 1SQXH 2ZT9B 1O9GA 1ZTEA 2X7RB 5EIBD 3RBZA 4PD4F 3HKBA 4HNAB 4IHJB 1Q81W 5HFMA 1YITV 4FMTA 2DE0X 1B3QA 5BMVB 2VQFB 1SQFA 1FJGB 5LP6C 5BZBA 1M1KW 1EN4A 1EN5A 4ZOLA 2N05A 4TWKA 2Q5ZA 1SQBH 3CRMA 2YXLA 3RYHB 3ZEDA 1KYOF 3JATB 1BSMA 3H1IH 2GDSA 1IXMA 5H5NA 4LP8A 5A9GA 5EZYB 4OX9O 2PTMA 4LF7O 4WFBV 1K5SA 4MW8A 5IYZA 3CJHB 4FM0A 5JQGA 3AG7A 4B3SO 1PKXA 3RW0A 5J2TA 2QSAA 4ICGA 1IBMO 1X59A 4LH6A 2Z3YA 2GUZB 3SYPA 4H0LB 1W59A 3U11A 4PDVA 3JAKB 1NZ6A 4LWSB 3S3WA 1GM9A 4YY3B 1L1FA 4BW9A 4W4LA 1XOUA 1I0HA 3RT3C 3ZN0A 2ZE8A 4GLXA 5KHGA 2E76B 3TXQA 2BTQA 4DR5O 4IHJA 1E1RG 2DQ3A 4B7KA 1OCRC 3LSSA 2W0FC 2ZNJA 4KHPO 4DRXA 3FB6C 3CE2A 3ZHUA 1CXZB 1GH6A 4X66B 2AHZA 1BGYH 3T1HB 2XUMA 1AR1B 3ABKC 4RWUA 2F66C 2OT5A 2JS5A 2IJIA 3E89A 4DV1O 2QTOA 4BR6A 1IVSA 2WLLA 2DMXA 3HPLC 5DECA 4U3FH 5JCOC 1B6QA 4RUFA 4DR7O 1VQLV 3B4SA 2ARHA 2UUBB 2YUAA 1T5EA 4GUNA 1GN4A 3I5DA 2ZINA 3O9OA 4JYAB 4UVCA 1FJGO 2LO1A 5LL6Y 1S77D 1EM1A 2P7TC 2ODMA 2Q68A 3VQWA 5LOVA 4FVMA 3FAVB 3HKEB 4DW1A 3JALB 1EZJA 1G8MA 2NNUA 4I55A 3UCSC 3Q4HA 2H3OA 2F93B 4MVRA 4X1YA 2ETNA 5C93A 4TSFG 2LJ2A 3EXAA 5CA3A 2RJZA 3F7YC 4GKKB 4TOIA 5CN0A 2YIBD 3D8CA 1V54B 1Z5WA 5AG2A 2EIMC 3HB3B 3B09A 4W4KA 3C90A 3JASB 1YSCA 4YY3O 2VWJA 1M90W 2WLNA 5B1NA 2EBOA 1V55B 1ZX3A 1H2LA 1WA8B 3SR2C 4O2BA 4YJ2B 5E79Z 1XREA 3IAYA 2FL4A 4DV7B 1WLEA 2QKSA 4UCTA 5EK0A 3ZRWB 1VQNV 1NH2D 1K34A 2HLDG 4DV4B 1JJ2U 2ILMA 1OHHG 2LW1A 4IYHA 3OW2U 5LP6B 3T1HO 1OCOB 1E1QG 3CWBH 3D36C 1D5AA 4PDLA 3E2EA 3KCXA 5CBGA 3T4DA 4DUYO 1TAEA 3ZMTA 4CC6A 2IH1C 1ZL8B 2MW2B 1ENVA 4YXWG 2UUBO 1NTZH 3AK2A 2QDOA 3A0RA 4O4LB 2X6AA 4PA4A 3L9DA 5C8YA 4JYAO 4WFFA 2BOCC 3JASA 2JGDA 1JNBA 3E86A 3TCUA 4JTAB 4I5SA 2EZPA 2PUSA 3LSUA 1XUQA 4NYKA 3MHHC 3WG7C 2XAQA 1EN6A 3CP1A 2YICA 4PI2A 1N32B 3L75H 3CRAA 5B1BC 2YC0A 2ATKC 1K33A 3T4ZA 3QG5A 5B3SB 1AI6A 4GKKO 2Q7EA 5LP6A 4CC5A 2P22C 1Q6HA 1QNMA 4YJ3B 3B77A 3LUTB 4H37A 1BMFG 1UPGA 4MS2A 2AZ0A 3N2KA 4MSWC 2XAJA 5H6QA 1M9NA 1FFXA 2JJ2G 1DGSA 4OPHA 4K8ZA 2H94A 1QQCA 1NS1A 1AJQA 1Q86W 4DV7O 1YJ9V 3UM7A 3BA8A 2EJ7A 2UXXA 4I7ZB 3SYCA 4DV4O 2XASA 3ABMC 4BAYA 2XT9A 3QNEA 5JH7A 3CCJV 4KXRA 3DC5A 1L0NH 3QTCA 2WLHA 2OTJV 2P5OA 4K0KB 3FB5C 3S3XA 1QVGU 2DOSA 3FYIB 3ETDA 5KHJA 3UT5B 1SQVH 2PI4A 4IIJB 4X62O 3ZHTA 2FB5A 3G6BA 4JYBA 1JA8A 1NT2B 3IFXA 1QR9A 5EBWC 4MT8A 1AVMA 3IC7A 3N27A 1SZXA 1IXBA 4X8AA 1Y66A 3OMIB 1I5YA 4J42A 3CB2A 2F4VB 2XTAA 2IM9A 1VQ5V 2Q4PA 5IJ0B 4O2AB 3EVKA 4L8JA 3H1LH 1M4UA 5KA5A 4CS4A 1M57C 1AP5A 2HG5C 2LGWA 1YJWV 1XMQB 1JR9A 1TA8A 3H1JH 3T2MA 2Q7HA 5JCOA 4C7UA 4J10A 3VQVA 4I0XB 1N36B 4MTXA 4X20A 2QA4V 1RSOA 2RDCA 5H2FZ 1GM8A 4LC1A 2IW5A 4O4HA 4TV9B 4WBNA 3K59A 4PDMA 4JASA 2HEPA 4FFKA 2QM7A 1GN3A 4QE7A 3JCZA 4DV2B 2ZIMA 1Z2GA 3OE7G 1S5HC 4GT1A 3ASOB 4DV6B 4DK1A 3ABUA 4LH7A 1GAXA 5CBHA 5LA6B 4I50B 3HKDB 3L71H 1P4RA 1D2DA 2YEVB 2UXBB 3L70H 1AI4A 1Y76B 5CA0A 4UVAA 4P2ZA 1B04A 5IJ0A 4I4TA 4O4JB 4FIPC 5L3EA 4MVMA 1VQPV 3E8HA 1VIBA 3CC7V 1HNZB 1XNRB 3SJQC 4JI7O 2X6CA 2XAHA 3VQXA 2F1MA 2VRZA 3ZHRA 4K0KO 3DXRB 3ZRVA 2GV9A 1XEQA 1IZ3A 4LF5O 4MVSA 1QU7A 1HNXO 1KB9F 2HP8A 3CSXA 2CH7A 1URFA 4UV9A 3ASNB 1YJNV 2A79B 3NR7A 3AG2B 4JF3A 3X2QB 1DK1A 4F6RA 5FPRA 2F4VO 5B1AB 2B1IA 2JS3A 3G67A
chains in the Genus database with same CATH topology
1EN6A 2CE4A 1Y67A 1AP5A 4YIPA 2ADPA 1B06A 1ZSPA 1JR9A 3MDSA 4E4EA 4C7UA 1LUWA 4JYYA 4JZ2A 2QKAA 2P4KA 5AG2A 2QKCA 3C3SA 1MA1A 1IX9A 1AR4A 1QNMA 1VARA 1PM9A 1I0HA 1VEWA 4X9QA 1WB8A 4FFKA 1GN3A 3TJTA 1XDCA 1N0JA 1KKCA 1XREA 1MSDA 1N0NA 1P7GA 4F6EA 1ZLZA 1GN6A 3DC6A 3KKYA 3C3TA 1AP6A 3OT7A 1MMMA 1D5NA 1MNGA 3DC5A 3AK1A 4BR6A 1XILA 1ZTEA 2CDYA 2RCVA 1WB7A 4YIOA 4GUNA 1GN4A 3CEIA 1JA8A 1GN2A 3K9SA 2ADQB 1AVMA 3AK2A 3RN4A 1EN4A 1EN5A 2AW9A 1SZXA 1IXBA 3KDRA 1PL4A 3AK3A 1AR5A 3IC9A 4JZGA 1BT8A 1BSMA 2GDSA 1EM1A 1ZUQA 3QVNA 1LUVA 3EVKA 5A9GA 1IDSA 3BFRA 3LSUA 1XUQA 1BS3A 1I08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EN6 A;  2CE4 A;  1Y67 A;  1AP5 A;  4YIP A;  2ADP A;  1B06 A;  1ZSP A;  1JR9 A;  3MDS A;  4E4E A;  4C7U A;  1LUW A;  4JYY A;  4JZ2 A;  2QKA A;  2P4K A;  5AG2 A;  2QKC A;  3C3S A;  1MA1 A;  1IX9 A;  1AR4 A;  1QNM A;  1VAR A;  1PM9 A;  1I0H A;  1VEW A;  4X9Q A;  1WB8 A;  4FFK A;  1GN3 A;  3TJT A;  1XDC A;  1N0J A;  1KKC A;  1XRE A;  1MSD A;  1N0N A;  1P7G A;  4F6E A;  1ZLZ A;  1GN6 A;  3DC6 A;  3KKY A;  3C3T A;  1AP6 A;  3OT7 A;  1MMM A;  1D5N A;  1MNG A;  3DC5 A;  3AK1 A;  4BR6 A;  1XIL A;  1ZTE A;  2CDY A;  2RCV A;  1WB7 A;  4YIO A;  4GUN A;  1GN4 A;  3CEI A;  1JA8 A;  1GN2 A;  3K9S A;  2ADQ B;  1AVM A;  3AK2 A;  3RN4 A;  1EN4 A;  1EN5 A;  2AW9 A;  1SZX A;  1IXB A;  1PL4 A;  3AK3 A;  1AR5 A;  3IC9 A;  4JZG A;  1BT8 A;  1BSM A;  2GDS A;  1EM1 A;  1ZUQ A;  3QVN A;  1LUV A;  3EVK A;  5A9G A;  1IDS A;  3BFR A;  3LSU A;  1XUQ A;  1BS3 A;  1I08 A; 
#chains in the Genus database with same CATH topology
 3D36 A;  3CXC U;  2ADP A;  4DO2 A;  2PI5 A;  4PJ0 Z;  5LMU B;  1XMQ O;  1BQ0 A;  2OCC B;  2P6J A;  2PF4 E;  4DR6 B;  1THZ A;  2GSM B;  2AZ2 A;  1HNW O;  3J81 N;  2E3C A;  4NB5 A;  2Y48 A;  4TV8 A;  1N36 O;  5IY5 B;  4FFB A;  4N21 A;  4O4J A;  3AG3 C;  3KZI Z;  2Q0O C;  3OR7 C;  1YZB A;  1RPR A;  1WAZ A;  4K8X A;  4JAA A;  1SET A;  1PNL A;  2Z0A A;  3N2G B;  1QVF U;  1IBL B;  1MSD A;  1COW G;  3EFF K;  1JOY A;  4DV6 O;  1W0J G;  3ZHV A;  5ITZ B;  5KMG B;  2DWE C;  2E5L B;  1Y4M A;  1NR1 A;  2V7Q G;  2WLK A;  1LNQ A;  3ABT A;  5L3D A;  4Z1M G;  2Y0P A;  2UXB O;  4U7N A;  1NTK H;  2Q73 A;  3ICX A;  4R50 A;  4RAI A;  2DWD C;  1N8R W;  1VQ6 V;  1H8H G;  3A0B Z;  2LGQ A;  4J7Z A;  1KP2 A;  1HNZ O;  1XNR O;  1SQQ H;  1TUB B;  4EFB A;  2BSK B;  4IL6 Z;  4UCS A;  1HW7 A;  2V1D A;  4JI5 B;  3JAR B;  4UB6 Z;  1M57 B;  3RYI B;  5EBM C;  5IJ9 B;  4MTG A;  2PGG A;  1AR5 A;  5IYD O;  1JFF B;  3CCV V;  2QEX V;  5JVD A;  2EX3 A;  3H9V A;  3K57 A;  2AHY A;  1FXH A;  1OCO C;  3K0G A;  4DYL A;  4WFG A;  5ITZ A;  2JGU A;  5LMU O;  3LNN A;  1QLN A;  2EUL A;  4JAV A;  4LCU C;  4R7C A;  1ZWI C;  4U3J A;  4X1I A;  3FX7 A;  4EFE A;  4WFE A;  5EYP B;  1K3E A;  5CB4 B;  1Q43 A;  4DR1 B;  1S3J A;  2RNB A;  1FFT B;  1FXV A;  2R9A A;  3VQY A;  4X64 B;  3F5W C;  4LFC B;  2BSK A;  4MTF A;  3NXS A;  1SA0 B;  5JJE B;  1IBL O;  2WLM A;  2AXT Z;  3DC6 A;  4HYO A;  4K3A A;  5KAF Z;  4LFA B;  4D7T A;  5F2V O;  3P30 A;  1W0K G;  4RUE A;  5CA1 B;  1DF5 A;  2DQ0 A;  1OZ0 A;  3ETQ A;  1JFF A;  3GWK C;  4HNA A;  1KMI Z;  4LF4 B;  3RYC B;  5B3S C;  4DR2 B;  1VQO V;  2YXY A;  3UKM A;  5D5Q A;  4G28 B;  5BMV A;  4B3T B;  1H2N A;  1WJZ A;  1WB7 A;  4LNU B;  2QWR B;  4NR1 A;  2UXN A;  3H1K H;  2CGN A;  2UUA O;  3RYH A;  3OGC C;  3JAT A;  3LSQ A;  3OMA B;  1K92 A;  4KUM A;  3CHX A;  5GON B;  3SJA C;  4UUJ C;  4WFH A;  5EZY A;  3JD4 A;  2YI9 A;  3F5T A;  3JYC A;  3CRC A;  4CS3 A;  5DED A;  1ZUQ A;  3CJH A;  3M99 B;  4ZI7 B;  3I56 V;  1J5E B;  4RO2 A;  3W7W A;  1I08 A;  2Q67 A;  2GUZ A;  3AG3 B;  2Y0I A;  1SA0 A;  2F23 A;  1B06 A;  3JAK A;  4LWS A;  2VQF O;  4O4I B;  4J7J A;  3JAW B;  4AIL C;  1QR8 A;  3MAQ A;  2XAG A;  1K8A W;  5KUM A;  1TVK B;  1X4T A;  5K1X A;  4GZR B;  4JV5 B;  5LXT B;  4GX5 A;  2CAZ C;  2IJJ A;  3FD9 A;  1SQP H;  2ZM6 B;  2JEX A;  3AG4 C;  3GWO A;  1NKD A;  1BCC H;  1VQ7 V;  4X1K B;  1N0J A;  3BCC H;  4X64 O;  3ZHS A;  2IJK A;  2G38 A;  4CS2 A;  3JCU Z;  4LFC O;  2KSD A;  1P7G A;  4I9Q A;  4OPA A;  5CBF A;  1VF6 C;  2LQT A;  2Y4U A;  3AG1 C;  3RVZ A;  2YS8 A;  4GX0 A;  3OGI B;  1R73 A;  3PJS K;  4KL1 A;  1F23 A;  3BY6 A;  1QHT A;  4FZ0 A;  2LW7 A;  4JAU A;  4DR3 B;  1KEC A;  4LF4 O;  1XIL A;  4DR2 O;  4HBN A;  2CGO A;  2CTQ A;  4I9W A;  1MG1 A;  4QE9 A;  4YIO A;  4DW0 A;  4YHH B;  1FPO A;  2BOB C;  2N74 A;  2UUC B;  3APQ A;  1VMG A;  2P06 A;  4LBE C;  1NQT A;  1TVK A;  4KP4 A;  1NH2 B;  4X66 O;  3FAV A;  3HKE A;  3JAL A;  3KDR A;  3IC9 A;  5H9C A;  4FPP A;  3ASO C;  1N4C A;  2DYR B;  4AHC A;  2UXD B;  3ZMZ A;  4X1K A;  5L3B A;  3T1Y B;  3U0Z A;  2ZDI C;  3IGA C;  2OTL V;  1J5E O;  4P9O A;  1YHQ V;  5J2U B;  1NBM G;  4FK5 C;  4ASU G;  2NR5 A;  4H33 A;  5KHH A;  2EZO A;  1Q6I A;  4Q20 A;  3K04 A;  3BEH A;  3B40 A;  4E2L A;  2WA3 A;  5IT9 N;  1WNS A;  2QKC A;  1IX9 A;  3LNM B;  5BXZ A;  1MZF A;  1SRY A;  4DUZ B;  1Q82 W;  5A2Q N;  1WA8 A;  4YJ2 A;  4QNH B;  2ZM6 O;  2ZXW C;  1US6 A;  3KG2 A;  1F4N A;  1S5J A;  2A06 H;  1I94 B;  3A8T A;  3ASN C;  1KU9 A;  3ZRW A;  5GTI Z;  1KKC A;  2F95 B;  3AG2 C;  3X2Q C;  1CEZ A;  1YF2 A;  3CCM V;  3TGU H;  5KUK A;  4FLX A;  3OD4 A;  5B1A C;  2WA4 A;  3SPJ A;  4EB6 B;  3L73 H;  3P32 A;  1F4M A;  4JI8 B;  2JEU A;  1OCZ B;  1ROP A;  2JRI A;  1Y6X A;  1KKD A;  1PV0 A;  2HVJ C;  2EIK B;  3RYF B;  2Q8V A;  2WPD G;  1ZL8 A;  2CTW A;  2OCC C;  3CCL V;  2WWW A;  4BIU A;  1R6T A;  2ZR3 A;  4ZIB A;  2X0L A;  2YID A;  5IY5 C;  2BE3 A;  1NTM H;  4O4L A;  2MK3 A;  4MW3 A;  4DV3 B;  3CEI A;  4HZ3 A;  4TQF A;  4YHH O;  5LMN B;  3SJB C;  2UUC O;  1R3I C;  2AGA A;  2Z5U A;  3CME V;  5J9P C;  2IH3 C;  1R6K A;  1PL4 A;  2JDI G;  1K4D C;  1KUQ A;  3K79 A;  3HKC B;  2VWK A;  3JSL A;  3WB1 A;  3ZRX A;  4UV8 A;  1FXK B;  1IDS A;  3BFR A;  2EIN C;  2UXD O;  5FPO A;  1H8E G;  1F51 A;  3T1Y O;  3SYA A;  2CE4 A;  2JJ1 G;  4BW5 A;  3AG4 B;  2YIA A;  1UJW B;  1AJP A;  1VF5 B;  3QO5 A;  4LR3 A;  4JI2 B;  4X65 B;  5BR8 B;  1FD9 A;  4YJ3 A;  1SC5 B;  1YEW A;  2GHY A;  2HR3 A;  3SYO A;  5KAI Z;  1I7F A;  3UO2 A;  3ZHQ A;  1KBH A;  5L3C A;  4GKJ B;  4DV0 B;  1XMO B;  3AG1 B;  4DUZ O;  3K0D A;  2ITD C;  3TET A;  1XHX A;  1AIL A;  4MVU A;  1Z5V A;  2XND G;  1N32 O;  3SPH A;  3QO8 A;  1RM1 C;  2WLI B;  1I94 O;  4EKW A;  2O57 A;  4PV1 B;  5K1P A;  2E75 B;  5EIB C;  5B5E Z;  4FLZ A;  2HJD A;  3OT7 A;  4ZHQ B;  1KP3 A;  3J80 N;  1K9M W;  1H2S B;  1XNQ B;  1NVP B;  1F7Y A;  2KQX A;  2KKW A;  5IYC O;  4FLY A;  3ZCC A;  1LR1 A;  3UT5 A;  4G2K A;  4IIJ A;  4MVZ A;  3CC4 V;  1M93 A;  1WPX A;  1AI7 A;  3MHS C;  3FYE B;  4P9P A;  4X89 A;  4DV3 O;  4NXN B;  2Y4T A;  3BAA A;  3CCU V;  4PA6 A;  2N04 A;  4Z1V A;  5GTH Z;  2M6Y A;  4O2A A;  2PYL A;  1VF6 A;  4JZG A;  2OCH A;  1MOF A;  1G4Y B;  1VF7 A;  4FM2 A;  1S72 V;  2L6L A;  2Q0A A;  1Y74 B;  1LUV A;  3UO3 A;  4JI3 B;  4UCO A;  1BS3 A;  2BTO A;  5FNV B;  3ZS8 C;  4I0X A;  4YIP A;  4PHZ A;  2ZXW B;  1K73 W;  1CPY A;  1QLE B;  4PDR A;  3WB2 A;  3LDC A;  2DN9 A;  4TV9 A;  3APO A;  4JI2 O;  4IYI A;  4NXM B;  1S5L Z;  2E74 B;  4X65 O;  5BR8 O;  2CUG A;  2FML A;  4L87 A;  5KX5 B;  2YI8 A;  5HFL A;  1FOU A;  3THO A;  4CBC A;  3WU2 Z;  2QE7 G;  3OR6 C;  1PM9 A;  1SZT A;  4DV0 O;  2B1G A;  5LHI A;  1XMO O;  3CCE V;  4WFA V;  4UCU A;  3ABL B;  4FLW A;  1K7D A;  5LA6 A;  4I50 A;  3HKD A;  2ZDI A;  1N0N A;  3DSQ A;  2YEV A;  4Z2W A;  1P7B A;  1Y76 A;  3C3T A;  1AP6 A;  3E22 B;  3BVO A;  2LP7 A;  3T1C A;  5KA6 A;  1XL6 A;  3PN1 A;  1MMM A;  1D5N A;  4X88 A;  1K97 A;  3CRQ A;  4UVB A;  3ZIA G;  3SDL A;  3UQ8 A;  3ZMV A;  5JWP A;  1XNQ O;  4H44 B;  2IU0 A;  3DXR A;  1H2G A;  4DV2 O;  5FNV A;  2GTA A;  2CDY A;  4ZBM A;  4OX9 B;  3F7V C;  1RFY A;  3BAB A;  5IDJ A;  2W6J G;  2EIL B;  4LF7 B;  1S76 D;  3E8F A;  2R70 A;  2EIN B;  5LYJ B;  4R8C A;  4B3S B;  4JPR A;  1Q8I A;  2ADQ B;  1JQ0 A;  3HKB B;  3A0H Z;  1XHZ A;  2ZCE A;  2RQ6 A;  4NXN O;  2AW9 A;  3SJC C;  3WFV A;  1N33 B;  2DYS B;  3OUS A;  3H01 A;  2L35 A;  3O65 A;  1BT8 A;  1XBL A;  1EBO A;  4ZOL B;  1KD1 W;  4LFB B;  5LGT A;  1YTF B;  3FB7 C;  3OTO B;  4DR5 B;  1M5I A;  5EC1 C;  2GBO A;  1H38 A;  1U96 A;  3W7X A;  1K5Q A;  3TXS A;  1I5X A;  5IYZ B;  5EC2 C;  1RM1 B;  5JQG B;  1XI1 A;  5J2T B;  4KHP B;  2P4K A;  5DM6 V;  2EIJ C;  4B3M B;  1MA1 A;  1V9P A;  2ZR2 A;  1MSW D;  2UU9 B;  3GVM A;  3N2G A;  4NKG B;  2ZE7 A;  5JJN B;  4D6T H;  5TIS Z;  4UCV A;  4FZ1 A;  3M8A A;  1SQG A;  3OEE G;  2W0X A;  5KMG A;  5LYJ A;  2UXC B;  5LBQ A;  4DR7 B;  1JMK C;  1TUE B;  4P30 A;  2DYR C;  1ZLZ A;  4JI1 B;  2BTQ B;  1MAB G;  2DJV A;  4DR6 O;  4CH3 A;  4LF8 B;  2Q9L A;  2B5U A;  1W2B U;  3D3Q A;  1L8D A;  2HJF C;  3ML0 A;  3JD2 A;  4Q6G A;  4DRX B;  3K3W A;  3CCR V;  5JJJ B;  1TUB A;  1WN7 A;  5EBL C;  4BIO A;  5FLX N;  3ETG A;  3JAR A;  4QPK A;  4AI8 A;  3RYI A;  5IJ9 A;  2NN4 A;  2WLL B;  5L3G A;  1HDJ A;  3K9A A;  2E5L O;  1CP9 A;  2NLJ C;  3AEI A;  2FKX A;  2RN9 A;  3M7M X;  4FLV A;  3RGB A;  1GTO A;  1N33 O;  2ZKO A;  2QWP B;  1ARO P;  3QVN A;  2QTS A;  4B08 A;  1DLB A;  2HHH B;  3OTF A;  4OGQ B;  1YCI A;  1KC8 W;  4TQD A;  4LFB O;  1PP9 H;  4BWA A;  5LOV B;  4XDJ A;  1OCZ C;  5IE9 A;  1JCH A;  3OTO O;  2EIK C;  4JI5 O;  1BE3 H;  4I55 B;  2VQE B;  3Q4H B;  3LDD A;  3QO7 A;  3CD6 V;  1R6N A;  5EYP A;  2QWO B;  4JZ2 A;  4X1Y B;  5CB4 A;  4JI6 B;  1S0V A;  4J9Y B;  1QCE A;  4B3M O;  3JSN A;  4KFM A;  3OAA G;  1FKA O;  2UU9 O;  1WB8 A;  5IWA B;  2FTK A;  4DUY B;  1L0L H;  4ZKI A;  2R9R B;  4B3R B;  1OCC C;  5H6R A;  1GO3 F;  1SKV A;  5CA1 A;  3P3N A;  4JI4 B;  2QJ1 A;  1BZK A;  2UXC O;  1FXK C;  2K1E A;  3BHP A;  4JI1 O;  3L74 H;  1M56 C;  4O2B B;  2LFS A;  4N23 A;  3RYC A;  4LF8 O;  4QPJ A;  3R65 A;  2ZE6 A;  4DR1 O;  1XL4 A;  4LNU A;  2ZIO A;  4GCZ A;  4J7K A;  1PPJ H;  2OIG A;  1PNK A;  1ZAU A;  5GON A;  4LFA O;  2D3O W;  2PZS A;  1VQM V;  3ZMU A;  4ZI7 A;  5B1O A;  3W7U A;  4R6Z A;  1P84 F;  4PA9 A;  1VQ8 V;  1DTO A;  3ZJZ A;  1Q7Y W;  4FLT A;  5C8Y B;  2EIJ B;  1GRJ A;  3G80 A;  4B3T O;  2HHH O;  4UFZ A;  4O4I A;  2OYQ A;  4A5U B;  2JGD B;  3I55 V;  3ZMS A;  3JAW A;  4B7E A;  3RWR D;  2V4D A;  3SYQ A;  2IJH A;  4PEL A;  5LHG A;  3E8B A;  5LXT A;  2VQE O;  1LUW A;  5GW7 A;  3VOU A;  3H1H H;  1DF4 A;  4MVO A;  3K5N A;  4QGP A;  4JI6 O;  2WSS G;  4QIW F;  1AR4 A;  1G6U A;  4FJC C;  3DTU B;  4X9Q A;  2XAF A;  2P4V A;  2A7W A;  1XDC A;  2ZD9 A;  3CXH F;  5IWA O;  1HWY A;  2YIB A;  2W6I G;  1ORQ C;  3N2K B;  2A0L A;  4B3R O;  1O9H A;  4X62 B;  1FFX B;  1RPO A;  4JI4 O;  4UCR A;  3G71 V;  1H5W A;  3ZX6 A;  3IJ4 A;  3W7T A;  1NU1 H;  4JV5 O;  3CPW U;  2Y69 C;  2C2A A;  4RQF A;  4DV5 B;  1Q90 D;  1QLE C;  2WAM A;  3A2F A;  2GTS A;  1E79 G;  2B9Z A;  2QM8 A;  5JH7 B;  3FKS G;  4GX2 A;  1WP8 A;  1GN2 A;  4ABM A;  2IU3 A;  5E1A C;  3RN4 A;  3SPG A;  5L3F A;  2QWN B;  3ABL C;  3TK1 A;  1TGO A;  3AK3 A;  4K35 A;  3CX5 F;  3ZBH A;  1VQ4 V;  3L72 H;  4DR3 O;  3W7S A;  1OCR B;  5J2U A;  4PI0 A;  4G27 B;  3STL C;  3U10 A;  2X6B A;  1R3K C;  1PD3 A;  1YDX A;  1MZE A;  2Q6A A;  1Q5O A;  2RMK B;  3ABK B;  3MDS A;  4E4E A;  4CH6 A;  3GB7 C;  2CK3 G;  2QGN A;  4NVP A;  1YI2 V;  5LGU A;  2K9P A;  2Q69 A;  2Q7G A;  2R72 A;  1OCC B;  1OV9 A;  2ITC C;  3ZRS A;  5KHI A;  1H2K A;  2EIL C;  4OXS A;  2R9I A;  3ZN1 A;  2JVD A;  3CCQ V;  4J11 A;  2XHB A;  1M56 B;  1VAR A;  1A32 A;  4X20 B;  2QM4 A;  1RSO B;  2P90 A;  4O4H B;  3K58 A;  4WBN B;  4MTO A;  3K5L A;  1HR0 B;  4DK0 A;  3BRC A;  1YXB A;  2DYS C;  2YSU B;  1OJH A;  4BIZ A;  4EB6 A;  4JI7 B;  4JI0 B;  3KKY A;  3BPZ A;  4J41 A;  1NR7 A;  2A3Q A;  4LF5 B;  2HVK C;  2WLJ A;  3RYF A;  1HNX B;  1SF9 A;  2ZQM A;  3G6E V;  3K5O A;  3FFQ A;  3SPI A;  2YXH A;  4DV5 O;  2ZE5 A;  4LF6 B;  1MNG A;  2JIZ G;  1PNM A;  1EFR G;  4DR4 B;  3JAM N;  5CA0 B;  5B66 Z;  4LF9 B;  4I4T B;  3JD3 A;  3B8N A;  4J9Z B;  2EIM B;  4MVQ A;  3G4S V;  3OEH G;  2H8P C;  1HP8 A;  4CZZ A;  1YVW A;  4JI8 O;  2BCC H;  3HKC A;  3CCS V;  2KG7 B;  4U7O A;  4EEQ A;  1FXK A;  1HNW B;  2ZNI A;  4UXN A;  3KCY A;  4PA3 A;  2CH7 B;  1IJG A;  1GM7 A;  3DGE A;  1WP7 A;  4DXW A;  3RFR A;  4JGS A;  1N34 B;  1NVP D;  1BQZ A;  3B2E E;  1AI5 A;  2DW4 A;  1AJN A;  3R66 A;  4F6R B;  3CRR A;  3K5M A;  1AB3 A;  3SPC A;  1GKF A;  1ZSP A;  1EZV H;  1XQ8 A;  2KB1 A;  3FB8 C;  1J95 A;  5LMN O;  1Q3E A;  3E8G A;  1NI8 A;  3BA9 A;  4JYY A;  1P49 A;  3CYO A;  1R3L C;  3JD1 A;  3RVY A;  4NTW A;  3C3S A;  1Q6U A;  2LFR A;  1JVM A;  4AQY B;  1IBK B;  2PYJ A;  2WLI A;  1VEW A;  2Y69 B;  3LDE A;  1U97 A;  4TV8 B;  3ETE A;  4FFB B;  3CC2 V;  3E83 A;  1SER A;  3TJT A;  2CTP A;  1HR0 O;  4PA7 A;  2D2C B;  4ZHQ A;  2HFE C;  4CH4 A;  1GN6 A;  4J80 A;  1GMG A;  3D3I A;  4UB8 Z;  2QWQ B;  4WF9 V;  2KG7 A;  4JI0 O;  4XBF A;  1QBZ A;  3SGI A;  4XDL A;  3WG7 B;  5KLV H;  1G1X B;  4GKJ O;  3E35 A;  3MD0 A;  4CH5 A;  4XDK A;  4HAM A;  2EJR A;  4FM1 A;  1H2M A;  1IUR A;  1R3J C;  4TUY B;  2JK5 C;  5B1B B;  4WCE V;  4LF6 O;  3JD0 A;  2RCV A;  1K4C C;  4GX1 A;  2A9H A;  4H13 B;  4DR4 O;  2M7W A;  5BY1 A;  4LF9 O;  2VS0 A;  5DN6 G;  4FLU A;  3K9S A;  1KQS U;  3J7A U;  1JJO A;  4TT3 G;  3B8M A;  2IBZ H;  2FYU H;  1Y74 A;  5LHH A;  3CMA V;  3CS5 A;  1YIJ V;  4JYC A;  1FYJ A;  4D7S A;  2OIE A;  5KHK A;  1N34 O;  1Y67 A;  1IBM B;  5JVD B;  5FL7 G;  1BL8 A;  2HKO A;  3OMN B;  1JPX A;  3ABM B;  4JTD B;  5KX5 A;  2OWO A;  1R1B A;  4NTX A;  1GK9 A;  2P67 A;  3OFN G;  4NTY A;  4IT5 A;  2QKA A;  1RP3 B;  4QJF B;  1FS0 G;  2YDE A;  1BHA A;  4RQE A;  4TUY A;  3VBB A;  1WPB A;  4JTC B;  5CMU A;  1SS3 A;  5D5P A;  4JI3 O;  4F4L A;  4AQY O;  2XOK G;  1IBK O;  3QF7 A;  4U3J B;  4X1I B;  1BHB A;  1VP7 A;  3HR0 A;  3K06 A;  5LGN A;  3P3P A;  1JX9 A;  3E22 A;  3OM3 B;  1VQ9 V;  1V54 C;  4F6E A;  5IYB O;  2F43 G;  3EHB B;  3K08 A;  4NXM O;  1YTF D;  3WB0 A;  2CTR A;  2UUA B;  4GYC B;  1NJI W;  3OUF A;  1VQK V;  4IGG A;  2PY5 A;  3K03 A;  1PL0 A;  1SES A;  3STZ C;  1UFI A;  1V55 C;  2QR4 A;  4DV1 B;  1FAF A;  3AK1 A;  1SQX H;  2ZT9 B;  1O9G A;  1ZTE A;  2X7R B;  5EIB D;  3RBZ A;  4PD4 F;  3HKB A;  4HNA B;  4IHJ B;  1Q81 W;  5HFM A;  1YIT V;  4FMT A;  2DE0 X;  1B3Q A;  5BMV B;  2VQF B;  1SQF A;  1FJG B;  5LP6 C;  5BZB A;  1M1K W;  1EN4 A;  1EN5 A;  4ZOL A;  2N05 A;  4TWK A;  2Q5Z A;  1SQB H;  3CRM A;  2YXL A;  3RYH B;  3ZED A;  1KYO F;  3JAT B;  1BSM A;  3H1I H;  2GDS A;  1IXM A;  5H5N A;  4LP8 A;  5A9G A;  5EZY B;  4OX9 O;  2PTM A;  4LF7 O;  4WFB V;  1K5S A;  4MW8 A;  5IYZ A;  3CJH B;  4FM0 A;  5JQG A;  3AG7 A;  4B3S O;  1PKX A;  3RW0 A;  5J2T A;  2QSA A;  4ICG A;  1IBM O;  1X59 A;  4LH6 A;  2Z3Y A;  2GUZ B;  3SYP A;  4H0L B;  1W59 A;  3U11 A;  4PDV A;  3JAK B;  1NZ6 A;  4LWS B;  3S3W A;  1GM9 A;  4YY3 B;  1L1F A;  4BW9 A;  4W4L A;  1XOU A;  1I0H A;  3RT3 C;  3ZN0 A;  2ZE8 A;  4GLX A;  5KHG A;  2E76 B;  3TXQ A;  2BTQ A;  4DR5 O;  4IHJ A;  1E1R G;  2DQ3 A;  4B7K A;  1OCR C;  3LSS A;  2W0F C;  2ZNJ A;  4KHP O;  4DRX A;  3FB6 C;  3CE2 A;  3ZHU A;  1CXZ B;  1GH6 A;  4X66 B;  2AHZ A;  1BGY H;  3T1H B;  2XUM A;  1AR1 B;  3ABK C;  4RWU A;  2F66 C;  2OT5 A;  2JS5 A;  2IJI A;  3E89 A;  4DV1 O;  2QTO A;  4BR6 A;  1IVS A;  2WLL A;  2DMX A;  3HPL C;  5DEC A;  4U3F H;  5JCO C;  1B6Q A;  4RUF A;  4DR7 O;  1VQL V;  3B4S A;  2ARH A;  2UUB B;  2YUA A;  1T5E A;  4GUN A;  1GN4 A;  3I5D A;  2ZIN A;  3O9O A;  4JYA B;  4UVC A;  1FJG O;  2LO1 A;  5LL6 Y;  1S77 D;  1EM1 A;  2P7T C;  2ODM A;  2Q68 A;  3VQW A;  5LOV A;  4FVM A;  3FAV B;  3HKE B;  4DW1 A;  3JAL B;  1EZJ A;  1G8M A;  2NNU A;  4I55 A;  3UCS C;  3Q4H A;  2H3O A;  2F93 B;  4MVR A;  4X1Y A;  2ETN A;  5C93 A;  4TSF G;  2LJ2 A;  3EXA A;  5CA3 A;  2RJZ A;  3F7Y C;  4GKK B;  4TOI A;  5CN0 A;  2YIB D;  3D8C A;  1V54 B;  1Z5W A;  5AG2 A;  2EIM C;  3HB3 B;  3B09 A;  4W4K A;  3C90 A;  3JAS B;  1YSC A;  4YY3 O;  2VWJ A;  1M90 W;  2WLN A;  5B1N A;  2EBO A;  1V55 B;  1ZX3 A;  1H2L A;  1WA8 B;  3SR2 C;  4O2B A;  4YJ2 B;  5E79 Z;  1XRE A;  3IAY A;  2FL4 A;  4DV7 B;  1WLE A;  2QKS A;  4UCT A;  5EK0 A;  3ZRW B;  1VQN V;  1NH2 D;  1K34 A;  2HLD G;  4DV4 B;  1JJ2 U;  2ILM A;  1OHH G;  2LW1 A;  4IYH A;  3OW2 U;  5LP6 B;  3T1H O;  1OCO B;  1E1Q G;  3CWB H;  3D36 C;  1D5A A;  4PDL A;  3E2E A;  3KCX A;  5CBG A;  3T4D A;  4DUY O;  1TAE A;  3ZMT A;  4CC6 A;  2IH1 C;  1ZL8 B;  2MW2 B;  1ENV A;  4YXW G;  2UUB O;  1NTZ H;  3AK2 A;  2QDO A;  3A0R A;  4O4L B;  2X6A A;  4PA4 A;  3L9D A;  5C8Y A;  4JYA O;  4WFF A;  2BOC C;  3JAS A;  2JGD A;  1JNB A;  3E86 A;  3TCU A;  4JTA B;  4I5S A;  2EZP A;  2PUS A;  3LSU A;  1XUQ A;  4NYK A;  3MHH C;  3WG7 C;  2XAQ A;  1EN6 A;  3CP1 A;  2YIC A;  4PI2 A;  1N32 B;  3L75 H;  3CRA A;  5B1B C;  2YC0 A;  2ATK C;  1K33 A;  3T4Z A;  3QG5 A;  5B3S B;  1AI6 A;  4GKK O;  2Q7E A;  5LP6 A;  4CC5 A;  2P22 C;  1Q6H A;  1QNM A;  4YJ3 B;  3B77 A;  3LUT B;  4H37 A;  1BMF G;  1UPG A;  4MS2 A;  2AZ0 A;  3N2K A;  4MSW C;  2XAJ A;  5H6Q A;  1M9N A;  1FFX A;  2JJ2 G;  1DGS A;  4OPH A;  4K8Z A;  2H94 A;  1QQC A;  1NS1 A;  1AJQ A;  1Q86 W;  4DV7 O;  1YJ9 V;  3UM7 A;  3BA8 A;  2EJ7 A;  2UXX A;  4I7Z B;  3SYC A;  4DV4 O;  2XAS A;  3ABM C;  4BAY A;  2XT9 A;  3QNE A;  5JH7 A;  3CCJ V;  4KXR A;  3DC5 A;  1L0N H;  3QTC A;  2WLH A;  2OTJ V;  2P5O A;  4K0K B;  3FB5 C;  3S3X A;  1QVG U;  2DOS A;  3FYI B;  3ETD A;  5KHJ A;  3UT5 B;  1SQV H;  2PI4 A;  4IIJ B;  4X62 O;  3ZHT A;  2FB5 A;  3G6B A;  4JYB A;  1JA8 A;  1NT2 B;  3IFX A;  1QR9 A;  5EBW C;  4MT8 A;  1AVM A;  3IC7 A;  3N27 A;  1SZX A;  1IXB A;  4X8A A;  1Y66 A;  3OMI B;  1I5Y A;  4J42 A;  3CB2 A;  2F4V B;  2XTA A;  2IM9 A;  1VQ5 V;  2Q4P A;  5IJ0 B;  4O2A B;  3EVK A;  4L8J A;  3H1L H;  1M4U A;  5KA5 A;  4CS4 A;  1M57 C;  1AP5 A;  2HG5 C;  2LGW A;  1YJW V;  1XMQ B;  1JR9 A;  1TA8 A;  3H1J H;  3T2M A;  2Q7H A;  5JCO A;  4C7U A;  4J10 A;  3VQV A;  4I0X B;  1N36 B;  4MTX A;  4X20 A;  2QA4 V;  1RSO A;  2RDC A;  5H2F Z;  1GM8 A;  4LC1 A;  2IW5 A;  4O4H A;  4TV9 B;  4WBN A;  3K59 A;  4PDM A;  4JAS A;  2HEP A;  4FFK A;  2QM7 A;  1GN3 A;  4QE7 A;  3JCZ A;  4DV2 B;  2ZIM A;  1Z2G A;  3OE7 G;  1S5H C;  4GT1 A;  3ASO B;  4DV6 B;  4DK1 A;  3ABU A;  4LH7 A;  1GAX A;  5CBH A;  5LA6 B;  4I50 B;  3HKD B;  3L71 H;  1P4R A;  1D2D A;  2YEV B;  2UXB B;  3L70 H;  1AI4 A;  1Y76 B;  5CA0 A;  4UVA A;  4P2Z A;  1B04 A;  5IJ0 A;  4I4T A;  4O4J B;  4FIP C;  5L3E A;  4MVM A;  1VQP V;  3E8H A;  1VIB A;  3CC7 V;  1HNZ B;  1XNR B;  3SJQ C;  4JI7 O;  2X6C A;  2XAH A;  3VQX A;  2F1M A;  2VRZ A;  3ZHR A;  4K0K O;  3DXR B;  3ZRV A;  2GV9 A;  1XEQ A;  1IZ3 A;  4LF5 O;  4MVS A;  1QU7 A;  1HNX O;  1KB9 F;  2HP8 A;  3CSX A;  2CH7 A;  1URF A;  4UV9 A;  3ASN B;  1YJN V;  2A79 B;  3NR7 A;  3AG2 B;  4JF3 A;  3X2Q B;  1DK1 A;  4F6R A;  5FPR A;  2F4V O;  5B1A B;  2B1I A;  2JS3 A;  3G67 A; 
#chains in the Genus database with same CATH homology
 1EN6 A;  2CE4 A;  1Y67 A;  1AP5 A;  4YIP A;  2ADP A;  1B06 A;  1ZSP A;  1JR9 A;  3MDS A;  4E4E A;  4C7U A;  1LUW A;  4JYY A;  4JZ2 A;  2QKA A;  2P4K A;  5AG2 A;  2QKC A;  3C3S A;  1MA1 A;  1IX9 A;  1AR4 A;  1QNM A;  1VAR A;  1PM9 A;  1I0H A;  1VEW A;  4X9Q A;  1WB8 A;  4FFK A;  1GN3 A;  3TJT A;  1XDC A;  1N0J A;  1KKC A;  1XRE A;  1MSD A;  1N0N A;  1P7G A;  4F6E A;  1ZLZ A;  1GN6 A;  3DC6 A;  3KKY A;  3C3T A;  1AP6 A;  3OT7 A;  1MMM A;  1D5N A;  1MNG A;  3DC5 A;  3AK1 A;  4BR6 A;  1XIL A;  1ZTE A;  2CDY A;  2RCV A;  1WB7 A;  4YIO A;  4GUN A;  1GN4 A;  3CEI A;  1JA8 A;  1GN2 A;  3K9S A;  2ADQ B;  1AVM A;  3AK2 A;  3RN4 A;  1EN4 A;  1EN5 A;  2AW9 A;  1SZX A;  1IXB A;  3KDR A;  1PL4 A;  3AK3 A;  1AR5 A;  3IC9 A;  4JZG A;  1BT8 A;  1BSM A;  2GDS A;  1EM1 A;  1ZUQ A;  3QVN A;  1LUV A;  3EVK A;  5A9G A;  1IDS A;  3BFR A;  3LSU A;  1XUQ A;  1BS3 A;  1I08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...