3QVNA

Crystal structure of cytosolic mnsod3 from candida albicans
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
MITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVKLDYFKAIWNVINWAEAESRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Manganese-containing superoxide dismutase
publication title Comparison of two yeast MnSODs: mitochondrial Saccharomyces cerevisiae versus cytosolic Candida albicans.
pubmed doi rcsb
source organism Candida albicans
molecule tags Oxidoreductase
total genus 73
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3qvnA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3qvnA02
1MNGA 1PM9A 3AK1A 1BSMA 2AW9A 1BS3A 3AK2A 1Y67A 1JA8A 3C3SA 4JYYA 3IC9A 4GUNA 1ZLZA 1AR5A 1LUVA 1XDCA 2CE4A 1D5NA 1KKCA 1I08A 2GDSA 3KKYA 4FFKA 1ZSPA 1GN6A 1GN2A 1PL4A 5AG2A 1XREA 4BR6A 3LSUA 2QKCA 1XUQA 1WB8A 4JZ2A 4F6EA 3DC5A 2RCVA 1MSDA 1IXBA 1MA1A 3DC6A 1EN4A 1AVMA 2P4KA 1BT8A 1WB7A 4YIOA 1GN3A 3C3TA 2ADPA 3MDSA 1JR9A 4JZGA 3QVNA 4YIPA 3EVKA 1GN4A 3BFRA 1I0HA 3RN4A 1EN6A 2ADQB 1SZXA 1IX9A 1ZTEA 1QNMA 1EM1A 2QKAA 1N0JA 1LUWA 1AP5A 3OT7A 1IDSA 1VARA 1B06A 3AK3A 1VEWA 1N0NA 4E4EA 5A9GA 3K9SA 3CEIA 1EN5A 1AR4A 4X9QA 2CDYA 1AP6A 4C7UA 3TJTA 1MMMA 1ZUQA 1P7GA 1XILA
chains in the Genus database with same CATH superfamily
3MHHC 5H9CA 4BWAA 4IHJA 1Y4MA 1GTOA 2WPDG 3ZMUA 4DUZO 2D2CB 1HP8A 5CBFA 3JD2A 4WFAV 1MSWD 2E5LO 4WF9V 1OJHA 5BY1A 2ZE5A 4FM2A 5C8YB 5FPOA 2NR5A 2OCCB 3H9VA 2Q68A 4AI8A 1OZ0A 2E3CA 2N04A 4JAVA 3DXRA 4X88A 3RVZA 4PDRA 1M93A 1XHXA 1MZEA 3Q4HA 1W0KG 1P7BA 2CTRA 2XT9A 4B3RO 1NI8A 2X7RB 2HKOA 5IJ9A 2Q0AA 3EFFK 4JI4O 1EN4A 2QE7G 4UV9A 1COWG 1NR1A 1TVKB 4DR7B 2E76B 4DR5B 4J11A 3K59A 1Q6UA 5LOVB 3MAQA 2WLHA 1MG1A 2QR4A 3SGIA 1MABG 5LMNO 5J2UA 5B66Z 5A2QN 4K0KO 3ZHRA 5L3CA 2IH1C 2C2AA 1EFRG 1R6KA 1K97A 2ZINA 2WLIA 4K3AA 5CB4A 1XNRB 1VQ5V 4W4LA 5H6QA 1RFYA 5KMGA 4YY3B 2UXNA 4NTWA 2ARHA 3K03A 1CXZB 3BPZA 3FFQA 2WWWA 4X1IB 1M56C 1XEQA 1S5JA 1OCZB 3O65A 1HW7A 4PD4F 2VQEB 5LXTA 4JI8O 1Q5OA 1YTFB 2F43G 2UUBB 2Y4TA 5L3FA 2IM9A 2CTQA 4B3TO 2CE4A 3W7SA 2YIDA 3AG2B 1H5WA 5EZYB 3OEHG 1I94B 2EX3A 1ORQC 3I55V 1FPOA 1VQMV 4J80A 4MTGA 1K73W 3G6BA 3OAAG 3RYHB 1YXBA 3GVMA 3I5DA 3K58A 1KMIZ 4DXWA 1K7DA 3K3WA 1DLBA 3EHBB 2DYRB 3ZRWA 5FLXN 4NR1A 4HYOA 1WB7A 5IWAB 3DTUB 3CCLV 2XAHA 1S5LZ 2B1GA 4AILC 3L74H 1JR9A 1QBZA 4TQFA 1Y66A 2GSMB 2YC0A 3BFRA 1Q7YW 3ZHUA 1N33B 4LFBB 1NVPD 1YHQV 5L3EA 3K5NA 3ASNC 3JCZA 1ZTEA 4DR4B 3THOA 5C93A 3CRAA 4X20A 3EXAA 4X1YB 5L3BA 2UXBO 2ZXWC 4DV7O 2XUMA 3K06A 2OYQA 5A9GA 2P22C 2CH7B 1RSOB 2IBZH 2PF4E 3LDEA 3CRCA 1YI2V 2BOBC 3H1IH 1VQPV 1F4NA 5KX5A 2EILB 1L1FA 3JARA 4B08A 3JSLA 4DV4O 1I5XA 2JRIA 5E79Z 5GONB 3BVOA 2DQ0A 2JGDA 3KCXA 5CBHA 5KA5A 1KQSU 3CWBH 2Y69C 2ZXWB 5K1XA 4DR6O 1JJOA 1SETA 2XHBA 1G1XB 4X65B 2GDSA 3ZS8C 2QM7A 4B3SB 1SA0B 2YI9A 1PL4A 1M57C 1NH2D 1XREA 2QKCA 3W7TA 2B1IA 2Q7GA 4JI5B 1S0VA 3B2EE 3ABUA 4TV9B 2P5OA 4YHHO 1H8EG 1KC8W 3VBBA 1F4MA 4MT8A 4J42A 1THZA 5GW7A 4GX1A 2PTMA 4LFCO 2BCCH 1Z2GA 4YIOA 1SC5B 1UJWB 2Y69B 3L70H 3JCUZ 1QHTA 1IXMA 5JVDA 1Q8IA 3JYCA 3ABTA 3ZN1A 3SYAA 3M99B 4JZGA 5CBGA 4YIPA 1VF7A 3KCYA 1KKDA 3CPWU 4FIPC 2VWKA 1AILA 1M57B 4DV1B 1TUEB 3T4ZA 1Q81W 3QNEA 4X1YA 3IC7A 2QWQB 4NXNO 1PKXA 4B3MO 4Z1MG 2Q69A 3TGUH 3B77A 5BR8B 4DR3B 3APOA 1AI4A 2X6AA 2IW5A 1AJPA 4E4EA 1AB3A 1SESA 1OCOB 4KL1A 3TXSA 1TUBA 1WA8A 1AR4A 2Y48A 1Y76B 3HKDB 2V7QG 4XDJA 5IJ0A 4G2KA 1XILA 2ZNJA 2H8PC 2OT5A 4ZI7A 1H2NA 2OWOA 4JI2B 1FXKC 3OE7G 5LA6B 1GM9A 3JASB 1Q90D 4PDMA 1Q3EA 4LF9B 3OGCC 3T1YO 3ABLB 2JEUA 2ZNIA 5AG2A 5L3DA 1N32O 2NN4A 4LNUA 1XUQA 2ITCC 4BIUA 2IJJA 4NTXA 1ZWIC 4YXWG 2BTOA 1S5HC 1FXKB 3ETQA 1VMGA 3ABMC 2KKWA 3ML0A 3UO2A 3CS5A 5IE9A 2YIBD 4A5UB 3T1HO 2GV9A 1XMQB 5ITZA 2YUAA 5FNVA 3MDSA 1NR7A 4WCEV 4W4KA 4GX2A 2GUZB 4FZ0A 1AI6A 4I0XA 5FL7G 4UCRA 2OTLV 4MSWC 2QKAA 1N0JA 3K5MA 5KHKA 5LGUA 4RQEA 3RW0A 3QO7A 4PI2A 2Q9LA 4DV0O 3CC7V 1M9NA 4UVBA 1VF6C 4JAUA 4ZHQB 4X64B 4WBNB 3ETGA 5JCOC 4I50B 1PNMA 4O4IB 2VQFB 3LNMB 1K4DC 4UUJC 2ZIMA 1NTMH 2GTSA 1ZUQA 1E79G 1XMOB 5LA6A 3K9AA 4ZBMA 1Q86W 3OTFA 4JTCB 1HNXB 5J9PC 1CP9A 3ZHTA 1WAZA 2ITDC 3ABKC 3LDCA 1NU1H 1LR1A 1RPOA 5B3SC 2WSSG 1H2KA 1JFFA 2BSKA 1ZSPA 2E75B 2QWNB 3L75H 2HLDG 2YIBA 4JZ2A 4OGQB 4FLVA 2K9PA 2EIKC 4TUYB 4JI7B 1V54B 1D2DA 1V55C 2LFRA 4DUYO 1FXKA 2VWJA 3CX5F 1AVMA 1SQFA 3SPCA 4GKKB 3UCSC 3CCJV 4PA3A 5B1BC 1N4CA 5IYDO 1NTZH 3DXRB 3G6EV 4J7JA 5B3SB 4QPKA 2UUAB 1QCEA 1QU7A 5KUKA 2GUZA 1QLEB 4Z2WA 5IYZA 3EVKA 5LGNA 3HPLC 4H33A 1IBKO 5BZBA 1X59A 3P3NA 3ZRXA 3SJAC 1YZBA 1Q82W 1IX9A 2CGOA 2HVJC 4FK5C 1EM1A 5CA0A 4ZHQA 5J2TA 2YS8A 2DYSB 3RFRA 1R6NA 1AI7A 1R3IC 5F2VO 3FYEB 5LMUB 3AK3A 2ETNA 2QSAA 3H01A 4WFBV 5J2UB 2UXDB 2NNUA 4O4IA 2VS0A 4BW9A 3UT5A 3KDRA 1YVWA 2UXBB 5IT9N 4DO2A 4I5SA 1BSMA 4JI3B 1VQ4V 1HNWB 4CC5A 2UXCB 1Y67A 2WLIB 3ZMZA 1KYOF 3B40A 2JEXA 1VF6A 3ZHSA 4PHZA 1OCRC 5DM6V 4DV5O 1JQ0A 1N34B 1DTOA 4JI1O 5JCOA 4LFAB 1RPRA 4RUEA 4X62B 4DV4B 3H1LH 4ZIBA 1YJNV 4NXMO 2PYLA 1NBMG 3AG3B 2EBOA 1GK9A 3E8BA 1RP3B 2WA3A 1RM1B 1GM8A 4TUYA 1HNZB 2WLKA 3E35A 2WLLA 1NJIW 2BOCC 2ODMA 1WPXA 1XL6A 3QO5A 4QPJA 5LXTB 1V9PA 2JIZG 1FFXB 4UVAA 4LWSA 5GTIZ 2QWRB 5JH7B 4PDVA 2DQ3A 1L0NH 1GN3A 1K5QA 4ASUG 3CMEV 2LO1A 1SKVA 2EIJC 3AG1C 2RJZA 2ZDIC 4DV6B 3K04A 5EIBC 3ETDA 2CTWA 2JVDA 1M1KW 2B5UA 1XNQO 1Q6IA 3VOUA 4R8CA 1HR0O 3JAWA 4CBCA 4RQFA 1GO3F 4J7ZA 3ZRWB 4JI0B 2FL4A 4PV1B 4FFBA 2Q7EA 1TAEA 1OCCC 1R3KC 3FYIB 4OX9O 2UU9O 4GYCB 5BXZA 2EIJB 4B3MB 3H1HH 3P3PA 1FJGO 1Q6HA 2ATKC 4X20B 2HHHO 5EC2C 2AHYA 1U96A 2JJ2G 4CH6A 2IJIA 2A79B 3SJQC 4YJ2A 3SR2C 4UB6Z 5EIBD 3WU2Z 1N8RW 3X2QC 1NZ6A 4DV3O 2M7WA 4LF4O 4LF8B 4CH4A 1NQTA 3MHSC 2JDIG 3ASOC 5KX5B 1N36B 2KQXA 3JARB 4F6EA 2LW7A 5IDJA 3G4SV 2DMXA 1FFXA 3OW2U 4X66O 1PL0A 2JGDB 5JH7A 3CRMA 1VQOV 4IL6Z 5EBLC 1ZAUA 4RWUA 4AQYB 3FB8C 4KUMA 4J10A 2K1EA 3A2FA 3CYOA 1M56B 2KG7B 3CXHF 5DN6G 3ZCCA 4HAMA 3X2QB 5EBMC 2ZE6A 3SJBC 3T2MA 4BIOA 2LW1A 3CCSV 2HEPA 2JS5A 1QNMA 1NVPB 1AP5A 1PNKA 4HNAA 2Y0PA 4JI6O 4JV5O 3RYCA 2XOKG 3KZIZ 3JD4A 1SQXH 5JQGB 5JVDB 1OHHG 3UO3A 2LFSA 3G67A 3NR7A 4NVPA 2F93B 1KB9F 2ZDIA 4JAAA 3BABA 2QEXV 1GRJA 4C7UA 2F4VO 1J5EB 3CC4V 1IURA 3SPHA 1XHZA 4LF5B 1FD9A 2FKXA 4LC1A 5DEDA 1JA8A 3RT3C 1BGYH 3ZIAG 4DR2B 3G71V 1HWYA 4CS3A 1TUBB 1WA8B 3KKYA 3BA9A 5IJ0B 5KLVH 4P30A 2KB1A 4UV8A 1YF2A 4IGGA 1NH2B 3ASNB 3VQVA 4ZI7B 2QM8A 3CB2A 4D7TA 4JYAO 2QWPB 5H2FZ 3ZHQA 1M90W 3D8CA 3UKMA 2Z0AA 3CMAV 1WP7A 4LF6B 3WFVA 1VQ9V 4IYIA 4TOIA 2R9IA 3ZRVA 4DW0A 2KG7A 1PPJH 1B6QA 1I5YA 2WAMA 3HKBA 1JCHA 4FPPA 1US6A 4DUYB 4LNUB 3BRCA 2H3OA 5L3GA 4BIZA 2PYJA 1SZXA 1YDXA 2LJ2A 1Y6XA 4TT3G 3K79A 1G4YB 1LUWA 2WLNA 2YXLA 3OT7A 4O4JB 4BW5A 1VARA 1B06A 4DR1B 5JQGA 2CK3G 1CEZA 2W6IG 5ITZB 5FNVB 1IBMB 5K1PA 1M5IA 1DGSA 4PA9A 5KUMA 3CCRV 4PA6A 2QA4V 1AP6A 4MW3A 2OIGA 3TK1A 4IYHA 4DR7O 4DR5O 1ROPA 4I0XB 3GWKC 3SDLA 2Q0OC 2RDCA 2G38A 4DW1A 4ZOLA 1Y74B 1H38A 2QGNA 3SYCA 3LUTB 3OTOO 5IY5C 3A0HZ 3WB0A 3IC9A 1K8AW 5DECA 1XDCA 3N2KB 4ICGA 3U11A 4U3JA 2IU0A 4DV2B 1R6TA 3E8HA 4JYBA 2LP7A 1XNRO 3AG4C 2ZKOA 4MS2A 1BHBA 4EEQA 4WFFA 4YY3O 3SPGA 5IYBO 2UUCO 2ZM6B 3JATB 1I7FA 4QIWF 5CN0A 5CA1A 1IBLB 4GKJB 4JI1B 1T5EA 1Q43A 1XOUA 1BT8A 3IAYA 4NXMB 4X89A 1GKFA 3LSQA 5IY5B 4DUZB 1VQLV 1JFFB 2BSKB 1KECA 4QJFB 1WN7A 3I56V 2GTAA 5LHIA 3N27A 4NYKA 4IIJB 2E5LB 4KHPO 1AJQA 3H1JH 3L73H 2VQEO 1GMGA 1AROP 1BZKA 5B1OA 1P49A 2UUBO 2P67A 4O2BB 3CCUV 2IJHA 3B4SA 2DN9A 4O4JA 1B3QA 2F1MA 2XAFA 1YITV 1O9HA 5FPRA 1MZFA 4B3RB 1I94O 4O4LB 2AZ2A 3WG7C 3TCUA 3S3XA 2ZQMA 4UVCA 1R3JC 3GB7C 2ZE7A 1H2SB 3ZMTA 4JI4B 2YSUB 4JYCA 1U97A 4EB6A 5EYPA 5IYZB 2V4DA 1J95A 2Q67A 4UCUA 4LF7O 1Y74A 3IFXA 5IWAO 4F6RA 3LNNA 5LMNB 5CA0B 2XASA 4UB8Z 3P32A 1YJWV 2CAZC 5J2TB 2Y0IA 4X8AA 3PJSK 3N2KA 1S72V 4I4TA 3ABMB 4K0KB 1ZLZA 4UXNA 3QO8A 5LP6C 2MW2B 1N33O 4LR3A 4LFBO 2CUGA 4K8ZA 4DR4O 4Z1VA 1K3EA 2AXTZ 3UT5B 5KHGA 2OCHA 2YXYA 4UCTA 2QKSA 1JX9A 3LSUA 3JATA 2GBOA 3DC5A 3K5LA 5B5EZ 1BQ0A 2ZR2A 2R70A 1CPYA 3DC6A 1BE3H 3TXQA 3M8AA 1KD1W 1AR1B 5KHHA 4FJCC 3J81N 2PY5A 2W0XA 5LP6B 2EJ7A 4P9PA 2DE0X 4IIJA 1Z5VA 3A0BZ 3N2GA 3FKSG 4JI8B 1XBLA 1L0LH 3K08A 1GN4A 4O2BA 1KP2A 5EC1C 1I0HA 4FLTA 4R7CA 4B3TB 2WLLB 1TGOA 4R6ZA 2OTJV 3T1CA 2YDEA 2A3QA 3VQWA 3E8GA 3P30A 2W6JG 2EJRA 3L9DA 3JAKA 4X65O 5CA3A 4O4LA 3BEHA 4B3SO 3ABKB 4LWSB 5LBQA 4JF3A 2JS3A 1WJZA 2EIMC 2PZSA 2W0FC 3U0ZA 1X4TA 2IJKA 2WA4A 4JI5O 2X0LA 5KHJA 3BAAA 4PA7A 2L35A 3ZEDA 2P6JA 4X9QA 3CCQV 4LH6A 3K0DA 2ZD9A 2EIKB 4H44B 1V55B 3CJHA 4B7EA 3JAWB 2FYUH 2FTKA 1H2MA 1NKDA 3OUSA 4DRXB 2D3OW 4Q6GA 4XDLA 1AR5A 2X6BA 2Q4PA 4FFBB 5B1BB 2P7TC 4HBNA 4LCUC 4DV1O 4FLWA 1D5NA 1I08A 4O4HA 2F4VB 5JWPA 1XQ8A 4QNHB 3JALB 1F23A 1GN2A 4JTDB 2PUSA 4DV7B 4PJ0Z 1SQBH 2F95B 3K5OA 3E83A 2PGGA 5BR8O 5LYJB 4DR3O 3E89A 1BCCH 4FM0A 4LP8A 2EULA 1FS0G 4J9ZB 5JJNB 2L6LA 5LP6A 4UCVA 4YJ2B 2XNDG 3G80A 4UFZA 2BTQA 3CCMV 3M7MX 2OCCC 2LGWA 3CRQA 3QTCA 4CS2A 1VIBA 3W7UA 4I9WA 3W7WA 3CCVV 1SQGA 1YSCA 3K57A 3BCCH 1VQKV 1VQ7V 2VRZA 4DR6B 3ZX6A 1S76D 4LF9O 4FLXA 2DWDC 3OD4A 1W0JG 3C90A 1OCRB 4TSFG 3OMNB 2AHZA 2H94A 1N0NA 4YHHB 3ZMSA 4CC6A 4MW8A 2R9RB 2AZ0A 1ZL8A 2GHYA 4JGSA 4LFCB 3HKEA 5KAFZ 3WB1A 1SQQH 2YI8A 2AW9A 4DRXA 4JASA 1A32A 4D6TH 4HNAB 4H37A 4ABMA 1XMQO 4E2LA 5LGTA 3SPIA 1Z5WA 3L71H 2HJFC 3RYCB 3FD9A 4AHCA 4GCZA 1R1BA 3JSNA 4TV8A 4J7KA 3UM7A 4UCSA 3JALA 3LDDA 4NXNB 3AG1B 1K5SA 2M6YA 1VQ8V 4FFKA 1FKAO 1E1RG 1GN6A 3RYIA 4QE7A 5LYJA 1IJGA 4G27B 3OTOB 2Z3YA 3NXSA 2HP8A 4CH5A 2Q5ZA 5LHGA 4FZ1A 3OMIB 4X64O 4NTYA 3VQYA 1JMKC 1OCZC 4MTFA 3E22A 3CRRA 2P4KA 4U3FH 2Z5UA 2LQTA 1VP7A 1DK1A 4PELA 2VQFO 4EFEA 1OCCB 4CZZA 1FYJA 2A7WA 1XMOO 1VQ6V 2IH3C 1AI5A 2P4VA 5KA6A 3AG2C 3JD3A 2IU3A 3F5TA 3QF7A 2UUCB 2RQ6A 1AJNA 1WP8A 1ZX3A 2DWEC 1SQVH 4LBEC 1R73A 1HNXO 4GX5A 3T1YB 4FMTA 3IJ4A 1N32B 4J41A 3OR6C 4KHPB 1NTKH 4XBFA 3SPJA 2DYRC 2R72A 5C8YA 1PP9H 3ZJZA 2WLJA 3J80N 3HKBB 4JI7O 3ICXA 2A0LA 3CEIA 4K35A 3ASOB 1XI1A 1EZJA 2RCVA 4OXSA 1MNGA 1PM9A 5EK0A 3CD6V 4GKKO 3T1HB 2EZOA 3AK2A 1YTFD 4NB5A 4UCOA 1JVMA 3CXCU 4JYYA 2UUAO 1UFIA 3OEEG 4KP4A 1P84F 1TVKA 5BMVB 4K8XA 3OMAB 2HFEC 4FVMA 1KKCA 5LOVA 4FLUA 3STLC 3K0GA 4LF7B 1G6UA 4U7OA 4DV0B 2CTPA 2F66C 1YCIA 3SYPA 1KP3A 2XAJA 3FB6C 2YEVB 1MSDA 4ZOLB 5LMUO 3FAVB 4P9OA 2EILC 4B7KA 3ZRSA 1BL8A 4DK0A 2DJVA 2UXDO 4NKGB 2ZT9B 2P90A 3STZC 2YXHA 2FB5A 1EZVH 3C3TA 4MVRA 2ADPA 3RYFB 4MVUA 4JI3O 1HNWO 2WLMA 4U3JB 1PV0A 4D7SA 2XTAA 2UXCO 5B1AC 4X1IA 1QR8A 2NLJC 1WPBA 5H6RA 3D3QA 3RN4A 1EN6A 3QG5A 4HZ3A 3SYQA 1D5AA 1K4CC 3R66A 1S77D 2Q6AA 5CA1B 3E8FA 1N34O 4LFAO 2HG5C 4X62O 1P4RA 3JAMN 1FOUA 1VQNV 1HNZO 3HB3B 1G8MA 4TWKA 5EZYA 1DF4A 1EN5A 1XL4A 4DK1A 1BQZA 5B1AB 5E1AC 3TJTA 2E74B 3PN1A 3OR7C 2ZE8A 1LNQA 3RYHA 4OPAA 1H2GA 3C3SA 2JK5C 5BMVA 3B8NA 3RVYA 3GWOA 1IBKB 1VF5B 4DV6O 3LSSA 2QM4A 3MD0A 3CCEV 3CSXA 2JJ1G 3AG7A 3ZHVA 3A8TA 4EB6B 5EYPB 2Q73A 4CH3A 1MOFA 1OCOC 3HKCB 2FMLA 3D36C 2YEVA 5D5PA 2O57A 3FAVA 1WB8A 4JI0O 1OV9A 4RO2A 5TISZ 4F6RB 5LL6Y 3KG2A 1JPXA 1QQCA 3CHXA 4U7NA 3E2EA 2JGUA 4KFMA 1MA1A 2XAQA 3RGBA 4I4TB 2P06A 2EINC 3RYFA 4LH7A 4MVOA 2KSDA 3UQ8A 2DOSA 3TETA 1K9MW 2QTOA 5GTHZ 1BHAA 3ABLC 3ETEA 1FXHA 4H0LB 1W2BU 2CH7A 4QE9A 1RSOA 4GT1A 4N23A 4DV5B 4O2AB 2OIEA 4L8JA 2HR3A 1K92A 4MVMA 4RUFA 2YICA 5GONA 4RAIA 3SJCC 3R65A 1DF5A 4EKWA 4LF8O 3U10A 3BY6A 4EFBA 2EINB 2Q8VA 1SERA 1NT2B 1N36O 2Q7HA 3N2GB 3JD0A 4FLYA 3K9SA 4P2ZA 1F51A 1H8HG 3WB2A 1SA0A 2CDYA 2Y4UA 4PA4A 3AG4B 2QTSA 3CE2A 4G28B 3ZN0A 5H5NA 1E1QG 1MMMA 1P7GA 1S3JA 3B8MA 1IVSA 3AK1A 4AQYO 2MK3A 3JAKB 4TV9A 1JNBA 1BS3A 5CMUA 3B09A 4GLXA 2LGQA 2A9HA 4PI0A 1PD3A 5KHIA 3OUFA 1LUVA 1XNQB 5IYCO 2EZPA 4MVQA 1HR0B 5EBWC 2BE3A 4WFHA 3SYOA 1R3LC 3HKCA 4N21A 2QJ1A 4BR6A 1BMFG 3ZMVA 4I9QA 4I7ZB 4H13B 3CJHB 2F23A 1GAXA 2B9ZA 4OX9B 5D5QA 2UU9B 2AGAA 1JOYA 4MVSA 3F5WC 3WG7B 1H2LA 1FJGB 2ZIOA 4F4LA 2UXXA 1PNLA 1B04A 2PI5A 2RNBA 3FX7A 4O4HB 2HHHB 1J5EO 3L72H 3HR0A 4GX0A 1QR9A 4LF5O 1HDJA 3IGAC 1EBOA 1KU9A 3FB7C 3D36A 3QVNA 4O2AA 1QVFU 3J7AU 3E86A 2QDOA 1Y76A 3D3IA 4I55B 3HKDA 2PI4A 2RMKB 3F7VC 1YEWA 4DR2O 5JJJB 1WNSA 1V54C 3H1KH 4DV3B 4LF4B 3O9OA 2XAGA 5HFMA 1GM7A 4FM1A 3JASA 1IDSA 3S3WA 3CP1A 1SRYA 2BTQB 4J9YB 3VQXA 5JJEB 4X66B 1KBHA 4MTOA 4X1KB 2YIAA 1QLEC 4LF6O 1FXVA 3APQA 4FLZA 3ZBHA 4YJ3B 1ENVA 4IHJB 1TA8A 3OGIB 4GUNA 5HFLA 3W7XA 2HJDA 2DYSC 4TQDA 2X6CA 1L8DA 1SF9A 1YIJV 1SZTA 4JTAB 4GZRB 1IZ3A 2V1DA 2DW4A 5LHHA 1ZL8B 1NS1A 4ZKIA 3HKEB 1SQPH 4JI6B 4JV5B 1FFTB 1K33A 3Q4HB 3RWRD 4DR1O 4BAYA 1SS3A 1QVGU 3DGEA 1O9GA 1IXBA 2ZCEA 3FB5C 1F7YA 3BA8A 5IJ9B 1IBMO 4Q20A 3A0RA 2EIMB 4TV8B 1K34A 3JD1A 1GH6A 1URFA 4WBNA 4CS4A 2ZR3A 3F7YC 4PDLA 3RBZA 2HVKC 1WLEA 4I55A 4I50A 4OPHA 3RYIB 4JPRA 4R50A 4L87A 4DYLA 1M4UA 3AG3C 2QWOB 1RM1C 2ILMA 1YJ9V 4MVZA 2ADQB 3CC2V 1QLNA 3AEIA 3E22B 2N05A 2R9AA 3T4DA 1KUQA 2RN9A 4KXRA 2CGNA 4DV2O 1JJ2U 4MTXA 3OM3B 4IT5A 2N74A 5B1NA 5CB4B 4X1KA 1VEWA 4JYAB 1UPGA 5KMGB 5KAIZ 4JI2O 1FAFA 3OFNG 2ZM6O 2A06H 4QGPA 1W59A 4WFEA 1IBLO 4GKJO 4WFGA 3BHPA 4XDKA 3DSQA 4YJ3A
chains in the Genus database with same CATH topology
1MNGA 1PM9A 3AK1A 1BSMA 2AW9A 1BS3A 3AK2A 1Y67A 1JA8A 3C3SA 4JYYA 3IC9A 4GUNA 1ZLZA 1AR5A 1LUVA 1XDCA 2CE4A 1D5NA 1KKCA 1I08A 2GDSA 3KKYA 4FFKA 1ZSPA 1GN6A 1GN2A 1PL4A 5AG2A 1XREA 4BR6A 3LSUA 2QKCA 1XUQA 1WB8A 4JZ2A 4F6EA 3DC5A 2RCVA 1MSDA 1IXBA 1MA1A 3DC6A 1EN4A 1AVMA 2P4KA 1BT8A 1WB7A 4YIOA 1GN3A 3C3TA 2ADPA 3MDSA 1JR9A 4JZGA 3QVNA 4YIPA 3EVKA 1GN4A 3BFRA 1I0HA 3RN4A 1EN6A 2ADQB 1SZXA 1IX9A 1ZTEA 1QNMA 1EM1A 2QKAA 1N0JA 1LUWA 1AP5A 3OT7A 1IDSA 1VARA 1B06A 3AK3A 1VEWA 1N0NA 4E4EA 5A9GA 3K9SA 3CEIA 1EN5A 1AR4A 4X9QA 2CDYA 1AP6A 4C7UA 3KDRA 3TJTA 1MMMA 1ZUQA 1P7GA 1XILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MNG A;  1PM9 A;  3AK1 A;  1BSM A;  2AW9 A;  1BS3 A;  3AK2 A;  1Y67 A;  1JA8 A;  3C3S A;  4JYY A;  3IC9 A;  4GUN A;  1ZLZ A;  1AR5 A;  1LUV A;  1XDC A;  2CE4 A;  1D5N A;  1KKC A;  1I08 A;  2GDS A;  3KKY A;  4FFK A;  1ZSP A;  1GN6 A;  1GN2 A;  1PL4 A;  5AG2 A;  1XRE A;  4BR6 A;  3LSU A;  2QKC A;  1XUQ A;  1WB8 A;  4JZ2 A;  4F6E A;  3DC5 A;  2RCV A;  1MSD A;  1IXB A;  1MA1 A;  3DC6 A;  1EN4 A;  1AVM A;  2P4K A;  1BT8 A;  1WB7 A;  4YIO A;  1GN3 A;  3C3T A;  2ADP A;  3MDS A;  1JR9 A;  4JZG A;  3QVN A;  4YIP A;  3EVK A;  1GN4 A;  3BFR A;  1I0H A;  3RN4 A;  1EN6 A;  2ADQ B;  1SZX A;  1IX9 A;  1ZTE A;  1QNM A;  1EM1 A;  2QKA A;  1N0J A;  1LUW A;  1AP5 A;  3OT7 A;  1IDS A;  1VAR A;  1B06 A;  3AK3 A;  1VEW A;  1N0N A;  4E4E A;  5A9G A;  3K9S A;  3CEI A;  1EN5 A;  1AR4 A;  4X9Q A;  2CDY A;  1AP6 A;  4C7U A;  3TJT A;  1MMM A;  1ZUQ A;  1P7G A;  1XIL A; 
#chains in the Genus database with same CATH topology
 3MHH C;  5H9C A;  4BWA A;  4IHJ A;  1Y4M A;  1GTO A;  2WPD G;  3ZMU A;  4DUZ O;  2D2C B;  1HP8 A;  5CBF A;  3JD2 A;  4WFA V;  1MSW D;  2E5L O;  4WF9 V;  1OJH A;  5BY1 A;  2ZE5 A;  4FM2 A;  5C8Y B;  5FPO A;  2NR5 A;  2OCC B;  3H9V A;  2Q68 A;  4AI8 A;  1OZ0 A;  2E3C A;  2N04 A;  4JAV A;  3DXR A;  4X88 A;  3RVZ A;  4PDR A;  1M93 A;  1XHX A;  1MZE A;  3Q4H A;  1W0K G;  1P7B A;  2CTR A;  2XT9 A;  4B3R O;  1NI8 A;  2X7R B;  2HKO A;  5IJ9 A;  2Q0A A;  3EFF K;  4JI4 O;  1EN4 A;  2QE7 G;  4UV9 A;  1COW G;  1NR1 A;  1TVK B;  4DR7 B;  2E76 B;  4DR5 B;  4J11 A;  3K59 A;  1Q6U A;  5LOV B;  3MAQ A;  2WLH A;  1MG1 A;  2QR4 A;  3SGI A;  1MAB G;  5LMN O;  5J2U A;  5B66 Z;  5A2Q N;  4K0K O;  3ZHR A;  5L3C A;  2IH1 C;  2C2A A;  1EFR G;  1R6K A;  1K97 A;  2ZIN A;  2WLI A;  4K3A A;  5CB4 A;  1XNR B;  1VQ5 V;  4W4L A;  5H6Q A;  1RFY A;  5KMG A;  4YY3 B;  2UXN A;  4NTW A;  2ARH A;  3K03 A;  1CXZ B;  3BPZ A;  3FFQ A;  2WWW A;  4X1I B;  1M56 C;  1XEQ A;  1S5J A;  1OCZ B;  3O65 A;  1HW7 A;  4PD4 F;  2VQE B;  5LXT A;  4JI8 O;  1Q5O A;  1YTF B;  2F43 G;  2UUB B;  2Y4T A;  5L3F A;  2IM9 A;  2CTQ A;  4B3T O;  2CE4 A;  3W7S A;  2YID A;  3AG2 B;  1H5W A;  5EZY B;  3OEH G;  1I94 B;  2EX3 A;  1ORQ C;  3I55 V;  1FPO A;  1VQM V;  4J80 A;  4MTG A;  1K73 W;  3G6B A;  3OAA G;  3RYH B;  1YXB A;  3GVM A;  3I5D A;  3K58 A;  1KMI Z;  4DXW A;  1K7D A;  3K3W A;  1DLB A;  3EHB B;  2DYR B;  3ZRW A;  5FLX N;  4NR1 A;  4HYO A;  1WB7 A;  5IWA B;  3DTU B;  3CCL V;  2XAH A;  1S5L Z;  2B1G A;  4AIL C;  3L74 H;  1JR9 A;  1QBZ A;  4TQF A;  1Y66 A;  2GSM B;  2YC0 A;  3BFR A;  1Q7Y W;  3ZHU A;  1N33 B;  4LFB B;  1NVP D;  1YHQ V;  5L3E A;  3K5N A;  3ASN C;  3JCZ A;  1ZTE A;  4DR4 B;  3THO A;  5C93 A;  3CRA A;  4X20 A;  3EXA A;  4X1Y B;  5L3B A;  2UXB O;  2ZXW C;  4DV7 O;  2XUM A;  3K06 A;  2OYQ A;  5A9G A;  2P22 C;  2CH7 B;  1RSO B;  2IBZ H;  2PF4 E;  3LDE A;  3CRC A;  1YI2 V;  2BOB C;  3H1I H;  1VQP V;  1F4N A;  5KX5 A;  2EIL B;  1L1F A;  3JAR A;  4B08 A;  3JSL A;  4DV4 O;  1I5X A;  2JRI A;  5E79 Z;  5GON B;  3BVO A;  2DQ0 A;  2JGD A;  3KCX A;  5CBH A;  5KA5 A;  1KQS U;  3CWB H;  2Y69 C;  2ZXW B;  5K1X A;  4DR6 O;  1JJO A;  1SET A;  2XHB A;  1G1X B;  4X65 B;  2GDS A;  3ZS8 C;  2QM7 A;  4B3S B;  1SA0 B;  2YI9 A;  1PL4 A;  1M57 C;  1NH2 D;  1XRE A;  2QKC A;  3W7T A;  2B1I A;  2Q7G A;  4JI5 B;  1S0V A;  3B2E E;  3ABU A;  4TV9 B;  2P5O A;  4YHH O;  1H8E G;  1KC8 W;  3VBB A;  1F4M A;  4MT8 A;  4J42 A;  1THZ A;  5GW7 A;  4GX1 A;  2PTM A;  4LFC O;  2BCC H;  1Z2G A;  4YIO A;  1SC5 B;  1UJW B;  2Y69 B;  3L70 H;  3JCU Z;  1QHT A;  1IXM A;  5JVD A;  1Q8I A;  3JYC A;  3ABT A;  3ZN1 A;  3SYA A;  3M99 B;  4JZG A;  5CBG A;  4YIP A;  1VF7 A;  3KCY A;  1KKD A;  3CPW U;  4FIP C;  2VWK A;  1AIL A;  1M57 B;  4DV1 B;  1TUE B;  3T4Z A;  1Q81 W;  3QNE A;  4X1Y A;  3IC7 A;  2QWQ B;  4NXN O;  1PKX A;  4B3M O;  4Z1M G;  2Q69 A;  3TGU H;  3B77 A;  5BR8 B;  4DR3 B;  3APO A;  1AI4 A;  2X6A A;  2IW5 A;  1AJP A;  4E4E A;  1AB3 A;  1SES A;  1OCO B;  4KL1 A;  3TXS A;  1TUB A;  1WA8 A;  1AR4 A;  2Y48 A;  1Y76 B;  3HKD B;  2V7Q G;  4XDJ A;  5IJ0 A;  4G2K A;  1XIL A;  2ZNJ A;  2H8P C;  2OT5 A;  4ZI7 A;  1H2N A;  2OWO A;  4JI2 B;  1FXK C;  3OE7 G;  5LA6 B;  1GM9 A;  3JAS B;  1Q90 D;  4PDM A;  1Q3E A;  4LF9 B;  3OGC C;  3T1Y O;  3ABL B;  2JEU A;  2ZNI A;  5AG2 A;  5L3D A;  1N32 O;  2NN4 A;  4LNU A;  1XUQ A;  2ITC C;  4BIU A;  2IJJ A;  4NTX A;  1ZWI C;  4YXW G;  2BTO A;  1S5H C;  1FXK B;  3ETQ A;  1VMG A;  3ABM C;  2KKW A;  3ML0 A;  3UO2 A;  3CS5 A;  5IE9 A;  2YIB D;  4A5U B;  3T1H O;  2GV9 A;  1XMQ B;  5ITZ A;  2YUA A;  5FNV A;  3MDS A;  1NR7 A;  4WCE V;  4W4K A;  4GX2 A;  2GUZ B;  4FZ0 A;  1AI6 A;  4I0X A;  5FL7 G;  4UCR A;  2OTL V;  4MSW C;  2QKA A;  1N0J A;  3K5M A;  5KHK A;  5LGU A;  4RQE A;  3RW0 A;  3QO7 A;  4PI2 A;  2Q9L A;  4DV0 O;  3CC7 V;  1M9N A;  4UVB A;  1VF6 C;  4JAU A;  4ZHQ B;  4X64 B;  4WBN B;  3ETG A;  5JCO C;  4I50 B;  1PNM A;  4O4I B;  2VQF B;  3LNM B;  1K4D C;  4UUJ C;  2ZIM A;  1NTM H;  2GTS A;  1ZUQ A;  1E79 G;  1XMO B;  5LA6 A;  3K9A A;  4ZBM A;  1Q86 W;  3OTF A;  4JTC B;  1HNX B;  5J9P C;  1CP9 A;  3ZHT A;  1WAZ A;  2ITD C;  3ABK C;  3LDC A;  1NU1 H;  1LR1 A;  1RPO A;  5B3S C;  2WSS G;  1H2K A;  1JFF A;  2BSK A;  1ZSP A;  2E75 B;  2QWN B;  3L75 H;  2HLD G;  2YIB A;  4JZ2 A;  4OGQ B;  4FLV A;  2K9P A;  2EIK C;  4TUY B;  4JI7 B;  1V54 B;  1D2D A;  1V55 C;  2LFR A;  4DUY O;  1FXK A;  2VWJ A;  3CX5 F;  1AVM A;  1SQF A;  3SPC A;  4GKK B;  3UCS C;  3CCJ V;  4PA3 A;  5B1B C;  1N4C A;  5IYD O;  1NTZ H;  3DXR B;  3G6E V;  4J7J A;  5B3S B;  4QPK A;  2UUA B;  1QCE A;  1QU7 A;  5KUK A;  2GUZ A;  1QLE B;  4Z2W A;  5IYZ A;  3EVK A;  5LGN A;  3HPL C;  4H33 A;  1IBK O;  5BZB A;  1X59 A;  3P3N A;  3ZRX A;  3SJA C;  1YZB A;  1Q82 W;  1IX9 A;  2CGO A;  2HVJ C;  4FK5 C;  1EM1 A;  5CA0 A;  4ZHQ A;  5J2T A;  2YS8 A;  2DYS B;  3RFR A;  1R6N A;  1AI7 A;  1R3I C;  5F2V O;  3FYE B;  5LMU B;  3AK3 A;  2ETN A;  2QSA A;  3H01 A;  4WFB V;  5J2U B;  2UXD B;  2NNU A;  4O4I A;  2VS0 A;  4BW9 A;  3UT5 A;  3KDR A;  1YVW A;  2UXB B;  5IT9 N;  4DO2 A;  4I5S A;  1BSM A;  4JI3 B;  1VQ4 V;  1HNW B;  4CC5 A;  2UXC B;  1Y67 A;  2WLI B;  3ZMZ A;  1KYO F;  3B40 A;  2JEX A;  1VF6 A;  3ZHS A;  4PHZ A;  1OCR C;  5DM6 V;  4DV5 O;  1JQ0 A;  1N34 B;  1DTO A;  4JI1 O;  5JCO A;  4LFA B;  1RPR A;  4RUE A;  4X62 B;  4DV4 B;  3H1L H;  4ZIB A;  1YJN V;  4NXM O;  2PYL A;  1NBM G;  3AG3 B;  2EBO A;  1GK9 A;  3E8B A;  1RP3 B;  2WA3 A;  1RM1 B;  1GM8 A;  4TUY A;  1HNZ B;  2WLK A;  3E35 A;  2WLL A;  1NJI W;  2BOC C;  2ODM A;  1WPX A;  1XL6 A;  3QO5 A;  4QPJ A;  5LXT B;  1V9P A;  2JIZ G;  1FFX B;  4UVA A;  4LWS A;  5GTI Z;  2QWR B;  5JH7 B;  4PDV A;  2DQ3 A;  1L0N H;  1GN3 A;  1K5Q A;  4ASU G;  3CME V;  2LO1 A;  1SKV A;  2EIJ C;  3AG1 C;  2RJZ A;  2ZDI C;  4DV6 B;  3K04 A;  5EIB C;  3ETD A;  2CTW A;  2JVD A;  1M1K W;  2B5U A;  1XNQ O;  1Q6I A;  3VOU A;  4R8C A;  1HR0 O;  3JAW A;  4CBC A;  4RQF A;  1GO3 F;  4J7Z A;  3ZRW B;  4JI0 B;  2FL4 A;  4PV1 B;  4FFB A;  2Q7E A;  1TAE A;  1OCC C;  1R3K C;  3FYI B;  4OX9 O;  2UU9 O;  4GYC B;  5BXZ A;  2EIJ B;  4B3M B;  3H1H H;  3P3P A;  1FJG O;  1Q6H A;  2ATK C;  4X20 B;  2HHH O;  5EC2 C;  2AHY A;  1U96 A;  2JJ2 G;  4CH6 A;  2IJI A;  2A79 B;  3SJQ C;  4YJ2 A;  3SR2 C;  4UB6 Z;  5EIB D;  3WU2 Z;  1N8R W;  3X2Q C;  1NZ6 A;  4DV3 O;  2M7W A;  4LF4 O;  4LF8 B;  4CH4 A;  1NQT A;  3MHS C;  2JDI G;  3ASO C;  5KX5 B;  1N36 B;  2KQX A;  3JAR B;  4F6E A;  2LW7 A;  5IDJ A;  3G4S V;  2DMX A;  1FFX A;  3OW2 U;  4X66 O;  1PL0 A;  2JGD B;  5JH7 A;  3CRM A;  1VQO V;  4IL6 Z;  5EBL C;  1ZAU A;  4RWU A;  4AQY B;  3FB8 C;  4KUM A;  4J10 A;  2K1E A;  3A2F A;  3CYO A;  1M56 B;  2KG7 B;  3CXH F;  5DN6 G;  3ZCC A;  4HAM A;  3X2Q B;  5EBM C;  2ZE6 A;  3SJB C;  3T2M A;  4BIO A;  2LW1 A;  3CCS V;  2HEP A;  2JS5 A;  1QNM A;  1NVP B;  1AP5 A;  1PNK A;  4HNA A;  2Y0P A;  4JI6 O;  4JV5 O;  3RYC A;  2XOK G;  3KZI Z;  3JD4 A;  1SQX H;  5JQG B;  5JVD B;  1OHH G;  3UO3 A;  2LFS A;  3G67 A;  3NR7 A;  4NVP A;  2F93 B;  1KB9 F;  2ZDI A;  4JAA A;  3BAB A;  2QEX V;  1GRJ A;  4C7U A;  2F4V O;  1J5E B;  3CC4 V;  1IUR A;  3SPH A;  1XHZ A;  4LF5 B;  1FD9 A;  2FKX A;  4LC1 A;  5DED A;  1JA8 A;  3RT3 C;  1BGY H;  3ZIA G;  4DR2 B;  3G71 V;  1HWY A;  4CS3 A;  1TUB B;  1WA8 B;  3KKY A;  3BA9 A;  5IJ0 B;  5KLV H;  4P30 A;  2KB1 A;  4UV8 A;  1YF2 A;  4IGG A;  1NH2 B;  3ASN B;  3VQV A;  4ZI7 B;  2QM8 A;  3CB2 A;  4D7T A;  4JYA O;  2QWP B;  5H2F Z;  3ZHQ A;  1M90 W;  3D8C A;  3UKM A;  2Z0A A;  3CMA V;  1WP7 A;  4LF6 B;  3WFV A;  1VQ9 V;  4IYI A;  4TOI A;  2R9I A;  3ZRV A;  4DW0 A;  2KG7 A;  1PPJ H;  1B6Q A;  1I5Y A;  2WAM A;  3HKB A;  1JCH A;  4FPP A;  1US6 A;  4DUY B;  4LNU B;  3BRC A;  2H3O A;  5L3G A;  4BIZ A;  2PYJ A;  1SZX A;  1YDX A;  2LJ2 A;  1Y6X A;  4TT3 G;  3K79 A;  1G4Y B;  1LUW A;  2WLN A;  2YXL A;  3OT7 A;  4O4J B;  4BW5 A;  1VAR A;  1B06 A;  4DR1 B;  5JQG A;  2CK3 G;  1CEZ A;  2W6I G;  5ITZ B;  5FNV B;  1IBM B;  5K1P A;  1M5I A;  1DGS A;  4PA9 A;  5KUM A;  3CCR V;  4PA6 A;  2QA4 V;  1AP6 A;  4MW3 A;  2OIG A;  3TK1 A;  4IYH A;  4DR7 O;  4DR5 O;  1ROP A;  4I0X B;  3GWK C;  3SDL A;  2Q0O C;  2RDC A;  2G38 A;  4DW1 A;  4ZOL A;  1Y74 B;  1H38 A;  2QGN A;  3SYC A;  3LUT B;  3OTO O;  5IY5 C;  3A0H Z;  3WB0 A;  3IC9 A;  1K8A W;  5DEC A;  1XDC A;  3N2K B;  4ICG A;  3U11 A;  4U3J A;  2IU0 A;  4DV2 B;  1R6T A;  3E8H A;  4JYB A;  2LP7 A;  1XNR O;  3AG4 C;  2ZKO A;  4MS2 A;  1BHB A;  4EEQ A;  4WFF A;  4YY3 O;  3SPG A;  5IYB O;  2UUC O;  2ZM6 B;  3JAT B;  1I7F A;  4QIW F;  5CN0 A;  5CA1 A;  1IBL B;  4GKJ B;  4JI1 B;  1T5E A;  1Q43 A;  1XOU A;  1BT8 A;  3IAY A;  4NXM B;  4X89 A;  1GKF A;  3LSQ A;  5IY5 B;  4DUZ B;  1VQL V;  1JFF B;  2BSK B;  1KEC A;  4QJF B;  1WN7 A;  3I56 V;  2GTA A;  5LHI A;  3N27 A;  4NYK A;  4IIJ B;  2E5L B;  4KHP O;  1AJQ A;  3H1J H;  3L73 H;  2VQE O;  1GMG A;  1ARO P;  1BZK A;  5B1O A;  1P49 A;  2UUB O;  2P67 A;  4O2B B;  3CCU V;  2IJH A;  3B4S A;  2DN9 A;  4O4J A;  1B3Q A;  2F1M A;  2XAF A;  1YIT V;  1O9H A;  5FPR A;  1MZF A;  4B3R B;  1I94 O;  4O4L B;  2AZ2 A;  3WG7 C;  3TCU A;  3S3X A;  2ZQM A;  4UVC A;  1R3J C;  3GB7 C;  2ZE7 A;  1H2S B;  3ZMT A;  4JI4 B;  2YSU B;  4JYC A;  1U97 A;  4EB6 A;  5EYP A;  5IYZ B;  2V4D A;  1J95 A;  2Q67 A;  4UCU A;  4LF7 O;  1Y74 A;  3IFX A;  5IWA O;  4F6R A;  3LNN A;  5LMN B;  5CA0 B;  2XAS A;  4UB8 Z;  3P32 A;  1YJW V;  2CAZ C;  5J2T B;  2Y0I A;  4X8A A;  3PJS K;  3N2K A;  1S72 V;  4I4T A;  3ABM B;  4K0K B;  1ZLZ A;  4UXN A;  3QO8 A;  5LP6 C;  2MW2 B;  1N33 O;  4LR3 A;  4LFB O;  2CUG A;  4K8Z A;  4DR4 O;  4Z1V A;  1K3E A;  2AXT Z;  3UT5 B;  5KHG A;  2OCH A;  2YXY A;  4UCT A;  2QKS A;  1JX9 A;  3LSU A;  3JAT A;  2GBO A;  3DC5 A;  3K5L A;  5B5E Z;  1BQ0 A;  2ZR2 A;  2R70 A;  1CPY A;  3DC6 A;  1BE3 H;  3TXQ A;  3M8A A;  1KD1 W;  1AR1 B;  5KHH A;  4FJC C;  3J81 N;  2PY5 A;  2W0X A;  5LP6 B;  2EJ7 A;  4P9P A;  2DE0 X;  4IIJ A;  1Z5V A;  3A0B Z;  3N2G A;  3FKS G;  4JI8 B;  1XBL A;  1L0L H;  3K08 A;  1GN4 A;  4O2B A;  1KP2 A;  5EC1 C;  1I0H A;  4FLT A;  4R7C A;  4B3T B;  2WLL B;  1TGO A;  4R6Z A;  2OTJ V;  3T1C A;  2YDE A;  2A3Q A;  3VQW A;  3E8G A;  3P30 A;  2W6J G;  2EJR A;  3L9D A;  3JAK A;  4X65 O;  5CA3 A;  4O4L A;  3BEH A;  4B3S O;  3ABK B;  4LWS B;  5LBQ A;  4JF3 A;  2JS3 A;  1WJZ A;  2EIM C;  2PZS A;  2W0F C;  3U0Z A;  1X4T A;  2IJK A;  2WA4 A;  4JI5 O;  2X0L A;  5KHJ A;  3BAA A;  4PA7 A;  2L35 A;  3ZED A;  2P6J A;  4X9Q A;  3CCQ V;  4LH6 A;  3K0D A;  2ZD9 A;  2EIK B;  4H44 B;  1V55 B;  3CJH A;  4B7E A;  3JAW B;  2FYU H;  2FTK A;  1H2M A;  1NKD A;  3OUS A;  4DRX B;  2D3O W;  4Q6G A;  4XDL A;  1AR5 A;  2X6B A;  2Q4P A;  4FFB B;  5B1B B;  2P7T C;  4HBN A;  4LCU C;  4DV1 O;  4FLW A;  1D5N A;  1I08 A;  4O4H A;  2F4V B;  5JWP A;  1XQ8 A;  4QNH B;  3JAL B;  1F23 A;  1GN2 A;  4JTD B;  2PUS A;  4DV7 B;  4PJ0 Z;  1SQB H;  2F95 B;  3K5O A;  3E83 A;  2PGG A;  5BR8 O;  5LYJ B;  4DR3 O;  3E89 A;  1BCC H;  4FM0 A;  4LP8 A;  2EUL A;  1FS0 G;  4J9Z B;  5JJN B;  2L6L A;  5LP6 A;  4UCV A;  4YJ2 B;  2XND G;  3G80 A;  4UFZ A;  2BTQ A;  3CCM V;  3M7M X;  2OCC C;  2LGW A;  3CRQ A;  3QTC A;  4CS2 A;  1VIB A;  3W7U A;  4I9W A;  3W7W A;  3CCV V;  1SQG A;  1YSC A;  3K57 A;  3BCC H;  1VQK V;  1VQ7 V;  2VRZ A;  4DR6 B;  3ZX6 A;  1S76 D;  4LF9 O;  4FLX A;  2DWD C;  3OD4 A;  1W0J G;  3C90 A;  1OCR B;  4TSF G;  3OMN B;  2AHZ A;  2H94 A;  1N0N A;  4YHH B;  3ZMS A;  4CC6 A;  4MW8 A;  2R9R B;  2AZ0 A;  1ZL8 A;  2GHY A;  4JGS A;  4LFC B;  3HKE A;  5KAF Z;  3WB1 A;  1SQQ H;  2YI8 A;  2AW9 A;  4DRX A;  4JAS A;  1A32 A;  4D6T H;  4HNA B;  4H37 A;  4ABM A;  1XMQ O;  4E2L A;  5LGT A;  3SPI A;  1Z5W A;  3L71 H;  2HJF C;  3RYC B;  3FD9 A;  4AHC A;  4GCZ A;  1R1B A;  3JSN A;  4TV8 A;  4J7K A;  3UM7 A;  4UCS A;  3JAL A;  3LDD A;  4NXN B;  3AG1 B;  1K5S A;  2M6Y A;  1VQ8 V;  4FFK A;  1FKA O;  1E1R G;  1GN6 A;  3RYI A;  4QE7 A;  5LYJ A;  1IJG A;  4G27 B;  3OTO B;  2Z3Y A;  3NXS A;  2HP8 A;  4CH5 A;  2Q5Z A;  5LHG A;  4FZ1 A;  3OMI B;  4X64 O;  4NTY A;  3VQY A;  1JMK C;  1OCZ C;  4MTF A;  3E22 A;  3CRR A;  2P4K A;  4U3F H;  2Z5U A;  2LQT A;  1VP7 A;  1DK1 A;  4PEL A;  2VQF O;  4EFE A;  1OCC B;  4CZZ A;  1FYJ A;  2A7W A;  1XMO O;  1VQ6 V;  2IH3 C;  1AI5 A;  2P4V A;  5KA6 A;  3AG2 C;  3JD3 A;  2IU3 A;  3F5T A;  3QF7 A;  2UUC B;  2RQ6 A;  1AJN A;  1WP8 A;  1ZX3 A;  2DWE C;  1SQV H;  4LBE C;  1R73 A;  1HNX O;  4GX5 A;  3T1Y B;  4FMT A;  3IJ4 A;  1N32 B;  4J41 A;  3OR6 C;  4KHP B;  1NTK H;  4XBF A;  3SPJ A;  2DYR C;  2R72 A;  5C8Y A;  1PP9 H;  3ZJZ A;  2WLJ A;  3J80 N;  3HKB B;  4JI7 O;  3ICX A;  2A0L A;  3CEI A;  4K35 A;  3ASO B;  1XI1 A;  1EZJ A;  2RCV A;  4OXS A;  1MNG A;  1PM9 A;  5EK0 A;  3CD6 V;  4GKK O;  3T1H B;  2EZO A;  3AK2 A;  1YTF D;  4NB5 A;  4UCO A;  1JVM A;  3CXC U;  4JYY A;  2UUA O;  1UFI A;  3OEE G;  4KP4 A;  1P84 F;  1TVK A;  5BMV B;  4K8X A;  3OMA B;  2HFE C;  4FVM A;  1KKC A;  5LOV A;  4FLU A;  3STL C;  3K0G A;  4LF7 B;  1G6U A;  4U7O A;  4DV0 B;  2CTP A;  2F66 C;  1YCI A;  3SYP A;  1KP3 A;  2XAJ A;  3FB6 C;  2YEV B;  1MSD A;  4ZOL B;  5LMU O;  3FAV B;  4P9O A;  2EIL C;  4B7K A;  3ZRS A;  1BL8 A;  4DK0 A;  2DJV A;  2UXD O;  4NKG B;  2ZT9 B;  2P90 A;  3STZ C;  2YXH A;  2FB5 A;  1EZV H;  3C3T A;  4MVR A;  2ADP A;  3RYF B;  4MVU A;  4JI3 O;  1HNW O;  2WLM A;  4U3J B;  1PV0 A;  4D7S A;  2XTA A;  2UXC O;  5B1A C;  4X1I A;  1QR8 A;  2NLJ C;  1WPB A;  5H6R A;  3D3Q A;  3RN4 A;  1EN6 A;  3QG5 A;  4HZ3 A;  3SYQ A;  1D5A A;  1K4C C;  3R66 A;  1S77 D;  2Q6A A;  5CA1 B;  3E8F A;  1N34 O;  4LFA O;  2HG5 C;  4X62 O;  1P4R A;  3JAM N;  1FOU A;  1VQN V;  1HNZ O;  3HB3 B;  1G8M A;  4TWK A;  5EZY A;  1DF4 A;  1EN5 A;  1XL4 A;  4DK1 A;  1BQZ A;  5B1A B;  5E1A C;  3TJT A;  2E74 B;  3PN1 A;  3OR7 C;  2ZE8 A;  1LNQ A;  3RYH A;  4OPA A;  1H2G A;  3C3S A;  2JK5 C;  5BMV A;  3B8N A;  3RVY A;  3GWO A;  1IBK B;  1VF5 B;  4DV6 O;  3LSS A;  2QM4 A;  3MD0 A;  3CCE V;  3CSX A;  2JJ1 G;  3AG7 A;  3ZHV A;  3A8T A;  4EB6 B;  5EYP B;  2Q73 A;  4CH3 A;  1MOF A;  1OCO C;  3HKC B;  2FML A;  3D36 C;  2YEV A;  5D5P A;  2O57 A;  3FAV A;  1WB8 A;  4JI0 O;  1OV9 A;  4RO2 A;  5TIS Z;  4F6R B;  5LL6 Y;  3KG2 A;  1JPX A;  1QQC A;  3CHX A;  4U7N A;  3E2E A;  2JGU A;  4KFM A;  1MA1 A;  2XAQ A;  3RGB A;  4I4T B;  2P06 A;  2EIN C;  3RYF A;  4LH7 A;  4MVO A;  2KSD A;  3UQ8 A;  2DOS A;  3TET A;  1K9M W;  2QTO A;  5GTH Z;  1BHA A;  3ABL C;  3ETE A;  1FXH A;  4H0L B;  1W2B U;  2CH7 A;  4QE9 A;  1RSO A;  4GT1 A;  4N23 A;  4DV5 B;  4O2A B;  2OIE A;  4L8J A;  2HR3 A;  1K92 A;  4MVM A;  4RUF A;  2YIC A;  5GON A;  4RAI A;  3SJC C;  3R65 A;  1DF5 A;  4EKW A;  4LF8 O;  3U10 A;  3BY6 A;  4EFB A;  2EIN B;  2Q8V A;  1SER A;  1NT2 B;  1N36 O;  2Q7H A;  3N2G B;  3JD0 A;  4FLY A;  3K9S A;  4P2Z A;  1F51 A;  1H8H G;  3WB2 A;  1SA0 A;  2CDY A;  2Y4U A;  4PA4 A;  3AG4 B;  2QTS A;  3CE2 A;  4G28 B;  3ZN0 A;  5H5N A;  1E1Q G;  1MMM A;  1P7G A;  1S3J A;  3B8M A;  1IVS A;  3AK1 A;  4AQY O;  2MK3 A;  3JAK B;  4TV9 A;  1JNB A;  1BS3 A;  5CMU A;  3B09 A;  4GLX A;  2LGQ A;  2A9H A;  4PI0 A;  1PD3 A;  5KHI A;  3OUF A;  1LUV A;  1XNQ B;  5IYC O;  2EZP A;  4MVQ A;  1HR0 B;  5EBW C;  2BE3 A;  4WFH A;  3SYO A;  1R3L C;  3HKC A;  4N21 A;  2QJ1 A;  4BR6 A;  1BMF G;  3ZMV A;  4I9Q A;  4I7Z B;  4H13 B;  3CJH B;  2F23 A;  1GAX A;  2B9Z A;  4OX9 B;  5D5Q A;  2UU9 B;  2AGA A;  1JOY A;  4MVS A;  3F5W C;  3WG7 B;  1H2L A;  1FJG B;  2ZIO A;  4F4L A;  2UXX A;  1PNL A;  1B04 A;  2PI5 A;  2RNB A;  3FX7 A;  4O4H B;  2HHH B;  1J5E O;  3L72 H;  3HR0 A;  4GX0 A;  1QR9 A;  4LF5 O;  1HDJ A;  3IGA C;  1EBO A;  1KU9 A;  3FB7 C;  3D36 A;  3QVN A;  4O2A A;  1QVF U;  3J7A U;  3E86 A;  2QDO A;  1Y76 A;  3D3I A;  4I55 B;  3HKD A;  2PI4 A;  2RMK B;  3F7V C;  1YEW A;  4DR2 O;  5JJJ B;  1WNS A;  1V54 C;  3H1K H;  4DV3 B;  4LF4 B;  3O9O A;  2XAG A;  5HFM A;  1GM7 A;  4FM1 A;  3JAS A;  1IDS A;  3S3W A;  3CP1 A;  1SRY A;  2BTQ B;  4J9Y B;  3VQX A;  5JJE B;  4X66 B;  1KBH A;  4MTO A;  4X1K B;  2YIA A;  1QLE C;  4LF6 O;  1FXV A;  3APQ A;  4FLZ A;  3ZBH A;  4YJ3 B;  1ENV A;  4IHJ B;  1TA8 A;  3OGI B;  4GUN A;  5HFL A;  3W7X A;  2HJD A;  2DYS C;  4TQD A;  2X6C A;  1L8D A;  1SF9 A;  1YIJ V;  1SZT A;  4JTA B;  4GZR B;  1IZ3 A;  2V1D A;  2DW4 A;  5LHH A;  1ZL8 B;  1NS1 A;  4ZKI A;  3HKE B;  1SQP H;  4JI6 B;  4JV5 B;  1FFT B;  1K33 A;  3Q4H B;  3RWR D;  4DR1 O;  4BAY A;  1SS3 A;  1QVG U;  3DGE A;  1O9G A;  1IXB A;  2ZCE A;  3FB5 C;  1F7Y A;  3BA8 A;  5IJ9 B;  1IBM O;  4Q20 A;  3A0R A;  2EIM B;  4TV8 B;  1K34 A;  3JD1 A;  1GH6 A;  1URF A;  4WBN A;  4CS4 A;  2ZR3 A;  3F7Y C;  4PDL A;  3RBZ A;  2HVK C;  1WLE A;  4I55 A;  4I50 A;  4OPH A;  3RYI B;  4JPR A;  4R50 A;  4L87 A;  4DYL A;  1M4U A;  3AG3 C;  2QWO B;  1RM1 C;  2ILM A;  1YJ9 V;  4MVZ A;  2ADQ B;  3CC2 V;  1QLN A;  3AEI A;  3E22 B;  2N05 A;  2R9A A;  3T4D A;  1KUQ A;  2RN9 A;  4KXR A;  2CGN A;  4DV2 O;  1JJ2 U;  4MTX A;  3OM3 B;  4IT5 A;  2N74 A;  5B1N A;  5CB4 B;  4X1K A;  1VEW A;  4JYA B;  1UPG A;  5KMG B;  5KAI Z;  4JI2 O;  1FAF A;  3OFN G;  2ZM6 O;  2A06 H;  4QGP A;  1W59 A;  4WFE A;  1IBL O;  4GKJ O;  4WFG A;  3BHP A;  4XDK A;  3DSQ A;  4YJ3 A; 
#chains in the Genus database with same CATH homology
 1MNG A;  1PM9 A;  3AK1 A;  1BSM A;  2AW9 A;  1BS3 A;  3AK2 A;  1Y67 A;  1JA8 A;  3C3S A;  4JYY A;  3IC9 A;  4GUN A;  1ZLZ A;  1AR5 A;  1LUV A;  1XDC A;  2CE4 A;  1D5N A;  1KKC A;  1I08 A;  2GDS A;  3KKY A;  4FFK A;  1ZSP A;  1GN6 A;  1GN2 A;  1PL4 A;  5AG2 A;  1XRE A;  4BR6 A;  3LSU A;  2QKC A;  1XUQ A;  1WB8 A;  4JZ2 A;  4F6E A;  3DC5 A;  2RCV A;  1MSD A;  1IXB A;  1MA1 A;  3DC6 A;  1EN4 A;  1AVM A;  2P4K A;  1BT8 A;  1WB7 A;  4YIO A;  1GN3 A;  3C3T A;  2ADP A;  3MDS A;  1JR9 A;  4JZG A;  3QVN A;  4YIP A;  3EVK A;  1GN4 A;  3BFR A;  1I0H A;  3RN4 A;  1EN6 A;  2ADQ B;  1SZX A;  1IX9 A;  1ZTE A;  1QNM A;  1EM1 A;  2QKA A;  1N0J A;  1LUW A;  1AP5 A;  3OT7 A;  1IDS A;  1VAR A;  1B06 A;  3AK3 A;  1VEW A;  1N0N A;  4E4E A;  5A9G A;  3K9S A;  3CEI A;  1EN5 A;  1AR4 A;  4X9Q A;  2CDY A;  1AP6 A;  4C7U A;  3KDR A;  3TJT A;  1MMM A;  1ZUQ A;  1P7G A;  1XIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...