3QVNA

Crystal structure of cytosolic mnsod3 from candida albicans
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
MITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVKLDYFKAIWNVINWAEAESRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Manganese-containing superoxide dismutase
publication title Comparison of two yeast MnSODs: mitochondrial Saccharomyces cerevisiae versus cytosolic Candida albicans.
pubmed doi rcsb
source organism Candida albicans
molecule tags Oxidoreductase
total genus 73
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3qvnA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3qvnA02
1LUWA 1VARA 1ZLZA 1LUVA 1GN3A 3C3TA 1XDCA 3RN4A 1MMMA 1Y67A 1BT8A 3C3SA 1AR4A 1ZSPA 1GN6A 5AG2A 1I0HA 4F6EA 3LSUA 1AVMA 2GDSA 1N0JA 1IDSA 3K9SA 3CEIA 4JZGA 3DC6A 3TJTA 1XREA 1VEWA 4YIOA 4X9QA 1BSMA 1ZTEA 1KKCA 1AP6A 1MNGA 1N0NA 3KKYA 4FFKA 4YIPA 1MA1A 1JA8A 1IXBA 2RCVA 3AK1A 2ADPA 3OT7A 2AW9A 4C7UA 1WB7A 1AP5A 1PM9A 2QKCA 1ZUQA 1EM1A 3AK2A 4GUNA 2P4KA 1I08A 3IC9A 1D5NA 1BS3A 3MDSA 2CE4A 2CDYA 1PL4A 1EN5A 5A9GA 3BFRA 1GN2A 1XUQA 3AK3A 4E4EA 1AR5A 1WB8A 1B06A 1XILA 4JZ2A 1JR9A 1EN6A 1SZXA 1P7GA 3EVKA 1GN4A 2QKAA 2ADQB 4JYYA 1QNMA 4BR6A 1IX9A 1MSDA 3QVNA 3DC5A 1EN4A
chains in the Genus database with same CATH superfamily
2E5LO 1H2MA 2HP8A 1M56B 5LP6B 4B3MO 4P9PA 2VWJA 1V55C 1R73A 4TV8A 3TXSA 1GM7A 4O4JA 1BHBA 3OGCC 1ORQC 4MTOA 5JQGA 3GVMA 3SYQA 1HR0O 4MW3A 1IDSA 1NKDA 2VQFB 1SETA 1L1FA 1IJGA 4IGGA 3JASB 1E1RG 5E79Z 5GONA 2RCVA 3ZRXA 1HNXB 5H9CA 5BMVA 3GWOA 1FJGB 2YDEA 3CRRA 1AR1B 3SPGA 5KMGA 4X1IB 5JH7B 2Y0IA 2H3OA 3OAAG 4MVRA 3H1JH 4XBFA 2H8PC 4GKJO 5B1AB 2Q73A 3JALA 4TV9B 2D2CB 2WLHA 3OW2U 4FLXA 1U96A 3OGIB 3W7WA 1W0KG 4CH3A 2GSMB 4J10A 4K3AA 5TISZ 5H5NA 3UCSC 2ZINA 4LF5B 3ZMUA 2EJRA 1BZKA 2ILMA 4OPAA 2Q7HA 1VQ9V 2W6IG 2LO1A 4TUYB 4D7SA 5CA1A 3CP1A 1AJNA 3I56V 1H5WA 4KXRA 4U3JA 5D5PA 3FB6C 2JEXA 4YJ3B 1K4DC 3L71H 5HFMA 1QNMA 1P4RA 4GKKO 5KLVH 1GK9A 3QO8A 4NTXA 2DQ3A 3LNNA 4HNAA 4LBEC 1NR7A 3AG2B 2VQEB 4D7TA 2OIGA 2CGNA 1PPJH 3K58A 3SPCA 1YTFD 5CA0B 4JAUA 5EZYA 4JTDB 3R65A 5GTIZ 4KP4A 3AG1B 4QPJA 5IJ0A 3LSUA 1T5EA 2YEVB 2YI8A 1QCEA 2X6CA 2Q5ZA 5IYZB 1DK1A 1M57B 2Z0AA 3QO7A 4GCZA 1RFYA 1F4NA 4YIPA 1BQZA 2QM7A 4K0KB 2H94A 2F93B 4DR5O 1VQ5V 4B7EA 2QWNB 1DTOA 2QKSA 3HKBA 1WB7A 3RVYA 1PL0A 4X64O 4CZZA 1NT2B 2ARHA 4PA3A 4GUNA 4PJ0Z 4NXMO 1QQCA 3N2KA 1QLEB 5KA5A 5CBFA 5GTHZ 1KMIZ 2NNUA 5LHGA 4RO2A 4KUMA 4WFFA 5LOVB 5LMNB 2UXCO 4Q20A 2E3CA 2YICA 3EVKA 3BVOA 1HNZB 2YIBA 1WPXA 3VQXA 3E89A 2OCCC 2PYJA 4I0XA 5EIBD 3UT5A 3G4SV 1N34B 4WFEA 4PDMA 2QWRB 3OUSA 2ZNIA 4LFBO 5LMUB 1GN3A 2CTRA 1UPGA 2DYSB 3RGBA 3IC7A 3SYOA 1KP3A 3CCVV 3W7SA 3ASOB 4IHJA 1CP9A 4JI6B 4DR1B 3QG5A 2GDSA 3W7TA 5FLXN 1VEWA 2ZXWC 2EIKC 4P2ZA 4DUYB 3TK1A 3OTOO 3NXSA 3J80N 1M9NA 1N32B 1SF9A 1OCCC 5DEDA 2A7WA 4JAAA 1XNQB 4DV1O 1XMOB 2DW4A 2RQ6A 3STZC 4DUZB 1EM1A 3AK2A 5IJ9A 1QVGU 3D3IA 4TQFA 1Q8IA 2XT9A 3JAKA 1THZA 4QIWF 1JFFA 1K3EA 4PDLA 1O9GA 1HNWB 3O65A 2FL4A 3CCLV 1K5SA 3D3QA 2XAQA 1WNSA 4J11A 2Y48A 5KUMA 2IH1C 3RT3C 1Z2GA 2X6AA 1IBKB 4JI0B 1R6KA 1SRYA 3FYIB 1XEQA 3VBBA 4DR2B 3ZHQA 4JYCA 4FLUA 1FKAO 3QO5A 2XUMA 3C3TA 4AQYB 4B08A 3CB2A 5KHHA 4B7KA 3ZEDA 1I5XA 1MMMA 4DV5O 4JI3O 4UUJC 4F6RB 1NBMG 4DO2A 4DV0B 3VQVA 1S77D 2UXDB 3DSQA 3E83A 3AG4B 4MVMA 5DECA 4X62B 4O2BB 3TGUH 4YY3B 3ZMSA 1RM1B 4KHPB 3WB1A 3PJSK 2UXNA 1S76D 4DV7B 2IJHA 3K59A 2VQFO 1IXBA 3KDRA 3AK1A 4FFBB 1S3JA 2G38A 2RMKB 5LA6A 5KHKA 2EIMC 2OYQA 4I4TB 5B1BC 1H2SB 2Y69C 1IBLB 1HNXO 2EIJC 4UV8A 3KCXA 3ZMVA 3UKMA 4QPKA 1FJGO 2ITCC 5IY5B 4GZRB 3CSXA 1VF6A 3N2GB 3ZJZA 2V7QG 1D5NA 2HLDG 4EB6B 5LGNA 2UUCB 3K06A 2LGQA 5FL7G 4WFGA 1OZ0A 2Q6AA 3T4ZA 1KBHA 1FFXB 4OX9O 4LH7A 2Z3YA 3CMAV 1AR5A 5KUKA 1GAXA 1NJIW 1HP8A 5IYDO 4DK0A 2ZT9B 1TUBB 3B8MA 4PD4F 3K57A 2UU9O 4WBNA 1XL4A 4JI1O 2WSSG 2ZR3A 5LP6A 1OCRB 4U7OA 2W0XA 2DMXA 1AI7A 1TA8A 3ABLC 4BR6A 2WLJA 2ZR2A 3KG2A 2PUSA 2FTKA 3P30A 1EBOA 1FOUA 3ZRWA 3L9DA 4FM0A 4R6ZA 1FXKA 3OEHG 2QWPB 4CC5A 2QM4A 4LWSA 4ZI7B 1RPRA 3QF7A 5DN6G 2QJ1A 1GN6A 3TCUA 5IWAB 1PV0A 1M1KW 1AVMA 2BSKA 2Q0AA 3BA8A 2EINC 1MZEA 4I50B 4UCTA 4ZHQB 2F23A 3J7AU 1MSWD 2FYUH 4UB8Z 5J2TB 3BA9A 4RWUA 1FPOA 3D8CA 1AILA 3ZX6A 1MA1A 2EULA 2GUZA 4O4LB 3ZMTA 1B6QA 5KAIZ 3IAYA 2HG5C 3SR2C 4W4KA 4K0KO 2X7RB 2DN9A 2IW5A 1XOUA 2LFSA 1WA8B 2YXYA 1AJPA 1ZUQA 3FX7A 1N36O 3RWRD 4JF3A 1JX9A 2QEXV 1TVKB 1AROP 1L0LH 4DW0A 2JVDA 1OCOC 1VMGA 3G6EV 4JYBA 1XMQO 3T1CA 2ZIMA 5L3EA 3N27A 1IURA 3E22B 2BE3A 5IYCO 1BMFG 4X65B 5EBLC 3JCZA 1N4CA 4NYKA 3L72H 1FYJA 2HKOA 1FXKC 4JAVA 1WP7A 4RQFA 2YSUB 3ABMB 1Q6UA 1QR9A 1Y76A 3DXRB 1JVMA 3E35A 2JJ1G 1DLBA 4XDLA 3K04A 4JYYA 1HNZO 1Q43A 3B40A 4X88A 3RVZA 1N33B 5EC2C 1K73W 5CB4A 2YEVA 1Y74B 3CMEV 3OMIB 1N34O 4TOIA 5IYZA 5EYPA 4U3FH 2W6JG 2R9AA 3OD4A 4IIJB 2UUBB 5JJEB 5LMUO 2PI4A 1IXMA 2ZM6O 2KKWA 3GB7C 2ZIOA 1YF2A 4DR6O 1YXBA 2IJKA 1ZL8A 1SA0B 3TETA 4UFZA 1M5IA 4PHZA 3SJBC 1NI8A 3KKYA 1QBZA 3K5NA 1S5JA 3M8AA 4ABMA 4X20B 1MOFA 2R72A 1B04A 1OCZB 1SQVH 1XI1A 2F4VB 4O2AA 4DUYO 2XOKG 1M93A 1RP3B 1N32O 1K9MW 1I94B 2OT5A 4IYIA 2YIBD 2Q69A 4DR4B 2ZQMA 1Q7YW 2R70A 3E8HA 2L35A 4PA4A 1AJQA 2E76B 3A0HZ 1PD3A 1BS3A 2N74A 3P3PA 2QWOB 1VQMV 1OHHG 2BTQB 1RSOB 2WLLB 4DV3O 2JJ2G 5K1PA 1SS3A 2XAGA 3RYIB 3T1YB 1MABG 1R1BA 4JYAB 4A5UB 2PZSA 3O9OA 4LNUB 4RQEA 4MSWC 1HNWO 2IM9A 3ASNB 5B5EZ 4FLVA 2P67A 4TSFG 4TT3G 3P3NA 1ENVA 4CS2A 3K3WA 4I5SA 3CC4V 2EILB 2NN4A 1PNMA 1IBKO 3G71V 4JI0O 4MTGA 4O4HA 2P22C 3APOA 1KKDA 3CWBH 1AB3A 5LYJA 3JATA 2ZE6A 4DR2O 3T1HB 3CX5F 3A0BZ 4HBNA 2JDIG 3ML0A 4KFMA 4IT5A 1Y67A 2CUGA 1BT8A 2YS8A 3JAWA 1J5EO 3MHSC 2A79B 4AQYO 4B3RB 4H44B 3W7UA 3KZIZ 4DXWA 4JI4B 2Q7EA 4YHHB 3ICXA 4P30A 2QWQB 4DV0O 3EFFK 1ZAUA 1YIJV 3APQA 4UV9A 1YJWV 1V55B 4FIPC 1PP9H 3ZHVA 4B3SO 3TXQA 2DYRC 3JD0A 2CH7B 4YY3O 2EX3A 4CBCA 2QM8A 5LXTA 4E2LA 4X66B 1FD9A 1W2BU 3F7YC 4GX2A 2HJDA 3L74H 3LDEA 3AG3C 3K5OA 4JI2O 4Z2WA 4QE7A 1JMKC 1BE3H 3L75H 1IBLO 1WN7A 5BR8O 2YC0A 4JV5B 5HFLA 2MW2B 3ZIAG 3X2QC 1K5QA 3OUFA 4X1YB 3B8NA 2AZ2A 1SQGA 3I5DA 5C8YB 5JVDA 2YI9A 2UUCO 1H8HG 1YJ9V 2EZOA 1FXHA 5CN0A 4O4IA 3WB2A 4B3TB 2XAFA 3HKCB 2P90A 4JI7B 4H0LB 3E2EA 5BXZA 3FB8C 2WWWA 1YEWA 4HAMA 4ZOLA 4RAIA 2DWEC 1HWYA 2ADQB 3RYFB 1SESA 1Q3EA 2JS3A 1EN4A 5B66Z 4J7ZA 4JTAB 1VARA 3ABUA 4TV8B 1Y6XA 4O4JB 4R7CA 2JEUA 3Q4HB 1GMGA 5JQGB 2DQ0A 2QE7G 5KX5B 3SPIA 4X1KA 3WG7C 5H6QA 3B77A 2P4VA 4FK5C 1SERA 2BTOA 3DC6A 3BAAA 4FMTA 2QTSA 1Q82W 4CC6A 5GONB 4JTCB 2F95B 5BMVB 1BCCH 1IBMB 1G8MA 2F1MA 3JSNA 4PI0A 3RBZA 5L3BA 2QDOA 4L87A 2A9HA 1IVSA 3K0DA 4HZ3A 3AG3B 1KECA 3K03A 2K9PA 1K8AW 4MVUA 3JALB 2CGOA 3T4DA 4JI8B 5J2UA 1BL8A 2B9ZA 3IC9A 1N8RW 3STLC 3ETQA 2ZE7A 1TUBA 2CDYA 1KQSU 4FM1A 3CRMA 2E5LB 1GH6A 1US6A 4MW8A 2CTPA 2M6YA 2UXBO 2NR5A 3RYHB 5IE9A 1YDXA 1P7BA 1R3LC 5CA1B 4U3JB 2KSDA 1V9PA 3HKDA 2AXTZ 1KC8W 1F7YA 1GRJA 4I7ZB 1Q86W 1I7FA 1HR0B 1VF5B 4DV4B 2JGUA 5EK0A 2GBOA 2OIEA 2P7TC 5KHIA 3OR7C 1VQ8V 3ETDA 3K08A 4MVOA 1GM9A 3HKEA 1XDCA 2OCCB 5GW7A 3H1HH 5IDJA 4YJ2A 3H01A 3HR0A 1VQOV 3SPHA 3FYEB 4O4LA 3JD4A 4XDJA 4WF9V 3WU2Z 2PF4E 3CCQV 3K9SA 5JCOA 3T2MA 1Q81W 1E1QG 4LFCO 1L8DA 5B3SC 4AHCA 4ZKIA 1MNGA 4DRXA 4FFKA 2NLJC 1W0JG 3A0RA 1VQ4V 1JA8A 3VQYA 1SQFA 1TVKA 1XHZA 4LFAB 3HKBB 3JYCA 5ITZA 3L70H 1DGSA 5J9PC 4GLXA 2R9IA 2Y4UA 2ZXWB 3C90A 2EIKB 5FPOA 3VOUA 1SQQH 3CJHB 3N2KB 5FNVA 5CMUA 3CRAA 5L3DA 1I94O 1OCCB 1K97A 1NVPB 2LW1A 3ZHTA 3P32A 3UM7A 3UQ8A 4GKKB 3CCSV 2UXXA 4MTXA 1V54C 1M4UA 3JARA 1YI2V 2KB1A 5LHHA 2XASA 2EJ7A 3CCUV 2QGNA 3ZRSA 3OE7G 4DW1A 4ASUG 1R3IC 3T1YO 3UO3A 2EBOA 1MG1A 5IT9N 4G28B 2PY5A 5BY1A 1NR1A 4CS3A 1XHXA 2Q9LA 4K8XA 2ITDC 3CCEV 1Q6HA 2WLNA 3UT5B 2CTWA 1WPBA 2ETNA 4JI5B 5L3GA 2XHBA 4DYLA 5EBMC 4PA9A 1MSDA 2JIZG 4IIJA 4F4LA 3DC5A 3MAQA 2HVKC 1YJNV 3E8GA 2P5OA 1O9HA 4DR5B 3FAVA 2KG7B 3SJAC 3OM3B 1LUVA 4LF5O 5F2VO 4IL6Z 1JNBA 3B2EE 3LSQA 1EZJA 2LW7A 1S72V 4X64B 4X20A 2AHZA 2A0LA 2Q0OC 4MVZA 3G80A 1XREA 4B3RO 3S3XA 5LBQA 4JI4O 1BQ0A 1D5AA 3E86A 3G67A 4BWAA 4AILC 4LF8B 1AI6A 1R3JC 4MVSA 2VQEO 3ABKC 4NXNB 3R66A 4EEQA 2CK3G 3JASA 2BTQA 1WJZA 1D2DA 2X0LA 1AP5A 2P6JA 3CCMV 3CS5A 3RYIA 1H2LA 3BPZA 1J95A 2E74B 2P4KA 1I08A 3SYPA 2OTLV 1VF6C 2K1EA 1PNLA 4X1IA 1IZ3A 5JH7A 3JAKB 4LNUA 4NVPA 1U97A 2EIMB 5B1BB 1ZWIC 2Y69B 3K0GA 4TV9A 1YTFB 1GM8A 1QU7A 1NS1A 2EIJB 2B1GA 4TWKA 4JV5O 4K8ZA 2Z5UA 4Z1MG 4DK1A 1H2GA 4TUYA 4B3TO 2QKAA 4GX0A 4JI7O 1M56C 5LP6C 1AI4A 4LCUC 1VIBA 1SQXH 2VRZA 3DGEA 1XNRB 4H13B 4YJ3A 4J9YB 4FJCC 4OPHA 2BCCH 2JK5C 3CCRV 1CPYA 3IGAC 2ZDIA 3U0ZA 3CC2V 5H2FZ 5LMNO 2FKXA 3ZBHA 3ABLB 3LSSA 1ZSPA 5CA0A 2P06A 4BIOA 4LR3A 4DV2B 2O57A 2C2AA 2XTAA 4YXWG 1SZTA 2WLIB 1X4TA 4FZ0A 5A2QN 5LGTA 3H1IH 2IU0A 1AP6A 1H2KA 4ZIBA 4LP8A 4UCSA 5E1AC 3BY6A 3JSLA 1YVWA 3OR6C 5B1AC 4K35A 4DV6B 3DTUB 2HJFC 2EINB 1K34A 1IBMO 3OTFA 4PDRA 3FKSG 2DWDC 4X1YA 4U7NA 4JI6O 4XDKA 5C8YA 1SC5B 1AI5A 2IH3C 4DR1O 5B1OA 2AGAA 1CEZA 1Q90D 3BRCA 2N05A 3MDSA 4JPRA 3SDLA 4EFEA 2CE4A 3SPJA 4PA6A 2D3OW 3OFNG 3BEHA 1R6NA 2IJJA 4UVCA 1YZBA 2BOCC 3RFRA 4X8AA 2V1DA 3AK3A 4MT8A 3CPWU 2HR3A 3U10A 3RYFA 1QHTA 2JS5A 4WBNB 4DV5B 1XNQO 2ZDIC 4JI3B 1XMOO 1GKFA 1OCOB 4WFHA 5LOVA 1H2NA 2WPDG 3AG2C 4R8CA 4J42A 4DUZO 2L6LA 4QE9A 4UCOA 3Q4HA 2RN9A 3ZRWB 1OV9A 2JGDB 1RPOA 2DJVA 1JPXA 3CYOA 3AG1C 5KX5A 3LUTB 1FXKB 4DV4O 4JASA 3JD1A 1HW7A 3RYCB 4TQDA 4LWSB 3E8FA 4BW9A 3U11A 2M7WA 4NR1A 1M57C 1SKVA 3H9VA 1FAFA 3C3SA 2BSKB 4P9OA 4LF4B 1KP2A 5AG2A 5C93A 2ZKOA 1E79G 3M7MX 1N0JA 3ZHRA 2W0FC 4JZGA 5H6RA 2GUZB 2Q68A 1ZTEA 1KKCA 4EFBA 3D36A 1Z5VA 2A06H 4Z1VA 4L8JA 3ZMZA 4OX9B 1KYOF 3SJCC 4I55B 1KU9A 3ZCCA 3SYAA 1QLEC 3WFVA 1NTKH 1Q5OA 3E8BA 3OT7A 4BIZA 2Q4PA 1FS0G 3J81N 4PELA 4LFAO 2UU9B 5LHIA 4JI1B 1R3KC 5LL6Y 2ZE5A 4LF6B 3RYHA 3VQWA 4FZ1A 2UXDO 3F5WC 1WP8A 4UXNA 5IYBO 4X62O 2HHHB 2VS0A 1PL4A 5BZBA 1KB9F 4ICGA 4KHPO 4GX5A 1WLEA 3BFRA 3HPLC 1XUQA 4DV7O 1NH2D 3ZHSA 4DR7B 1LR1A 3MHHC 4BAYA 2ATKC 2GV9A 2UUAB 3LDCA 1URFA 4UCUA 1PNKA 2RJZA 1EN6A 1SZXA 2LP7A 4W4LA 1Y76B 1R6TA 1WAZA 3OMNB 1MZFA 4IYHA 2DYSC 2KQXA 3ASOC 5DM6V 3ETEA 3OEEG 5CB4B 3IFXA 5KA6A 4JI5O 1XQ8A 3FB5C 5EYPB 3SGIA 4CH6A 4DR3B 3D36C 1XBLA 2OWOA 2R9RB 3CRCA 2F66C 1A32A 3SYCA 1VQ6V 1EFRG 1N36B 2IU3A 1ZL8B 4UVAA 1TGOA 1S5LZ 4R50A 4FPPA 3B09A 4FLWA 4F6RA 4N23A 3CEIA 1F4MA 3TJTA 3M99B 4X9QA 2HEPA 5KHJA 1N0NA 1XMQB 3UO2A 3CJHA 4O2AB 2QTOA 1Z5WA 2ZD9A 4O2BA 1BGYH 2AZ0A 1GO3F 3CRQA 3AG7A 3G6BA 4LC1A 4LF8O 1Y4MA 4NTWA 2CTQA 4FFBA 4J7JA 2QKCA 3JD3A 5LGUA 4NXNO 3ZN1A 5IWAO 4I4TA 2DYRB 3HB3B 1G6UA 4LH6A 1S5HC 2LJ2A 4J41A 2XNDG 3N2GA 2FMLA 2Q67A 2YUAA 2FB5A 4EB6A 5KMGB 3BABA 4CH5A 3FFQA 4LF9B 3W7XA 5KHGA 2WA3A 1H38A 1WB8A 1XILA 4ZBMA 3F5TA 1FFXA 2LFRA 4LF7B 2DE0X 1QVFU 3CHXA 3OMAB 2ZM6B 3X2QB 2KG7A 4WFAV 4OXSA 5K1XA 4DR6B 3ABTA 3ETGA 1QR8A 5JWPA 1VQNV 4O4HB 4CH4A 2YIAA 1COWG 4X89A 3A8TA 3MD0A 3QVNA 1B3QA 5LYJB 4UCRA 2ODMA 2MK3A 3JATB 4B3MB 5EC1C 3AG4C 3K9AA 2JRIA 5L3CA 4RUEA 1XNRO 3JAWB 3QNEA 4X65O 2OTJV 1RM1C 1ZX3A 1F51A 2N04A 4Q6GA 1FFTB 4FM2A 4ZI7A 4HNAB 4I9QA 2HFEC 3ZN0A 2RNBA 3EHBB 2QR4A 1CXZB 2V4DA 3CXCU 4YIOA 4H37A 4J7KA 1BSMA 4DV3B 5EZYB 4DV2O 2Y0PA 2RDCA 5L3FA 4I50A 3CXHF 5LXTB 5IY5C 4ZHQA 1G1XB 3ZS8C 5IJ0B 1N33O 5J2TA 3WG7B 1M90W 2YXHA 2ADPA 2AW9A 1YSCA 5JJNB 1VQLV 3THOA 4GKJB 3NR7A 2QSAA 2UUBO 4DV6O 4KL1A 1DF5A 5D5QA 1WA8A 3LDDA 2GTSA 5JVDB 1P84F 1EN5A 1KD1W 2CAZC 4O4IB 4UB6Z 5CBHA 1OCRC 2F4VO 1K4CC 1Q6IA 2PTMA 3E22A 5B1NA 1JR9A 2YIDA 1J5EB 4ZOLB 4DR4O 1TUEB 1X59A 1GN4A 2WLKA 5KAFZ 1I5YA 1VP7A 5CA3A 3LNMB 1K92A 1IX9A 4MTFA 4H33A 2WLMA 4QJFB 4BW5A 1ROPA 4FLYA 4B3SB 3DXRA 1H8EG 1UFIA 2ZNJA 1ZLZA 4FLTA 2WLIA 1YITV 4AI8A 3JD2A 4X1KB 4JYAO 1Y74A 3PN1A 4I0XB 1AR4A 3SJQC 2GHYA 4JI2B 5JJJB 1NU1H 3KCYA 4RUFA 4FVMA 2IBZH 4NKGB 5JCOC 5BR8B 1NQTA 4LF4O 2GTAA 3CC7V 2WA4A 2QA4V 4CS4A 4IHJB 1SA0A 3H1KH 1VQKV 3K5LA 4J9ZB 3WB0A 1QLNA 1JCHA 3JAMN 4QGPA 5EBWC 1HDJA 1JJOA 2E75B 1LNQA 4NTYA 3CE2A 3T1HO 4C7UA 5J2UB 3BCCH 4NXMB 5B3SB 1PM9A 4PI2A 3FD9A 1JJ2U 3H1LH 4NB5A 1YHQV 2A3QA 4UCVA 4YHHO 4WFBV 2VWKA 3A2FA 4LF6O 4OGQB 3GWKC 3RW0A 3ZHUA 2UXCB 1F23A 3ABMC 1JQ0A 2HHHO 1RSOA 2WLLA 3HKDB 5IJ9B 2Q7GA 3F7VC 4G2KA 3CD6V 2JGDA 1B06A 5CBGA 4JZ2A 3ZRVA 1XL6A 2X6BA 3RYCA 4X66O 4DR7O 1V54B 4J80A 2UUAO 1NZ6A 3FB7C 1JFFB 4PV1B 5FPRA 2WAMA 1G4YB 3AEIA 2OCHA 2YXLA 4GT1A 4LFBB 3IJ4A 2AHYA 2HVJC 1K7DA 1W59A 3B4SA 1LUWA 3HKEB 1VF7A 1NH2B 1EZVH 4YJ2B 1L0NH 4MVQA 4FLZA 2Q8VA 3RN4A 5EIBC 4DR3O 4I9WA 2XAJA 1OCZC 4N21A 1I0HA 4I55A 4F6EA 1KUQA 1K33A 3OTOB 2PI5A 4DRXB 1OJHA 2Y4TA 4MS2A 4BIUA 1S0VA 2ZE8A 5ITZB 4DV1B 3I55V 2PGGA 2UXBB 3L73H 1SQPH 4HYOA 4EKWA 2B5UA 1GTOA 5FNVB 3EXAA 2CH7A 2IJIA 2PYLA 1DF4A 4D6TH 2BOBC 3S3WA 3JARB 2LGWA 3ABKB 3K5MA 5LA6B 2ZCEA 5A9GA 3ASNC 1JOYA 4JGSA 1GN2A 3K79A 1P49A 3QTCA 2F43G 3BHPA 1YCIA 4E4EA 1PKXA 2EILC 4QNHB 4PA7A 2B1IA 3CCJV 3JCUZ 1NTMH 4LF9O 2XAHA 1TAEA 1Y66A 1UJWB 1P7GA 2DOSA 4WCEV 4GYCB 1VQ7V 3HKCA 4PDVA 1BHAA 4JI8O 1FXVA 1SQBH 4LF7O 4LFCB 3FAVB 4UVBA 4GX1A 4G27B 2LQTA 1NVPD 2EZPA 1VQPV 1NTZH
chains in the Genus database with same CATH topology
1LUWA 1VARA 1ZLZA 1LUVA 1GN3A 3C3TA 1XDCA 3RN4A 1MMMA 1Y67A 1BT8A 3C3SA 1AR4A 1ZSPA 1GN6A 5AG2A 1I0HA 4F6EA 3LSUA 1AVMA 2GDSA 1N0JA 1IDSA 3K9SA 3CEIA 4JZGA 3DC6A 3TJTA 1XREA 1VEWA 4YIOA 4X9QA 1BSMA 1ZTEA 1KKCA 1AP6A 1MNGA 1N0NA 3KKYA 4FFKA 4YIPA 1MA1A 1JA8A 1IXBA 3KDRA 2RCVA 3AK1A 2ADPA 3OT7A 2AW9A 4C7UA 1WB7A 1AP5A 1PM9A 2QKCA 1ZUQA 1EM1A 3AK2A 4GUNA 2P4KA 1I08A 3IC9A 1D5NA 1BS3A 3MDSA 2CE4A 2CDYA 1PL4A 1EN5A 5A9GA 3BFRA 1GN2A 1XUQA 3AK3A 4E4EA 1AR5A 1WB8A 1B06A 1XILA 4JZ2A 1JR9A 1EN6A 1SZXA 1P7GA 3EVKA 1GN4A 2QKAA 2ADQB 4JYYA 1QNMA 4BR6A 1IX9A 1MSDA 3QVNA 3DC5A 1EN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUW A;  1VAR A;  1ZLZ A;  1LUV A;  1GN3 A;  3C3T A;  1XDC A;  3RN4 A;  1MMM A;  1Y67 A;  1BT8 A;  3C3S A;  1AR4 A;  1ZSP A;  1GN6 A;  5AG2 A;  1I0H A;  4F6E A;  3LSU A;  1AVM A;  2GDS A;  1N0J A;  1IDS A;  3K9S A;  3CEI A;  4JZG A;  3DC6 A;  3TJT A;  1XRE A;  1VEW A;  4YIO A;  4X9Q A;  1BSM A;  1ZTE A;  1KKC A;  1AP6 A;  1MNG A;  1N0N A;  3KKY A;  4FFK A;  4YIP A;  1MA1 A;  1JA8 A;  1IXB A;  2RCV A;  3AK1 A;  2ADP A;  3OT7 A;  2AW9 A;  4C7U A;  1WB7 A;  1AP5 A;  1PM9 A;  2QKC A;  1ZUQ A;  1EM1 A;  3AK2 A;  4GUN A;  2P4K A;  1I08 A;  3IC9 A;  1D5N A;  1BS3 A;  3MDS A;  2CE4 A;  2CDY A;  1PL4 A;  1EN5 A;  5A9G A;  3BFR A;  1GN2 A;  1XUQ A;  3AK3 A;  4E4E A;  1AR5 A;  1WB8 A;  1B06 A;  1XIL A;  4JZ2 A;  1JR9 A;  1EN6 A;  1SZX A;  1P7G A;  3EVK A;  1GN4 A;  2QKA A;  2ADQ B;  4JYY A;  1QNM A;  4BR6 A;  1IX9 A;  1MSD A;  3QVN A;  3DC5 A;  1EN4 A; 
#chains in the Genus database with same CATH topology
 2E5L O;  1H2M A;  2HP8 A;  1M56 B;  5LP6 B;  4B3M O;  4P9P A;  2VWJ A;  1V55 C;  1R73 A;  4TV8 A;  3TXS A;  1GM7 A;  4O4J A;  1BHB A;  3OGC C;  1ORQ C;  4MTO A;  5JQG A;  3GVM A;  3SYQ A;  1HR0 O;  4MW3 A;  1IDS A;  1NKD A;  2VQF B;  1SET A;  1L1F A;  1IJG A;  4IGG A;  3JAS B;  1E1R G;  5E79 Z;  5GON A;  2RCV A;  3ZRX A;  1HNX B;  5H9C A;  5BMV A;  3GWO A;  1FJG B;  2YDE A;  3CRR A;  1AR1 B;  3SPG A;  5KMG A;  4X1I B;  5JH7 B;  2Y0I A;  2H3O A;  3OAA G;  4MVR A;  3H1J H;  4XBF A;  2H8P C;  4GKJ O;  5B1A B;  2Q73 A;  3JAL A;  4TV9 B;  2D2C B;  2WLH A;  3OW2 U;  4FLX A;  1U96 A;  3OGI B;  3W7W A;  1W0K G;  4CH3 A;  2GSM B;  4J10 A;  4K3A A;  5TIS Z;  5H5N A;  3UCS C;  2ZIN A;  4LF5 B;  3ZMU A;  2EJR A;  1BZK A;  2ILM A;  4OPA A;  2Q7H A;  1VQ9 V;  2W6I G;  2LO1 A;  4TUY B;  4D7S A;  5CA1 A;  3CP1 A;  1AJN A;  3I56 V;  1H5W A;  4KXR A;  4U3J A;  5D5P A;  3FB6 C;  2JEX A;  4YJ3 B;  1K4D C;  3L71 H;  5HFM A;  1QNM A;  1P4R A;  4GKK O;  5KLV H;  1GK9 A;  3QO8 A;  4NTX A;  2DQ3 A;  3LNN A;  4HNA A;  4LBE C;  1NR7 A;  3AG2 B;  2VQE B;  4D7T A;  2OIG A;  2CGN A;  1PPJ H;  3K58 A;  3SPC A;  1YTF D;  5CA0 B;  4JAU A;  5EZY A;  4JTD B;  3R65 A;  5GTI Z;  4KP4 A;  3AG1 B;  4QPJ A;  5IJ0 A;  3LSU A;  1T5E A;  2YEV B;  2YI8 A;  1QCE A;  2X6C A;  2Q5Z A;  5IYZ B;  1DK1 A;  1M57 B;  2Z0A A;  3QO7 A;  4GCZ A;  1RFY A;  1F4N A;  4YIP A;  1BQZ A;  2QM7 A;  4K0K B;  2H94 A;  2F93 B;  4DR5 O;  1VQ5 V;  4B7E A;  2QWN B;  1DTO A;  2QKS A;  3HKB A;  1WB7 A;  3RVY A;  1PL0 A;  4X64 O;  4CZZ A;  1NT2 B;  2ARH A;  4PA3 A;  4GUN A;  4PJ0 Z;  4NXM O;  1QQC A;  3N2K A;  1QLE B;  5KA5 A;  5CBF A;  5GTH Z;  1KMI Z;  2NNU A;  5LHG A;  4RO2 A;  4KUM A;  4WFF A;  5LOV B;  5LMN B;  2UXC O;  4Q20 A;  2E3C A;  2YIC A;  3EVK A;  3BVO A;  1HNZ B;  2YIB A;  1WPX A;  3VQX A;  3E89 A;  2OCC C;  2PYJ A;  4I0X A;  5EIB D;  3UT5 A;  3G4S V;  1N34 B;  4WFE A;  4PDM A;  2QWR B;  3OUS A;  2ZNI A;  4LFB O;  5LMU B;  1GN3 A;  2CTR A;  1UPG A;  2DYS B;  3RGB A;  3IC7 A;  3SYO A;  1KP3 A;  3CCV V;  3W7S A;  3ASO B;  4IHJ A;  1CP9 A;  4JI6 B;  4DR1 B;  3QG5 A;  2GDS A;  3W7T A;  5FLX N;  1VEW A;  2ZXW C;  2EIK C;  4P2Z A;  4DUY B;  3TK1 A;  3OTO O;  3NXS A;  3J80 N;  1M9N A;  1N32 B;  1SF9 A;  1OCC C;  5DED A;  2A7W A;  4JAA A;  1XNQ B;  4DV1 O;  1XMO B;  2DW4 A;  2RQ6 A;  3STZ C;  4DUZ B;  1EM1 A;  3AK2 A;  5IJ9 A;  1QVG U;  3D3I A;  4TQF A;  1Q8I A;  2XT9 A;  3JAK A;  1THZ A;  4QIW F;  1JFF A;  1K3E A;  4PDL A;  1O9G A;  1HNW B;  3O65 A;  2FL4 A;  3CCL V;  1K5S A;  3D3Q A;  2XAQ A;  1WNS A;  4J11 A;  2Y48 A;  5KUM A;  2IH1 C;  3RT3 C;  1Z2G A;  2X6A A;  1IBK B;  4JI0 B;  1R6K A;  1SRY A;  3FYI B;  1XEQ A;  3VBB A;  4DR2 B;  3ZHQ A;  4JYC A;  4FLU A;  1FKA O;  3QO5 A;  2XUM A;  3C3T A;  4AQY B;  4B08 A;  3CB2 A;  5KHH A;  4B7K A;  3ZED A;  1I5X A;  1MMM A;  4DV5 O;  4JI3 O;  4UUJ C;  4F6R B;  1NBM G;  4DO2 A;  4DV0 B;  3VQV A;  1S77 D;  2UXD B;  3DSQ A;  3E83 A;  3AG4 B;  4MVM A;  5DEC A;  4X62 B;  4O2B B;  3TGU H;  4YY3 B;  3ZMS A;  1RM1 B;  4KHP B;  3WB1 A;  3PJS K;  2UXN A;  1S76 D;  4DV7 B;  2IJH A;  3K59 A;  2VQF O;  1IXB A;  3KDR A;  3AK1 A;  4FFB B;  1S3J A;  2G38 A;  2RMK B;  5LA6 A;  5KHK A;  2EIM C;  2OYQ A;  4I4T B;  5B1B C;  1H2S B;  2Y69 C;  1IBL B;  1HNX O;  2EIJ C;  4UV8 A;  3KCX A;  3ZMV A;  3UKM A;  4QPK A;  1FJG O;  2ITC C;  5IY5 B;  4GZR B;  3CSX A;  1VF6 A;  3N2G B;  3ZJZ A;  2V7Q G;  1D5N A;  2HLD G;  4EB6 B;  5LGN A;  2UUC B;  3K06 A;  2LGQ A;  5FL7 G;  4WFG A;  1OZ0 A;  2Q6A A;  3T4Z A;  1KBH A;  1FFX B;  4OX9 O;  4LH7 A;  2Z3Y A;  3CMA V;  1AR5 A;  5KUK A;  1GAX A;  1NJI W;  1HP8 A;  5IYD O;  4DK0 A;  2ZT9 B;  1TUB B;  3B8M A;  4PD4 F;  3K57 A;  2UU9 O;  4WBN A;  1XL4 A;  4JI1 O;  2WSS G;  2ZR3 A;  5LP6 A;  1OCR B;  4U7O A;  2W0X A;  2DMX A;  1AI7 A;  1TA8 A;  3ABL C;  4BR6 A;  2WLJ A;  2ZR2 A;  3KG2 A;  2PUS A;  2FTK A;  3P30 A;  1EBO A;  1FOU A;  3ZRW A;  3L9D A;  4FM0 A;  4R6Z A;  1FXK A;  3OEH G;  2QWP B;  4CC5 A;  2QM4 A;  4LWS A;  4ZI7 B;  1RPR A;  3QF7 A;  5DN6 G;  2QJ1 A;  1GN6 A;  3TCU A;  5IWA B;  1PV0 A;  1M1K W;  1AVM A;  2BSK A;  2Q0A A;  3BA8 A;  2EIN C;  1MZE A;  4I50 B;  4UCT A;  4ZHQ B;  2F23 A;  3J7A U;  1MSW D;  2FYU H;  4UB8 Z;  5J2T B;  3BA9 A;  4RWU A;  1FPO A;  3D8C A;  1AIL A;  3ZX6 A;  1MA1 A;  2EUL A;  2GUZ A;  4O4L B;  3ZMT A;  1B6Q A;  5KAI Z;  3IAY A;  2HG5 C;  3SR2 C;  4W4K A;  4K0K O;  2X7R B;  2DN9 A;  2IW5 A;  1XOU A;  2LFS A;  1WA8 B;  2YXY A;  1AJP A;  1ZUQ A;  3FX7 A;  1N36 O;  3RWR D;  4JF3 A;  1JX9 A;  2QEX V;  1TVK B;  1ARO P;  1L0L H;  4DW0 A;  2JVD A;  1OCO C;  1VMG A;  3G6E V;  4JYB A;  1XMQ O;  3T1C A;  2ZIM A;  5L3E A;  3N27 A;  1IUR A;  3E22 B;  2BE3 A;  5IYC O;  1BMF G;  4X65 B;  5EBL C;  3JCZ A;  1N4C A;  4NYK A;  3L72 H;  1FYJ A;  2HKO A;  1FXK C;  4JAV A;  1WP7 A;  4RQF A;  2YSU B;  3ABM B;  1Q6U A;  1QR9 A;  1Y76 A;  3DXR B;  1JVM A;  3E35 A;  2JJ1 G;  1DLB A;  4XDL A;  3K04 A;  4JYY A;  1HNZ O;  1Q43 A;  3B40 A;  4X88 A;  3RVZ A;  1N33 B;  5EC2 C;  1K73 W;  5CB4 A;  2YEV A;  1Y74 B;  3CME V;  3OMI B;  1N34 O;  4TOI A;  5IYZ A;  5EYP A;  4U3F H;  2W6J G;  2R9A A;  3OD4 A;  4IIJ B;  2UUB B;  5JJE B;  5LMU O;  2PI4 A;  1IXM A;  2ZM6 O;  2KKW A;  3GB7 C;  2ZIO A;  1YF2 A;  4DR6 O;  1YXB A;  2IJK A;  1ZL8 A;  1SA0 B;  3TET A;  4UFZ A;  1M5I A;  4PHZ A;  3SJB C;  1NI8 A;  3KKY A;  1QBZ A;  3K5N A;  1S5J A;  3M8A A;  4ABM A;  4X20 B;  1MOF A;  2R72 A;  1B04 A;  1OCZ B;  1SQV H;  1XI1 A;  2F4V B;  4O2A A;  4DUY O;  2XOK G;  1M93 A;  1RP3 B;  1N32 O;  1K9M W;  1I94 B;  2OT5 A;  4IYI A;  2YIB D;  2Q69 A;  4DR4 B;  2ZQM A;  1Q7Y W;  2R70 A;  3E8H A;  2L35 A;  4PA4 A;  1AJQ A;  2E76 B;  3A0H Z;  1PD3 A;  1BS3 A;  2N74 A;  3P3P A;  2QWO B;  1VQM V;  1OHH G;  2BTQ B;  1RSO B;  2WLL B;  4DV3 O;  2JJ2 G;  5K1P A;  1SS3 A;  2XAG A;  3RYI B;  3T1Y B;  1MAB G;  1R1B A;  4JYA B;  4A5U B;  2PZS A;  3O9O A;  4LNU B;  4RQE A;  4MSW C;  1HNW O;  2IM9 A;  3ASN B;  5B5E Z;  4FLV A;  2P67 A;  4TSF G;  4TT3 G;  3P3N A;  1ENV A;  4CS2 A;  3K3W A;  4I5S A;  3CC4 V;  2EIL B;  2NN4 A;  1PNM A;  1IBK O;  3G71 V;  4JI0 O;  4MTG A;  4O4H A;  2P22 C;  3APO A;  1KKD A;  3CWB H;  1AB3 A;  5LYJ A;  3JAT A;  2ZE6 A;  4DR2 O;  3T1H B;  3CX5 F;  3A0B Z;  4HBN A;  2JDI G;  3ML0 A;  4KFM A;  4IT5 A;  1Y67 A;  2CUG A;  1BT8 A;  2YS8 A;  3JAW A;  1J5E O;  3MHS C;  2A79 B;  4AQY O;  4B3R B;  4H44 B;  3W7U A;  3KZI Z;  4DXW A;  4JI4 B;  2Q7E A;  4YHH B;  3ICX A;  4P30 A;  2QWQ B;  4DV0 O;  3EFF K;  1ZAU A;  1YIJ V;  3APQ A;  4UV9 A;  1YJW V;  1V55 B;  4FIP C;  1PP9 H;  3ZHV A;  4B3S O;  3TXQ A;  2DYR C;  3JD0 A;  2CH7 B;  4YY3 O;  2EX3 A;  4CBC A;  2QM8 A;  5LXT A;  4E2L A;  4X66 B;  1FD9 A;  1W2B U;  3F7Y C;  4GX2 A;  2HJD A;  3L74 H;  3LDE A;  3AG3 C;  3K5O A;  4JI2 O;  4Z2W A;  4QE7 A;  1JMK C;  1BE3 H;  3L75 H;  1IBL O;  1WN7 A;  5BR8 O;  2YC0 A;  4JV5 B;  5HFL A;  2MW2 B;  3ZIA G;  3X2Q C;  1K5Q A;  3OUF A;  4X1Y B;  3B8N A;  2AZ2 A;  1SQG A;  3I5D A;  5C8Y B;  5JVD A;  2YI9 A;  2UUC O;  1H8H G;  1YJ9 V;  2EZO A;  1FXH A;  5CN0 A;  4O4I A;  3WB2 A;  4B3T B;  2XAF A;  3HKC B;  2P90 A;  4JI7 B;  4H0L B;  3E2E A;  5BXZ A;  3FB8 C;  2WWW A;  1YEW A;  4HAM A;  4ZOL A;  4RAI A;  2DWE C;  1HWY A;  2ADQ B;  3RYF B;  1SES A;  1Q3E A;  2JS3 A;  1EN4 A;  5B66 Z;  4J7Z A;  4JTA B;  1VAR A;  3ABU A;  4TV8 B;  1Y6X A;  4O4J B;  4R7C A;  2JEU A;  3Q4H B;  1GMG A;  5JQG B;  2DQ0 A;  2QE7 G;  5KX5 B;  3SPI A;  4X1K A;  3WG7 C;  5H6Q A;  3B77 A;  2P4V A;  4FK5 C;  1SER A;  2BTO A;  3DC6 A;  3BAA A;  4FMT A;  2QTS A;  1Q82 W;  4CC6 A;  5GON B;  4JTC B;  2F95 B;  5BMV B;  1BCC H;  1IBM B;  1G8M A;  2F1M A;  3JSN A;  4PI0 A;  3RBZ A;  5L3B A;  2QDO A;  4L87 A;  2A9H A;  1IVS A;  3K0D A;  4HZ3 A;  3AG3 B;  1KEC A;  3K03 A;  2K9P A;  1K8A W;  4MVU A;  3JAL B;  2CGO A;  3T4D A;  4JI8 B;  5J2U A;  1BL8 A;  2B9Z A;  3IC9 A;  1N8R W;  3STL C;  3ETQ A;  2ZE7 A;  1TUB A;  2CDY A;  1KQS U;  4FM1 A;  3CRM A;  2E5L B;  1GH6 A;  1US6 A;  4MW8 A;  2CTP A;  2M6Y A;  2UXB O;  2NR5 A;  3RYH B;  5IE9 A;  1YDX A;  1P7B A;  1R3L C;  5CA1 B;  4U3J B;  2KSD A;  1V9P A;  3HKD A;  2AXT Z;  1KC8 W;  1F7Y A;  1GRJ A;  4I7Z B;  1Q86 W;  1I7F A;  1HR0 B;  1VF5 B;  4DV4 B;  2JGU A;  5EK0 A;  2GBO A;  2OIE A;  2P7T C;  5KHI A;  3OR7 C;  1VQ8 V;  3ETD A;  3K08 A;  4MVO A;  1GM9 A;  3HKE A;  1XDC A;  2OCC B;  5GW7 A;  3H1H H;  5IDJ A;  4YJ2 A;  3H01 A;  3HR0 A;  1VQO V;  3SPH A;  3FYE B;  4O4L A;  3JD4 A;  4XDJ A;  4WF9 V;  3WU2 Z;  2PF4 E;  3CCQ V;  3K9S A;  5JCO A;  3T2M A;  1Q81 W;  1E1Q G;  4LFC O;  1L8D A;  5B3S C;  4AHC A;  4ZKI A;  1MNG A;  4DRX A;  4FFK A;  2NLJ C;  1W0J G;  3A0R A;  1VQ4 V;  1JA8 A;  3VQY A;  1SQF A;  1TVK A;  1XHZ A;  4LFA B;  3HKB B;  3JYC A;  5ITZ A;  3L70 H;  1DGS A;  5J9P C;  4GLX A;  2R9I A;  2Y4U A;  2ZXW B;  3C90 A;  2EIK B;  5FPO A;  3VOU A;  1SQQ H;  3CJH B;  3N2K B;  5FNV A;  5CMU A;  3CRA A;  5L3D A;  1I94 O;  1OCC B;  1K97 A;  1NVP B;  2LW1 A;  3ZHT A;  3P32 A;  3UM7 A;  3UQ8 A;  4GKK B;  3CCS V;  2UXX A;  4MTX A;  1V54 C;  1M4U A;  3JAR A;  1YI2 V;  2KB1 A;  5LHH A;  2XAS A;  2EJ7 A;  3CCU V;  2QGN A;  3ZRS A;  3OE7 G;  4DW1 A;  4ASU G;  1R3I C;  3T1Y O;  3UO3 A;  2EBO A;  1MG1 A;  5IT9 N;  4G28 B;  2PY5 A;  5BY1 A;  1NR1 A;  4CS3 A;  1XHX A;  2Q9L A;  4K8X A;  2ITD C;  3CCE V;  1Q6H A;  2WLN A;  3UT5 B;  2CTW A;  1WPB A;  2ETN A;  4JI5 B;  5L3G A;  2XHB A;  4DYL A;  5EBM C;  4PA9 A;  1MSD A;  2JIZ G;  4IIJ A;  4F4L A;  3DC5 A;  3MAQ A;  2HVK C;  1YJN V;  3E8G A;  2P5O A;  1O9H A;  4DR5 B;  3FAV A;  2KG7 B;  3SJA C;  3OM3 B;  1LUV A;  4LF5 O;  5F2V O;  4IL6 Z;  1JNB A;  3B2E E;  3LSQ A;  1EZJ A;  2LW7 A;  1S72 V;  4X64 B;  4X20 A;  2AHZ A;  2A0L A;  2Q0O C;  4MVZ A;  3G80 A;  1XRE A;  4B3R O;  3S3X A;  5LBQ A;  4JI4 O;  1BQ0 A;  1D5A A;  3E86 A;  3G67 A;  4BWA A;  4AIL C;  4LF8 B;  1AI6 A;  1R3J C;  4MVS A;  2VQE O;  3ABK C;  4NXN B;  3R66 A;  4EEQ A;  2CK3 G;  3JAS A;  2BTQ A;  1WJZ A;  1D2D A;  2X0L A;  1AP5 A;  2P6J A;  3CCM V;  3CS5 A;  3RYI A;  1H2L A;  3BPZ A;  1J95 A;  2E74 B;  2P4K A;  1I08 A;  3SYP A;  2OTL V;  1VF6 C;  2K1E A;  1PNL A;  4X1I A;  1IZ3 A;  5JH7 A;  3JAK B;  4LNU A;  4NVP A;  1U97 A;  2EIM B;  5B1B B;  1ZWI C;  2Y69 B;  3K0G A;  4TV9 A;  1YTF B;  1GM8 A;  1QU7 A;  1NS1 A;  2EIJ B;  2B1G A;  4TWK A;  4JV5 O;  4K8Z A;  2Z5U A;  4Z1M G;  4DK1 A;  1H2G A;  4TUY A;  4B3T O;  2QKA A;  4GX0 A;  4JI7 O;  1M56 C;  5LP6 C;  1AI4 A;  4LCU C;  1VIB A;  1SQX H;  2VRZ A;  3DGE A;  1XNR B;  4H13 B;  4YJ3 A;  4J9Y B;  4FJC C;  4OPH A;  2BCC H;  2JK5 C;  3CCR V;  1CPY A;  3IGA C;  2ZDI A;  3U0Z A;  3CC2 V;  5H2F Z;  5LMN O;  2FKX A;  3ZBH A;  3ABL B;  3LSS A;  1ZSP A;  5CA0 A;  2P06 A;  4BIO A;  4LR3 A;  4DV2 B;  2O57 A;  2C2A A;  2XTA A;  4YXW G;  1SZT A;  2WLI B;  1X4T A;  4FZ0 A;  5A2Q N;  5LGT A;  3H1I H;  2IU0 A;  1AP6 A;  1H2K A;  4ZIB A;  4LP8 A;  4UCS A;  5E1A C;  3BY6 A;  3JSL A;  1YVW A;  3OR6 C;  5B1A C;  4K35 A;  4DV6 B;  3DTU B;  2HJF C;  2EIN B;  1K34 A;  1IBM O;  3OTF A;  4PDR A;  3FKS G;  2DWD C;  4X1Y A;  4U7N A;  4JI6 O;  4XDK A;  5C8Y A;  1SC5 B;  1AI5 A;  2IH3 C;  4DR1 O;  5B1O A;  2AGA A;  1CEZ A;  1Q90 D;  3BRC A;  2N05 A;  3MDS A;  4JPR A;  3SDL A;  4EFE A;  2CE4 A;  3SPJ A;  4PA6 A;  2D3O W;  3OFN G;  3BEH A;  1R6N A;  2IJJ A;  4UVC A;  1YZB A;  2BOC C;  3RFR A;  4X8A A;  2V1D A;  3AK3 A;  4MT8 A;  3CPW U;  2HR3 A;  3U10 A;  3RYF A;  1QHT A;  2JS5 A;  4WBN B;  4DV5 B;  1XNQ O;  2ZDI C;  4JI3 B;  1XMO O;  1GKF A;  1OCO B;  4WFH A;  5LOV A;  1H2N A;  2WPD G;  3AG2 C;  4R8C A;  4J42 A;  4DUZ O;  2L6L A;  4QE9 A;  4UCO A;  3Q4H A;  2RN9 A;  3ZRW B;  1OV9 A;  2JGD B;  1RPO A;  2DJV A;  1JPX A;  3CYO A;  3AG1 C;  5KX5 A;  3LUT B;  1FXK B;  4DV4 O;  4JAS A;  3JD1 A;  1HW7 A;  3RYC B;  4TQD A;  4LWS B;  3E8F A;  4BW9 A;  3U11 A;  2M7W A;  4NR1 A;  1M57 C;  1SKV A;  3H9V A;  1FAF A;  3C3S A;  2BSK B;  4P9O A;  4LF4 B;  1KP2 A;  5AG2 A;  5C93 A;  2ZKO A;  1E79 G;  3M7M X;  1N0J A;  3ZHR A;  2W0F C;  4JZG A;  5H6R A;  2GUZ B;  2Q68 A;  1ZTE A;  1KKC A;  4EFB A;  3D36 A;  1Z5V A;  2A06 H;  4Z1V A;  4L8J A;  3ZMZ A;  4OX9 B;  1KYO F;  3SJC C;  4I55 B;  1KU9 A;  3ZCC A;  3SYA A;  1QLE C;  3WFV A;  1NTK H;  1Q5O A;  3E8B A;  3OT7 A;  4BIZ A;  2Q4P A;  1FS0 G;  3J81 N;  4PEL A;  4LFA O;  2UU9 B;  5LHI A;  4JI1 B;  1R3K C;  5LL6 Y;  2ZE5 A;  4LF6 B;  3RYH A;  3VQW A;  4FZ1 A;  2UXD O;  3F5W C;  1WP8 A;  4UXN A;  5IYB O;  4X62 O;  2HHH B;  2VS0 A;  1PL4 A;  5BZB A;  1KB9 F;  4ICG A;  4KHP O;  4GX5 A;  1WLE A;  3BFR A;  3HPL C;  1XUQ A;  4DV7 O;  1NH2 D;  3ZHS A;  4DR7 B;  1LR1 A;  3MHH C;  4BAY A;  2ATK C;  2GV9 A;  2UUA B;  3LDC A;  1URF A;  4UCU A;  1PNK A;  2RJZ A;  1EN6 A;  1SZX A;  2LP7 A;  4W4L A;  1Y76 B;  1R6T A;  1WAZ A;  3OMN B;  1MZF A;  4IYH A;  2DYS C;  2KQX A;  3ASO C;  5DM6 V;  3ETE A;  3OEE G;  5CB4 B;  3IFX A;  5KA6 A;  4JI5 O;  1XQ8 A;  3FB5 C;  5EYP B;  3SGI A;  4CH6 A;  4DR3 B;  3D36 C;  1XBL A;  2OWO A;  2R9R B;  3CRC A;  2F66 C;  1A32 A;  3SYC A;  1VQ6 V;  1EFR G;  1N36 B;  2IU3 A;  1ZL8 B;  4UVA A;  1TGO A;  1S5L Z;  4R50 A;  4FPP A;  3B09 A;  4FLW A;  4F6R A;  4N23 A;  3CEI A;  1F4M A;  3TJT A;  3M99 B;  4X9Q A;  2HEP A;  5KHJ A;  1N0N A;  1XMQ B;  3UO2 A;  3CJH A;  4O2A B;  2QTO A;  1Z5W A;  2ZD9 A;  4O2B A;  1BGY H;  2AZ0 A;  1GO3 F;  3CRQ A;  3AG7 A;  3G6B A;  4LC1 A;  4LF8 O;  1Y4M A;  4NTW A;  2CTQ A;  4FFB A;  4J7J A;  2QKC A;  3JD3 A;  5LGU A;  4NXN O;  3ZN1 A;  5IWA O;  4I4T A;  2DYR B;  3HB3 B;  1G6U A;  4LH6 A;  1S5H C;  2LJ2 A;  4J41 A;  2XND G;  3N2G A;  2FML A;  2Q67 A;  2YUA A;  2FB5 A;  4EB6 A;  5KMG B;  3BAB A;  4CH5 A;  3FFQ A;  4LF9 B;  3W7X A;  5KHG A;  2WA3 A;  1H38 A;  1WB8 A;  1XIL A;  4ZBM A;  3F5T A;  1FFX A;  2LFR A;  4LF7 B;  2DE0 X;  1QVF U;  3CHX A;  3OMA B;  2ZM6 B;  3X2Q B;  2KG7 A;  4WFA V;  4OXS A;  5K1X A;  4DR6 B;  3ABT A;  3ETG A;  1QR8 A;  5JWP A;  1VQN V;  4O4H B;  4CH4 A;  2YIA A;  1COW G;  4X89 A;  3A8T A;  3MD0 A;  3QVN A;  1B3Q A;  5LYJ B;  4UCR A;  2ODM A;  2MK3 A;  3JAT B;  4B3M B;  5EC1 C;  3AG4 C;  3K9A A;  2JRI A;  5L3C A;  4RUE A;  1XNR O;  3JAW B;  3QNE A;  4X65 O;  2OTJ V;  1RM1 C;  1ZX3 A;  1F51 A;  2N04 A;  4Q6G A;  1FFT B;  4FM2 A;  4ZI7 A;  4HNA B;  4I9Q A;  2HFE C;  3ZN0 A;  2RNB A;  3EHB B;  2QR4 A;  1CXZ B;  2V4D A;  3CXC U;  4YIO A;  4H37 A;  4J7K A;  1BSM A;  4DV3 B;  5EZY B;  4DV2 O;  2Y0P A;  2RDC A;  5L3F A;  4I50 A;  3CXH F;  5LXT B;  5IY5 C;  4ZHQ A;  1G1X B;  3ZS8 C;  5IJ0 B;  1N33 O;  5J2T A;  3WG7 B;  1M90 W;  2YXH A;  2ADP A;  2AW9 A;  1YSC A;  5JJN B;  1VQL V;  3THO A;  4GKJ B;  3NR7 A;  2QSA A;  2UUB O;  4DV6 O;  4KL1 A;  1DF5 A;  5D5Q A;  1WA8 A;  3LDD A;  2GTS A;  5JVD B;  1P84 F;  1EN5 A;  1KD1 W;  2CAZ C;  4O4I B;  4UB6 Z;  5CBH A;  1OCR C;  2F4V O;  1K4C C;  1Q6I A;  2PTM A;  3E22 A;  5B1N A;  1JR9 A;  2YID A;  1J5E B;  4ZOL B;  4DR4 O;  1TUE B;  1X59 A;  1GN4 A;  2WLK A;  5KAF Z;  1I5Y A;  1VP7 A;  5CA3 A;  3LNM B;  1K92 A;  1IX9 A;  4MTF A;  4H33 A;  2WLM A;  4QJF B;  4BW5 A;  1ROP A;  4FLY A;  4B3S B;  3DXR A;  1H8E G;  1UFI A;  2ZNJ A;  1ZLZ A;  4FLT A;  2WLI A;  1YIT V;  4AI8 A;  3JD2 A;  4X1K B;  4JYA O;  1Y74 A;  3PN1 A;  4I0X B;  1AR4 A;  3SJQ C;  2GHY A;  4JI2 B;  5JJJ B;  1NU1 H;  3KCY A;  4RUF A;  4FVM A;  2IBZ H;  4NKG B;  5JCO C;  5BR8 B;  1NQT A;  4LF4 O;  2GTA A;  3CC7 V;  2WA4 A;  2QA4 V;  4CS4 A;  4IHJ B;  1SA0 A;  3H1K H;  1VQK V;  3K5L A;  4J9Z B;  3WB0 A;  1QLN A;  1JCH A;  3JAM N;  4QGP A;  5EBW C;  1HDJ A;  1JJO A;  2E75 B;  1LNQ A;  4NTY A;  3CE2 A;  3T1H O;  4C7U A;  5J2U B;  3BCC H;  4NXM B;  5B3S B;  1PM9 A;  4PI2 A;  3FD9 A;  1JJ2 U;  3H1L H;  4NB5 A;  1YHQ V;  2A3Q A;  4UCV A;  4YHH O;  4WFB V;  2VWK A;  3A2F A;  4LF6 O;  4OGQ B;  3GWK C;  3RW0 A;  3ZHU A;  2UXC B;  1F23 A;  3ABM C;  1JQ0 A;  2HHH O;  1RSO A;  2WLL A;  3HKD B;  5IJ9 B;  2Q7G A;  3F7V C;  4G2K A;  3CD6 V;  2JGD A;  1B06 A;  5CBG A;  4JZ2 A;  3ZRV A;  1XL6 A;  2X6B A;  3RYC A;  4X66 O;  4DR7 O;  1V54 B;  4J80 A;  2UUA O;  1NZ6 A;  3FB7 C;  1JFF B;  4PV1 B;  5FPR A;  2WAM A;  1G4Y B;  3AEI A;  2OCH A;  2YXL A;  4GT1 A;  4LFB B;  3IJ4 A;  2AHY A;  2HVJ C;  1K7D A;  1W59 A;  3B4S A;  1LUW A;  3HKE B;  1VF7 A;  1NH2 B;  1EZV H;  4YJ2 B;  1L0N H;  4MVQ A;  4FLZ A;  2Q8V A;  3RN4 A;  5EIB C;  4DR3 O;  4I9W A;  2XAJ A;  1OCZ C;  4N21 A;  1I0H A;  4I55 A;  4F6E A;  1KUQ A;  1K33 A;  3OTO B;  2PI5 A;  4DRX B;  1OJH A;  2Y4T A;  4MS2 A;  4BIU A;  1S0V A;  2ZE8 A;  5ITZ B;  4DV1 B;  3I55 V;  2PGG A;  2UXB B;  3L73 H;  1SQP H;  4HYO A;  4EKW A;  2B5U A;  1GTO A;  5FNV B;  3EXA A;  2CH7 A;  2IJI A;  2PYL A;  1DF4 A;  4D6T H;  2BOB C;  3S3W A;  3JAR B;  2LGW A;  3ABK B;  3K5M A;  5LA6 B;  2ZCE A;  5A9G A;  3ASN C;  1JOY A;  4JGS A;  1GN2 A;  3K79 A;  1P49 A;  3QTC A;  2F43 G;  3BHP A;  1YCI A;  4E4E A;  1PKX A;  2EIL C;  4QNH B;  4PA7 A;  2B1I A;  3CCJ V;  3JCU Z;  1NTM H;  4LF9 O;  2XAH A;  1TAE A;  1Y66 A;  1UJW B;  1P7G A;  2DOS A;  4WCE V;  4GYC B;  1VQ7 V;  3HKC A;  4PDV A;  1BHA A;  4JI8 O;  1FXV A;  1SQB H;  4LF7 O;  4LFC B;  3FAV B;  4UVB A;  4GX1 A;  4G27 B;  2LQT A;  1NVP D;  2EZP A;  1VQP V;  1NTZ H; 
#chains in the Genus database with same CATH homology
 1LUW A;  1VAR A;  1ZLZ A;  1LUV A;  1GN3 A;  3C3T A;  1XDC A;  3RN4 A;  1MMM A;  1Y67 A;  1BT8 A;  3C3S A;  1AR4 A;  1ZSP A;  1GN6 A;  5AG2 A;  1I0H A;  4F6E A;  3LSU A;  1AVM A;  2GDS A;  1N0J A;  1IDS A;  3K9S A;  3CEI A;  4JZG A;  3DC6 A;  3TJT A;  1XRE A;  1VEW A;  4YIO A;  4X9Q A;  1BSM A;  1ZTE A;  1KKC A;  1AP6 A;  1MNG A;  1N0N A;  3KKY A;  4FFK A;  4YIP A;  1MA1 A;  1JA8 A;  1IXB A;  3KDR A;  2RCV A;  3AK1 A;  2ADP A;  3OT7 A;  2AW9 A;  4C7U A;  1WB7 A;  1AP5 A;  1PM9 A;  2QKC A;  1ZUQ A;  1EM1 A;  3AK2 A;  4GUN A;  2P4K A;  1I08 A;  3IC9 A;  1D5N A;  1BS3 A;  3MDS A;  2CE4 A;  2CDY A;  1PL4 A;  1EN5 A;  5A9G A;  3BFR A;  1GN2 A;  1XUQ A;  3AK3 A;  4E4E A;  1AR5 A;  1WB8 A;  1B06 A;  1XIL A;  4JZ2 A;  1JR9 A;  1EN6 A;  1SZX A;  1P7G A;  3EVK A;  1GN4 A;  2QKA A;  2ADQ B;  4JYY A;  1QNM A;  4BR6 A;  1IX9 A;  1MSD A;  3QVN A;  3DC5 A;  1EN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...