3QVNA

Crystal structure of cytosolic mnsod3 from candida albicans
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
MITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVKLDYFKAIWNVINWAEAESRYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Manganese-containing superoxide dismutase
publication title Comparison of two yeast MnSODs: mitochondrial Saccharomyces cerevisiae versus cytosolic Candida albicans.
pubmed doi rcsb
source organism Candida albicans
total genus 73
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3qvnA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3qvnA02
4C7UA 2RCVA 3MDSA 2P4KA 1GN4A 3CEIA 1XUQA 1WB7A 1MNGA 1N0JA 2ADQB 1BS3A 1AR4A 1PL4A 2CE4A 3C3TA 1WB8A 3OT7A 2AW9A 1XDCA 1JR9A 3K9SA 4F6EA 1EN6A 5AG2A 3RN4A 1ZUQA 1AVMA 1EM1A 1VEWA 3KKYA 1N0NA 1QNMA 1I0HA 3AK1A 1ZLZA 1MSDA 1XREA 1AP5A 4YIPA 1P7GA 1B06A 3DC6A 1I08A 1AR5A 3DC5A 1ZTEA 1AP6A 1ZSPA 1LUVA 1EN5A 3QVNA 2QKAA 1D5NA 1VARA 4GUNA 5A9GA 3EVKA 1BSMA 3C3SA 1MMMA 1PM9A 4JYYA 1Y67A 3LSUA 3TJTA 2GDSA 4BR6A 1IDSA 1BT8A 1SZXA 4X9QA 4E4EA 1EN4A 1GN6A 4JZGA 1LUWA 1GN3A 3AK2A 3BFRA 2CDYA 4YIOA 1JA8A 1KKCA 3IC9A 1XILA 4FFKA 1IX9A 1IXBA 2QKCA 3AK3A 4JZ2A 2ADPA 1GN2A 1MA1A
chains in the Genus database with same CATH superfamily
4J9YB 1K3EA 1H5WA 3ETGA 3CP1A 3K03A 3EFFK 3ZN0A 2ZE8A 3ASNB 4XDLA 2OWOA 3DTUB 1SQGA 2EILC 1BHBA 3UCSC 1HNWB 5L3GA 5F2VO 5DEDA 5ITZA 4UVBA 4TSFG 1KMIZ 3CRAA 3SJBC 3A0HZ 3CPWU 3OR6C 2L6LA 3AG1B 2WLLA 4BW9A 4RUFA 3T2MA 2ZD9A 2JS3A 1Q6HA 5IYZB 4O4HA 5CB4A 2WLMA 3EHBB 5AG2A 2XUMA 1K92A 2E5LB 3CCUV 2CH7B 4J80A 4X88A 4X65B 2LP7A 3O65A 5J2TB 3E86A 4EKWA 1HNWO 3HKCB 3FB7C 4GYCB 4DUYB 2EZOA 2F95B 2QWPB 4FZ1A 1FXKC 1SZTA 4LH7A 4ZIBA 5EZYA 2UXBB 2K1EA 1Y76A 2E5LO 1KP3A 3EVKA 4ICGA 1OHHG 3OMNB 5J2UB 3CB2A 3STLC 3ZIAG 3KZIZ 2HKOA 1JVMA 1KECA 1DF4A 4BR6A 4DV6B 3CCRV 1IBKB 1QLEB 4UCVA 1SQPH 3PN1A 4PA9A 4D7SA 5KA5A 4RWUA 2F23A 2KB1A 4I0XA 4ZOLB 4DUYO 2DYRC 2UUCB 3WB0A 3FAVB 4TV9A 2QWOB 1AJNA 3ETEA 1XILA 2GTAA 2VQFB 1JPXA 2UXBO 4NXMB 3KDRA 4LC1A 3AK3A 4JZ2A 3K5MA 2P7TC 1PNMA 4O4IA 3E35A 5LMNB 4DV6O 1IBKO 3AG2C 3SYPA 2P4KA 1OCZB 4X8AA 5JQGB 2P06A 3N2GA 2OTJV 2UUCO 1VQNV 4LF9B 2VQFO 4NXMO 1QR8A 4MVOA 1O9HA 1XL6A 2KG7B 3LDCA 5LMNO 3QO5A 2F93B 3I5DA 1VP7A 4NTWA 4JI0B 4BIOA 2Q7HA 3LSQA 2EINB 4DXWA 1K7DA 3ABTA 3JD2A 3MD0A 3I55V 4R8CA 1N33B 2YXLA 4LF9O 1WJZA 2UU9B 2AHYA 2LFSA 3RWRD 3I56V 2EIKC 4EB6B 1YCIA 5B1AC 1JFFA 1D5AA 3RVZA 5JWPA 4GUNA 4JYAO 3VQWA 1BSMA 3ETDA 4JI0O 3MHHC 4LP8A 3N2KA 3CX5F 1QQCA 1XBLA 1R3KC 1N34B 3CD6V 4B7KA 1TUBB 3D3QA 1FXKA 1PD3A 3IGAC 1N33O 1FJGB 2DYSC 4YJ2B 5IJ9A 1LUWA 2UU9O 1BQZA 1MZEA 4F6RA 3K06A 2OCCC 1WPXA 1L0LH 3QNEA 2CTWA 4FFKA 2YI9A 4DW0A 5BMVA 4U3JA 1MA1A 3UO2A 2X7RB 3H01A 1Q3EA 4NYKA 4I4TB 3D3IA 2BTOA 3CMEV 1N34O 1VQKV 1L0NH 1RSOA 1US6A 2LFRA 3WG7B 2JDIG 1FJGO 1A32A 4P30A 3CJHB 4PA4A 2M6YA 4X66O 3JD4A 1PNLA 1AROP 4W4LA 1DTOA 5JCOA 1JQ0A 2IJIA 3QO8A 2Y69C 4DV3B 2H94A 5B1BC 4CC5A 1H8HG 1HW7A 4LR3A 2KQXA 3G71V 2GBOA 4UVCA 4MW3A 1VQ5V 1VQLV 2ZQMA 2JGDB 3F7YC 4RQFA 3FB5C 2VQEO 1AR5A 3OEHG 3RYCB 1AP6A 5EYPB 1G8MA 4JYCA 4N23A 4DV3O 4DV7B 1YDXA 3JD0A 2Z3YA 3RYIB 3C3SA 2X6BA 3F5WC 4X1YB 4HAMA 1BT8A 3CCSV 1RPOA 3IFXA 2QM7A 1M90W 4UCOA 2Q8VA 1YJ9V 2Q7EA 1NVPB 2PYJA 1WP8A 5BXZA 3FKSG 4I9WA 5FPRA 3K0GA 4P9OA 1M93A 1PPJH 1S3JA 2QEXV 3SPCA 4RQEA 5C93A 4OGQB 1M4UA 1VQMV 2QKCA 2ZDIC 4DV7O 4PI2A 4DV2B 1NTZH 2QJ1A 2UXNA 2XASA 3Q4HB 3N27A 5LGUA 2Z5UA 1V54B 1PP9H 4FM1A 4QGPA 4FM0A 4FLUA 4TUYA 2EIMB 3WFVA 3ZBHA 1KD1W 5JJNB 3S3XA 1R3IC 3T1CA 2IM9A 3K08A 2BTQB 5EIBC 1HWYA 1PV0A 1Y74B 3B4SA 5KMGB 5IYDO 4LBEC 1QVGU 5J9PC 1WAZA 2A7WA 3CRQA 2OCHA 4FLTA 2ZR2A 3UM7A 2Q68A 3JALA 2Q0AA 2R9AA 3ML0A 1ORQC 3R65A 4JI8B 3JAKB 3G6BA 2FKXA 4MS2A 1WA8B 3ASOC 3HKBA 1Q43A 4HZ3A 4O4JB 2FMLA 5IWAO 4K3AA 3JATB 4FLYA 3CCJV 5LXTA 3SGIA 2QKAA 2IJKA 1G6UA 4KL1A 1B6QA 3LSSA 2AHZA 3AG4C 4I50A 5GTHZ 1M56B 4HYOA 1XOUA 2E74B 4JI8O 4R50A 4LF7B 2LO1A 4O4LB 4J42A 4OPAA 4U7OA 3SPIA 4OPHA 4HNAA 3ZRXA 5EC1C 1SA0B 2YICA 4JI2B 2ZNJA 3AG3B 3IC9A 2L35A 2Q9LA 5CA0B 2ZXWC 2QKSA 1BCCH 5HFMA 2QSAA 4GX0A 3CHXA 1J5EB 5EIBD 2PUSA 4AI8A 3UT5A 4IT5A 4Z1MG 2PGGA 1W2BU 3BCCH 2RCVA 4TT3G 5KX5A 1YIJV 2ZIOA 4X1IB 3T4ZA 4LF7O 3TXSA 2ODMA 3E8FA 1H2NA 1XMQB 4PHZA 4DR3B 4LF5O 2ZDIA 4JI2O 3CSXA 2ZT9B 2JEUA 4WBNA 3C3TA 5EBMC 1WB8A 3LUTB 3NXSA 4P2ZA 2HEPA 4YHHB 1NQTA 1IZ3A 3JARB 1JR9A 1V9PA 4GX1A 4JF3A 3FYIB 5BR8B 3KG2A 3F5TA 4QE9A 3ZRVA 2BSKB 1XQ8A 3KKYA 1XMQO 2HVJC 3K58A 1SETA 4DR3O 3ASNC 2JS5A 2ATKC 2YS8A 2XHBA 3DXRA 3MAQA 1NR7A 3L72H 5CA1B 4YHHO 4GKKB 1VQ7V 1H2MA 2BE3A 3AG1C 2DW4A 3UO3A 5BR8O 5DECA 2N05A 1PM9A 1MMMA 1SQBH 1HDJA 3ZHVA 4CH4A 3K57A 1G4YB 1IDSA 4CS4A 1SESA 3BRCA 1F51A 3B77A 3LDDA 1OCOB 1TAEA 3ABMB 2FTKA 1JMKC 1KC8W 1VQ9V 4WFFA 1K4DC 2X0LA 1JA8A 4JI7B 4TV8A 1P84F 4UCSA 1TGOA 4GKKO 3B40A 3SR2C 5DN6G 4FMTA 5IT9N 1HP8A 2UXDB 1TVKB 5JVDA 3HKDA 1NTKH 2K9PA 3JAWA 3K0DA 2WWWA 1G1XB 2CTPA 5KHHA 4GKJB 1QLEC 3APQA 4YJ3A 1XUQA 1S77D 1WB7A 2EJ7A 4JI7O 5KHGA 2YUAA 1MOFA 1AR4A 5IE9A 1OJHA 3SJCC 1OCCB 2UUBB 2IJHA 4H44B 3RGBA 2UXDO 1SQXH 1Q7YW 2QTSA 5ITZB 2CUGA 3ZHTA 5KLVH 3M99B 2OTLV 4KFMA 2XT9A 2GTSA 2Q5ZA 3G6EV 5LHIA 2WLLB 1GRJA 2OIGA 4U7NA 4ZHQA 4KHPB 2HHHB 4I5SA 3AG7A 5H6QA 4GKJO 4OX9B 5CB4B 3DSQA 4A5UB 1OCZC 1XREA 4FIPC 4LWSA 5EC2C 4O2AA 2LGWA 3LNMB 2CK3G 2UUBO 1XMOB 1LUVA 3A0RA 1R6NA 1NH2B 1CEZA 5LOVA 1Q86W 3R66A 3E8BA 3BA9A 4DR7B 4JYYA 4JTCB 4PJ0Z 4KHPO 2YEVB 2EX3A 2HHHO 3CC2V 4X9QA 3RYHA 4OX9O 1QCEA 2OT5A 3ZMSA 1Y76B 2EINC 4R7CA 4IIJB 1K8AW 4DRXB 4X20A 5H5NA 4XDJA 2OIEA 4I7ZB 3OW2U 1VQ6V 2UXXA 5L3CA 5CBGA 1QLNA 3TGUH 4KP4A 3SPJA 2P6JA 1XMOO 1RPRA 3DGEA 3IJ4A 4I0XB 3RYFA 1ZL8B 4I55A 4TV9B 2CH7A 3CCEV 2QE7G 4DR7O 4JI1B 1GN2A 1RP3B 1FPOA 1FKAO 1Q81W 5J2TA 3E22B 3HKCA 2W0FC 4BIUA 5LMUB 3RBZA 3CEIA 2F1MA 2Y4TA 1TUEB 1YVWA 1Y66A 3SYOA 3OUFA 4Q20A 3OMAB 1NTMH 4G2KA 2RDCA 2RNBA 5J2UA 3J80N 1AJQA 2E3CA 4E2LA 3SJQC 4JI1O 4GX5A 1YI2V 2Y0IA 3J7AU 1MG1A 4WCEV 2ARHA 2V1DA 2Q69A 3E83A 3W7TA 3W7WA 5LMUO 4ZOLA 3P3PA 3FAVA 2WLKA 3BPZA 4UV9A 3WG7C 5FPOA 3LNNA 2MW2B 1I08A 1KUQA 1BZKA 2B1GA 4JYAB 2UXCB 1EN5A 4NTXA 4MVQA 4O2BB 1HNXB 3ZRSA 3CCMV 2B1IA 4FLWA 3AEIA 1H8EG 2IJJA 3W7UA 1WN7A 4UCUA 2WSSG 3CYOA 3FX7A 4DK0A 3L73H 1Q82W 1R3JC 1FD9A 4B08A 1XI1A 1AI6A 1AILA 1K5QA 3OFNG 4DR2O 4GX2A 5JH7A 1FAFA 4B3SB 3K9AA 3NR7A 2PF4E 3GVMA 1K9MW 3OD4A 1FFXA 4QNHB 2UXCO 1KB9F 3PJSK 2CTQA 2EIJB 5IJ0A 5LHGA 1HNXO 3KCXA 1S5JA 4LCUC 4F6RB 1LR1A 1GK9A 3D36C 4AILC 2ZNIA 2F66C 3ZMTA 4CZZA 5CN0A 1BGYH 3ZN1A 3JASB 4X66B 2Q67A 5LYJA 4U3JB 5B1OA 4B3SO 1D2DA 3CXHF 3O9OA 4EB6A 5BZBA 3TCUA 5B5EZ 4J7KA 1RSOB 1P4RA 1M1KW 3BAAA 5LA6B 2IBZH 1BMFG 3H1IH 3K9SA 4K8XA 3E89A 2EULA 5E79Z 2FL4A 1EM1A 1TUBA 4Q6GA 2EJRA 2IH1C 3ABKB 3L71H 4YJ2A 1NJIW 2JJ2G 1F4MA 4MVSA 4L87A 1BE3H 1V54C 1KKDA 3OMIB 3CE2A 2VQEB 4MSWC 5K1PA 2D3OW 3THOA 3HR0A 1ENVA 2EIMC 3JYCA 4FK5C 3DC6A 1VF6C 4TQDA 3H1HH 2NR5A 2PI4A 4QJFB 3QF7A 1D5NA 5C8YB 1VARA 4I4TA 2BCCH 3SDLA 4OXSA 4DR6B 2GV9A 2JRIA 2B9ZA 2WLIB 3TXQA 2GSMB 1Y67A 3TJTA 4NXNB 1R1BA 3M8AA 2Y4UA 2IU3A 3CJHA 5IY5B 2YIDA 1K33A 3RFRA 4WFEA 4H33A 1FYJA 1M5IA 3HB3B 1GM8A 1R73A 2YC0A 4LNUA 1W59A 2RJZA 4JI5B 3L70H 1IXBA 1NVPD 3OGCC 4FLZA 4DR6O 1QBZA 2ADPA 1PL4A 3BVOA 1URFA 4NXNO 4TOIA 2RQ6A 4H0LB 2ZE7A 5LP6B 3ZHRA 3S3WA 3ZCCA 5LHHA 1YZBA 1M56C 3JSNA 4CS3A 4Z1VA 2JGDA 3SYCA 3RYCA 1P7BA 4WFAV 1SQQH 5GTIZ 4IHJB 5LBQA 4YY3B 4JI5O 1WNSA 4MVZA 1DGSA 2HG5C 3AG3C 5CBHA 2QA4V 3D36A 4RO2A 3F7VC 4EFBA 1SKVA 3ZHSA 3ABLB 1NBMG 3RN4A 1COWG 4UCRA 4YXWG 4LFBB 1KP2A 4GZRB 5IYCO 1RFYA 2ZM6O 4MW8A 1E79G 1YJNV 1FXVA 4JV5B 3CC7V 1K4CC 4JYBA 1AP5A 4N21A 4JI3B 4RUEA 5IWAB 2VWJA 3JALB 4YY3O 2P67A 2WLHA 4JGSA 2PI5A 3DC5A 1R6KA 3QVNA 5H6RA 2PTMA 3LDEA 2RMKB 4LFBO 3HKBB 3CCVV 1HNZB 3JCZA 5LXTB 3OM3B 4ZI7A 4JV5O 2MK3A 4PDVA 3HKEA 2AZ2A 2R9IA 1GN6A 1UFIA 1I5XA 2Q73A 2NN4A 4JI3O 4HBNA 4I50B 5L3DA 4BAYA 2EZPA 1SQVH 4BW5A 1OCRB 4JASA 2W6JG 3X2QB 2Y0PA 3CRMA 3ZRWA 1HNZO 4MTGA 2ZIMA 1X59A 3CWBH 4C7UA 2LGQA 2QWNB 4J41A 1F23A 3APOA 5GONB 4NKGB 4LF5B 1S76D 1Q8IA 2IH3C 3L74H 4I9QA 2WLNA 5KX5B 3T1YO 4GLXA 1ROPA 3ABMC 3UKMA 2DWDC 3OT7A 3H1JH 1KU9A 1LNQA 3OR7C 1Z5VA 3VQVA 3CMAV 3CCQV 3J81N 4MT8A 4O4LA 1VF7A 2A79B 2XAFA 3CCLV 1AI7A 2FB5A 1B06A 5CA0A 1E1QG 3BABA 1AJPA 2F4VB 3BA8A 2YIBD 2W0XA 3W7SA 4EFEA 4DV5B 1OCCC 2QDOA 4JAVA 3OTOB 2WAMA 4TQFA 1QHTA 2DE0X 4X1IA 1VMGA 1IXMA 1ZAUA 3L75H 4LFCB 4J7ZA 4PV1B 4CH6A 2JGUA 4X1KA 5A2QN 3BHPA 2ZE5A 1E1RG 1UPGA 3BFRA 1N36B 2F4VO 3JARA 1IBLB 1YJWV 1F7YA 2UUAB 2YSUB 3ICXA 4JTDB 4CH5A 4DV5O 1Q5OA 4ABMA 3M7MX 2JEXA 3OTOO 2BSKA 1JNBA 3G4SV 1Y4MA 3CRCA 2YIBA 5B66Z 3MDSA 4CC6A 2CTRA 3B2EE 2R70A 5FNVB 4LFCO 3GWOA 1YTFB 3WB2A 1DF5A 4DK1A 2GUZB 2JIZG 3OEEG 1EFRG 3ZJZA 1YF2A 5CA1A 3IC7A 3JAWB 1NZ6A 1N36O 2ADQB 3FD9A 1XHXA 2F43G 1IBLO 5KUKA 2UUAO 1B3QA 4DR1B 3ZMVA 3SPGA 2DWEC 4YJ3B 1YEWA 2YDEA 4EEQA 2DQ0A 3L9DA 1NT2B 1VEWA 4R6ZA 1HR0B 1QNMA 1I0HA 1ZLZA 1MSDA 2NNUA 4YIPA 4NB5A 3ZX6A 2R72A 2A9HA 4DR1O 4F4LA 3K5OA 2KSDA 4UVAA 4PD4F 4X64B 4JPRA 4LWSB 4FFBA 2FYUH 1FXHA 5L3BA 1GO3F 4LF8B 2N74A 4O4HB 2IU0A 1GMGA 1SZXA 4PA7A 1HR0O 1NH2D 4CS2A 5LOVB 4H13B 4JZGA 2V4DA 5B3SB 3E8HA 4YIOA 1FOUA 3RYHB 4P9PA 5DM6V 3T1HB 4X64O 4FLXA 5H2FZ 2E75B 4AHCA 4X20B 1SQFA 4G27B 3STZC 4LF8O 2X6AA 5EZYB 2WPDG 3U11A 2QM4A 5KUMA 3U10A 2XAHA 3RYFB 4I55B 1QR9A 1M57B 1I94B 4CH3A 5IYZA 4JAUA 5GW7A 5EBWC 3G67A 4GT1A 3T1HO 4XBFA 3QO7A 3RT3C 2RN9A 3OE7G 1H38A 1SERA 3WB1A 1YXBA 4F6EA 2EIJC 1RM1B 3B8NA 5H9CA 2N04A 3ZS8C 2YEVA 1Z2GA 1ZUQA 4D6TH 3ETQA 1EZVH 4ZKIA 5LGNA 2XOKG 4IIJA 4O4IB 2YXHA 4DRXA 1I94O 4L8JA 4X65O 2ZINA 4XDKA 1V55B 4BIZA 3HPLC 1H2KA 4NTYA 1PNKA 5LL6Y 5FLXN 4DV0B 3N2GB 3QTCA 2LW1A 3ABUA 1ZL8A 1VQPV 3H1KH 2WLJA 4MTOA 5B1NA 3KCYA 2JVDA 3E22A 1XNRB 1IURA 1F4NA 3H1LH 3ZHQA 2DN9A 5JCOC 3MHSC 3FB8C 1Y6XA 1GTOA 2EILB 4DR2B 1GKFA 3ABKC 4DV0O 2Y48A 4J11A 4UB6Z 4KXRA 3RVYA 5KA6A 3K5LA 3VQYA 1OV9A 2Q6AA 2NLJC 4QIWF 1EBOA 5JH7B 2AZ0A 1NS1A 1THZA 2XAQA 5JQGA 1GAXA 5LGTA 1OZ0A 4JI6B 1XNRO 1JFFB 1FFXB 1N4CA 2QGNA 4DO2A 3A0BZ 1N8RW 5IJ0B 4QE7A 1GN4A 3N2KB 4UV8A 5IYBO 2HVKC 2QWQB 3OTFA 5IY5C 2ITDC 2CAZC 1FXKB 2XTAA 3IAYA 2KG7A 5HFLA 2Q4PA 2VRZA 4FZ0A 1R6TA 5IJ9B 4MTFA 3UQ8A 4O2BA 2CE4A 1R3LC 5JJJB 5LYJB 4K0KB 2P4VA 5FL7G 3B09A 4JI6O 1H2GA 1M9NA 5KHIA 1Q6IA 4WFGA 1AVMA 5D5PA 5KAIZ 5BMVB 5CA3A 1GM9A 1N0NA 5L3FA 1WP7A 3AK1A 2DYRB 5LP6C 2LW7A 3JAMN 1W0JG 2EBOA 4X89A 3GB7C 1MABG 1ZTEA 2LQTA 4K0KO 1ZSPA 1NKDA 3A8TA 1QVFU 3W7XA 2LJ2A 2A0LA 4WF9V 3ABLC 3AG2B 4PA6A 3LSUA 3JASA 3EXAA 4FLVA 1XNQB 2D2CB 4E4EA 2YIAA 2O57A 4FM2A 5EK0A 1NR1A 5EBLC 1YITV 1VQOV 4NVPA 5LA6A 1IBMB 4DV4B 4UUJC 2PZSA 1S72V 3ZEDA 1JJOA 1WPBA 3K5NA 1O9GA 3T4DA 2QR4A 4G28B 2P5OA 4Z2WA 1NU1H 1WLEA 4LNUB 1XNQO 1Q6UA 5CBFA 4MVRA 2WA3A 1VQ4V 1XL4A 2P22C 4X62B 3BY6A 1DLBA 1EZJA 4BWAA 4B3MB 1N0JA 2EIKB 1IBMO 2ILMA 2HJFC 1TA8A 2QM8A 3FYEB 4DV4O 5B1AB 5C8YA 3D8CA 3CXCU 4FJCC 1OCRC 2AW9A 2WLIA 3X2QC 2ZM6B 3E8GA 2XAJA 4RAIA 4PI0A 2DQ3A 3CC4V 1IJGA 3SJAC 5JJEB 1U97A 4MVMA 2DOSA 2DYSB 4QPKA 4X62O 5EYPA 4B3MO 2A06H 2OCCB 4DR4B 4TUYB 1SF9A 3RYIA 4KUMA 2PYLA 1BQ0A 4X1YA 3JCUZ 3FFQA 5KHKA 3SYQA 1YSCA 4JTAB 1U96A 4DW1A 5LP6A 1I5YA 2BOBC 3ZMUA 1DK1A 4FVMA 2HJDA 4IYIA 5KHJA 1K34A 4GCZA 1NI8A 2P90A 4DR5B 4IHJA 1CP9A 1I7FA 2XNDG 2YXYA 4LF6B 2JJ1G 3C90A 4DR4O 5D5QA 4ZI7B 1JCHA 1KKCA 3HKEB 3Q4HA 1PKXA 3K59A 4UXNA 1GM7A 2M7WA 2Y69B 2R9RB 5B1BB 2HR3A 2Q7GA 4J10A 3QG5A 3B8MA 1VF6A 4JAAA 4DV2O 3RW0A 1IVSA 1QU7A 4UB8Z 4ZBMA 2HLDG 2BTQA 1AI5A 5CMUA 4DR5O 4PDRA 3K3WA 1Q90D 1Y74A 5KMGA 3JD3A 3ZRWB 4LF6O 3T1YB 4LH6A 4PDLA 2OYQA 2PY5A 3ZHUA 4J9ZB 2ZE6A 1PL0A 1XEQA 4B3TB 1BL8A 2DJVA 4HNAB 4LF4B 4J7JA 4DUZB 2G38A 3P3NA 1K5SA 2VWKA 1XDCA 1KQSU 4JI4B 3FB6C 2QTOA 1MZFA 1SC5B 1CXZB 3JAKA 2CGNA 2BOCC 1WA8A 3UT5B 4O4JA 5E1AC 3JATA 1N32B 2V7QG 1OCOC 2IW5A 3CRRA 5IDJA 5L3EA 3H9VA 1P7GA 2Q0OC 2XAGA 1AI4A 2QWRB 4B3TO 4LF4O 4DUZO 4PA3A 1L1FA 4UCTA 3ZMZA 2Z0AA 1FFTB 1CPYA 1T5EA 4JI4O 4WBNB 5A9GA 4U3FH 4AQYB 2ETNA 5GONA 2KKWA 4MVUA 5TISZ 1SA0A 1N32O 2A3QA 3OUSA 1EN4A 3E2EA 1KBHA 5BY1A 3K04A 4TWKA 1GH6A 2VS0A 1GN3A 3AK2A 1ZX3A 2CDYA 2YI8A 3DXRB 5KAFZ 4X1KB 3P30A 4AQYO 2HP8A 4D7TA 4K35A 1FS0G 1J5EO 4UFZA 2C2AA 1P49A 3VOUA 1XHZA 4PELA 3G80A 3ASOB 2HFEC 1UJWB 3OGIB 1AR1B 1MNGA 3SPHA 5B3SC 1BS3A 1YTFD 1SS3A 1YHQV 1KYOF 4TV8B 2H3OA 1W0KG 4H37A 3CS5A 1EN6A 3AG4B 2ZCEA 3VQXA 1SRYA 3VBBA 1JOYA 2B5UA 3HKDB 5JVDB 1JX9A 3K79A 3TETA 2X6CA 2ZR3A 4B3RB 2AGAA 2H8PC 2JK5C 3A2FA 3OAAG 2WA4A 1M57C 1JJ2U 1K97A 4MTXA 1ZWIC 3GWKC 3TK1A 2ITCC 4IL6Z 4W4KA 4K8ZA 2ZXWB 3SYAA 3WU2Z 2GHYA 5K1XA 3JD1A 3P32A 1H2SB 4LFAB 1AB3A 2W6IG 4DV1B 1Z5WA 1MSWD 1BHAA 1X4TA 4WFBV 2E76B 5FNVA 1RM1C 2CGOA 1VQ8V 2GDSA 1H2LA 1VIBA 2GUZA 1S5HC 4NR1A 1B04A 4FFBB 4B3RO 4WFHA 1L8DA 4DYLA 3JSLA 4PDMA 1VF5B 4IYHA 4B7EA 4ZHQB 1K73W 1S5LZ 2AXTZ 1V55C 1TVKA 4ASUG 4O2AB 1J95A 4CBCA 4FPPA 3U0ZA 4LFAO 4QPJA 3BEHA 1IX9A 4DV1O 4IGGA 2ZKOA 2DMXA 1S0VA
chains in the Genus database with same CATH topology
4C7UA 2RCVA 3MDSA 2P4KA 1GN4A 3CEIA 1XUQA 1WB7A 1MNGA 1N0JA 2ADQB 1BS3A 1AR4A 1PL4A 2CE4A 3C3TA 1WB8A 3OT7A 2AW9A 1XDCA 1JR9A 3K9SA 4F6EA 1EN6A 5AG2A 3RN4A 1ZUQA 1AVMA 1EM1A 1VEWA 3KKYA 1N0NA 1QNMA 1I0HA 3AK1A 1ZLZA 1MSDA 1XREA 1AP5A 4YIPA 1P7GA 1B06A 3DC6A 1I08A 1AR5A 3DC5A 1ZTEA 1AP6A 1ZSPA 1LUVA 1EN5A 3QVNA 2QKAA 1D5NA 1VARA 4GUNA 5A9GA 3EVKA 1BSMA 3C3SA 1MMMA 1PM9A 4JYYA 1Y67A 3LSUA 3TJTA 2GDSA 4BR6A 1IDSA 1BT8A 1SZXA 4X9QA 4E4EA 1EN4A 1GN6A 4JZGA 1LUWA 1GN3A 3AK2A 3BFRA 2CDYA 4YIOA 1JA8A 1KKCA 3IC9A 1XILA 4FFKA 1IX9A 3KDRA 1IXBA 2QKCA 3AK3A 4JZ2A 2ADPA 1GN2A 1MA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7U A;  2RCV A;  3MDS A;  2P4K A;  1GN4 A;  3CEI A;  1XUQ A;  1WB7 A;  1MNG A;  1N0J A;  2ADQ B;  1BS3 A;  1AR4 A;  1PL4 A;  2CE4 A;  3C3T A;  1WB8 A;  3OT7 A;  2AW9 A;  1XDC A;  1JR9 A;  3K9S A;  4F6E A;  1EN6 A;  5AG2 A;  3RN4 A;  1ZUQ A;  1AVM A;  1EM1 A;  1VEW A;  3KKY A;  1N0N A;  1QNM A;  1I0H A;  3AK1 A;  1ZLZ A;  1MSD A;  1XRE A;  1AP5 A;  4YIP A;  1P7G A;  1B06 A;  3DC6 A;  1I08 A;  1AR5 A;  3DC5 A;  1ZTE A;  1AP6 A;  1ZSP A;  1LUV A;  1EN5 A;  3QVN A;  2QKA A;  1D5N A;  1VAR A;  4GUN A;  5A9G A;  3EVK A;  1BSM A;  3C3S A;  1MMM A;  1PM9 A;  4JYY A;  1Y67 A;  3LSU A;  3TJT A;  2GDS A;  4BR6 A;  1IDS A;  1BT8 A;  1SZX A;  4X9Q A;  4E4E A;  1EN4 A;  1GN6 A;  4JZG A;  1LUW A;  1GN3 A;  3AK2 A;  3BFR A;  2CDY A;  4YIO A;  1JA8 A;  1KKC A;  3IC9 A;  1XIL A;  4FFK A;  1IX9 A;  1IXB A;  2QKC A;  3AK3 A;  4JZ2 A;  2ADP A;  1GN2 A;  1MA1 A; 
#chains in the Genus database with same CATH topology
 4J9Y B;  1K3E A;  1H5W A;  3ETG A;  3CP1 A;  3K03 A;  3EFF K;  3ZN0 A;  2ZE8 A;  3ASN B;  4XDL A;  2OWO A;  3DTU B;  1SQG A;  2EIL C;  1BHB A;  3UCS C;  1HNW B;  5L3G A;  5F2V O;  5DED A;  5ITZ A;  4UVB A;  4TSF G;  1KMI Z;  3CRA A;  3SJB C;  3A0H Z;  3CPW U;  3OR6 C;  2L6L A;  3AG1 B;  2WLL A;  4BW9 A;  4RUF A;  3T2M A;  2ZD9 A;  2JS3 A;  1Q6H A;  5IYZ B;  4O4H A;  5CB4 A;  2WLM A;  3EHB B;  5AG2 A;  2XUM A;  1K92 A;  2E5L B;  3CCU V;  2CH7 B;  4J80 A;  4X88 A;  4X65 B;  2LP7 A;  3O65 A;  5J2T B;  3E86 A;  4EKW A;  1HNW O;  3HKC B;  3FB7 C;  4GYC B;  4DUY B;  2EZO A;  2F95 B;  2QWP B;  4FZ1 A;  1FXK C;  1SZT A;  4LH7 A;  4ZIB A;  5EZY A;  2UXB B;  2K1E A;  1Y76 A;  2E5L O;  1KP3 A;  3EVK A;  4ICG A;  1OHH G;  3OMN B;  5J2U B;  3CB2 A;  3STL C;  3ZIA G;  3KZI Z;  2HKO A;  1JVM A;  1KEC A;  1DF4 A;  4BR6 A;  4DV6 B;  3CCR V;  1IBK B;  1QLE B;  4UCV A;  1SQP H;  3PN1 A;  4PA9 A;  4D7S A;  5KA5 A;  4RWU A;  2F23 A;  2KB1 A;  4I0X A;  4ZOL B;  4DUY O;  2DYR C;  2UUC B;  3WB0 A;  3FAV B;  4TV9 A;  2QWO B;  1AJN A;  3ETE A;  1XIL A;  2GTA A;  2VQF B;  1JPX A;  2UXB O;  4NXM B;  3KDR A;  4LC1 A;  3AK3 A;  4JZ2 A;  3K5M A;  2P7T C;  1PNM A;  4O4I A;  3E35 A;  5LMN B;  4DV6 O;  1IBK O;  3AG2 C;  3SYP A;  2P4K A;  1OCZ B;  4X8A A;  5JQG B;  2P06 A;  3N2G A;  2OTJ V;  2UUC O;  1VQN V;  4LF9 B;  2VQF O;  4NXM O;  1QR8 A;  4MVO A;  1O9H A;  1XL6 A;  2KG7 B;  3LDC A;  5LMN O;  3QO5 A;  2F93 B;  3I5D A;  1VP7 A;  4NTW A;  4JI0 B;  4BIO A;  2Q7H A;  3LSQ A;  2EIN B;  4DXW A;  1K7D A;  3ABT A;  3JD2 A;  3MD0 A;  3I55 V;  4R8C A;  1N33 B;  2YXL A;  4LF9 O;  1WJZ A;  2UU9 B;  2AHY A;  2LFS A;  3RWR D;  3I56 V;  2EIK C;  4EB6 B;  1YCI A;  5B1A C;  1JFF A;  1D5A A;  3RVZ A;  5JWP A;  4GUN A;  4JYA O;  3VQW A;  1BSM A;  3ETD A;  4JI0 O;  3MHH C;  4LP8 A;  3N2K A;  3CX5 F;  1QQC A;  1XBL A;  1R3K C;  1N34 B;  3CD6 V;  4B7K A;  1TUB B;  3D3Q A;  1FXK A;  1PD3 A;  3IGA C;  1N33 O;  1FJG B;  2DYS C;  4YJ2 B;  5IJ9 A;  1LUW A;  2UU9 O;  1BQZ A;  1MZE A;  4F6R A;  3K06 A;  2OCC C;  1WPX A;  1L0L H;  3QNE A;  2CTW A;  4FFK A;  2YI9 A;  4DW0 A;  5BMV A;  4U3J A;  1MA1 A;  3UO2 A;  2X7R B;  3H01 A;  1Q3E A;  4NYK A;  4I4T B;  3D3I A;  2BTO A;  3CME V;  1N34 O;  1VQK V;  1L0N H;  1RSO A;  1US6 A;  2LFR A;  3WG7 B;  2JDI G;  1FJG O;  1A32 A;  4P30 A;  3CJH B;  4PA4 A;  2M6Y A;  4X66 O;  3JD4 A;  1PNL A;  1ARO P;  4W4L A;  1DTO A;  5JCO A;  1JQ0 A;  2IJI A;  3QO8 A;  2Y69 C;  4DV3 B;  2H94 A;  5B1B C;  4CC5 A;  1H8H G;  1HW7 A;  4LR3 A;  2KQX A;  3G71 V;  2GBO A;  4UVC A;  4MW3 A;  1VQ5 V;  1VQL V;  2ZQM A;  2JGD B;  3F7Y C;  4RQF A;  3FB5 C;  2VQE O;  1AR5 A;  3OEH G;  3RYC B;  1AP6 A;  5EYP B;  1G8M A;  4JYC A;  4N23 A;  4DV3 O;  4DV7 B;  1YDX A;  3JD0 A;  2Z3Y A;  3RYI B;  3C3S A;  2X6B A;  3F5W C;  4X1Y B;  4HAM A;  1BT8 A;  3CCS V;  1RPO A;  3IFX A;  2QM7 A;  1M90 W;  4UCO A;  2Q8V A;  1YJ9 V;  2Q7E A;  1NVP B;  2PYJ A;  1WP8 A;  5BXZ A;  3FKS G;  4I9W A;  5FPR A;  3K0G A;  4P9O A;  1M93 A;  1PPJ H;  1S3J A;  2QEX V;  3SPC A;  4RQE A;  5C93 A;  4OGQ B;  1M4U A;  1VQM V;  2QKC A;  2ZDI C;  4DV7 O;  4PI2 A;  4DV2 B;  1NTZ H;  2QJ1 A;  2UXN A;  2XAS A;  3Q4H B;  3N27 A;  5LGU A;  2Z5U A;  1V54 B;  1PP9 H;  4FM1 A;  4QGP A;  4FM0 A;  4FLU A;  4TUY A;  2EIM B;  3WFV A;  3ZBH A;  1KD1 W;  5JJN B;  3S3X A;  1R3I C;  3T1C A;  2IM9 A;  3K08 A;  2BTQ B;  5EIB C;  1HWY A;  1PV0 A;  1Y74 B;  3B4S A;  5KMG B;  5IYD O;  4LBE C;  1QVG U;  5J9P C;  1WAZ A;  2A7W A;  3CRQ A;  2OCH A;  4FLT A;  2ZR2 A;  3UM7 A;  2Q68 A;  3JAL A;  2Q0A A;  2R9A A;  3ML0 A;  1ORQ C;  3R65 A;  4JI8 B;  3JAK B;  3G6B A;  2FKX A;  4MS2 A;  1WA8 B;  3ASO C;  3HKB A;  1Q43 A;  4HZ3 A;  4O4J B;  2FML A;  5IWA O;  4K3A A;  3JAT B;  4FLY A;  3CCJ V;  5LXT A;  3SGI A;  2QKA A;  2IJK A;  1G6U A;  4KL1 A;  1B6Q A;  3LSS A;  2AHZ A;  3AG4 C;  4I50 A;  5GTH Z;  1M56 B;  4HYO A;  1XOU A;  2E74 B;  4JI8 O;  4R50 A;  4LF7 B;  2LO1 A;  4O4L B;  4J42 A;  4OPA A;  4U7O A;  3SPI A;  4OPH A;  4HNA A;  3ZRX A;  5EC1 C;  1SA0 B;  2YIC A;  4JI2 B;  2ZNJ A;  3AG3 B;  3IC9 A;  2L35 A;  2Q9L A;  5CA0 B;  2ZXW C;  2QKS A;  1BCC H;  5HFM A;  2QSA A;  4GX0 A;  3CHX A;  1J5E B;  5EIB D;  2PUS A;  4AI8 A;  3UT5 A;  4IT5 A;  4Z1M G;  2PGG A;  1W2B U;  3BCC H;  2RCV A;  4TT3 G;  5KX5 A;  1YIJ V;  2ZIO A;  4X1I B;  3T4Z A;  4LF7 O;  3TXS A;  2ODM A;  3E8F A;  1H2N A;  1XMQ B;  4PHZ A;  4DR3 B;  4LF5 O;  2ZDI A;  4JI2 O;  3CSX A;  2ZT9 B;  2JEU A;  4WBN A;  3C3T A;  5EBM C;  1WB8 A;  3LUT B;  3NXS A;  4P2Z A;  2HEP A;  4YHH B;  1NQT A;  1IZ3 A;  3JAR B;  1JR9 A;  1V9P A;  4GX1 A;  4JF3 A;  3FYI B;  5BR8 B;  3KG2 A;  3F5T A;  4QE9 A;  3ZRV A;  2BSK B;  1XQ8 A;  3KKY A;  1XMQ O;  2HVJ C;  3K58 A;  1SET A;  4DR3 O;  3ASN C;  2JS5 A;  2ATK C;  2YS8 A;  2XHB A;  3DXR A;  3MAQ A;  1NR7 A;  3L72 H;  5CA1 B;  4YHH O;  4GKK B;  1VQ7 V;  1H2M A;  2BE3 A;  3AG1 C;  2DW4 A;  3UO3 A;  5BR8 O;  5DEC A;  2N05 A;  1PM9 A;  1MMM A;  1SQB H;  1HDJ A;  3ZHV A;  4CH4 A;  3K57 A;  1G4Y B;  1IDS A;  4CS4 A;  1SES A;  3BRC A;  1F51 A;  3B77 A;  3LDD A;  1OCO B;  1TAE A;  3ABM B;  2FTK A;  1JMK C;  1KC8 W;  1VQ9 V;  4WFF A;  1K4D C;  2X0L A;  1JA8 A;  4JI7 B;  4TV8 A;  1P84 F;  4UCS A;  1TGO A;  4GKK O;  3B40 A;  3SR2 C;  5DN6 G;  4FMT A;  5IT9 N;  1HP8 A;  2UXD B;  1TVK B;  5JVD A;  3HKD A;  1NTK H;  2K9P A;  3JAW A;  3K0D A;  2WWW A;  1G1X B;  2CTP A;  5KHH A;  4GKJ B;  1QLE C;  3APQ A;  4YJ3 A;  1XUQ A;  1S77 D;  1WB7 A;  2EJ7 A;  4JI7 O;  5KHG A;  2YUA A;  1MOF A;  1AR4 A;  5IE9 A;  1OJH A;  3SJC C;  1OCC B;  2UUB B;  2IJH A;  4H44 B;  3RGB A;  2UXD O;  1SQX H;  1Q7Y W;  2QTS A;  5ITZ B;  2CUG A;  3ZHT A;  5KLV H;  3M99 B;  2OTL V;  4KFM A;  2XT9 A;  2GTS A;  2Q5Z A;  3G6E V;  5LHI A;  2WLL B;  1GRJ A;  2OIG A;  4U7N A;  4ZHQ A;  4KHP B;  2HHH B;  4I5S A;  3AG7 A;  5H6Q A;  4GKJ O;  4OX9 B;  5CB4 B;  3DSQ A;  4A5U B;  1OCZ C;  1XRE A;  4FIP C;  4LWS A;  5EC2 C;  4O2A A;  2LGW A;  3LNM B;  2CK3 G;  2UUB O;  1XMO B;  1LUV A;  3A0R A;  1R6N A;  1NH2 B;  1CEZ A;  5LOV A;  1Q86 W;  3R66 A;  3E8B A;  3BA9 A;  4DR7 B;  4JYY A;  4JTC B;  4PJ0 Z;  4KHP O;  2YEV B;  2EX3 A;  2HHH O;  3CC2 V;  4X9Q A;  3RYH A;  4OX9 O;  1QCE A;  2OT5 A;  3ZMS A;  1Y76 B;  2EIN C;  4R7C A;  4IIJ B;  1K8A W;  4DRX B;  4X20 A;  5H5N A;  4XDJ A;  2OIE A;  4I7Z B;  3OW2 U;  1VQ6 V;  2UXX A;  5L3C A;  5CBG A;  1QLN A;  3TGU H;  4KP4 A;  3SPJ A;  2P6J A;  1XMO O;  1RPR A;  3DGE A;  3IJ4 A;  4I0X B;  3RYF A;  1ZL8 B;  4I55 A;  4TV9 B;  2CH7 A;  3CCE V;  2QE7 G;  4DR7 O;  4JI1 B;  1GN2 A;  1RP3 B;  1FPO A;  1FKA O;  1Q81 W;  5J2T A;  3E22 B;  3HKC A;  2W0F C;  4BIU A;  5LMU B;  3RBZ A;  3CEI A;  2F1M A;  2Y4T A;  1TUE B;  1YVW A;  1Y66 A;  3SYO A;  3OUF A;  4Q20 A;  3OMA B;  1NTM H;  4G2K A;  2RDC A;  2RNB A;  5J2U A;  3J80 N;  1AJQ A;  2E3C A;  4E2L A;  3SJQ C;  4JI1 O;  4GX5 A;  1YI2 V;  2Y0I A;  3J7A U;  1MG1 A;  4WCE V;  2ARH A;  2V1D A;  2Q69 A;  3E83 A;  3W7T A;  3W7W A;  5LMU O;  4ZOL A;  3P3P A;  3FAV A;  2WLK A;  3BPZ A;  4UV9 A;  3WG7 C;  5FPO A;  3LNN A;  2MW2 B;  1I08 A;  1KUQ A;  1BZK A;  2B1G A;  4JYA B;  2UXC B;  1EN5 A;  4NTX A;  4MVQ A;  4O2B B;  1HNX B;  3ZRS A;  3CCM V;  2B1I A;  4FLW A;  3AEI A;  1H8E G;  2IJJ A;  3W7U A;  1WN7 A;  4UCU A;  2WSS G;  3CYO A;  3FX7 A;  4DK0 A;  3L73 H;  1Q82 W;  1R3J C;  1FD9 A;  4B08 A;  1XI1 A;  1AI6 A;  1AIL A;  1K5Q A;  3OFN G;  4DR2 O;  4GX2 A;  5JH7 A;  1FAF A;  4B3S B;  3K9A A;  3NR7 A;  2PF4 E;  3GVM A;  1K9M W;  3OD4 A;  1FFX A;  4QNH B;  2UXC O;  1KB9 F;  3PJS K;  2CTQ A;  2EIJ B;  5IJ0 A;  5LHG A;  1HNX O;  3KCX A;  1S5J A;  4LCU C;  4F6R B;  1LR1 A;  1GK9 A;  3D36 C;  4AIL C;  2ZNI A;  2F66 C;  3ZMT A;  4CZZ A;  5CN0 A;  1BGY H;  3ZN1 A;  3JAS B;  4X66 B;  2Q67 A;  5LYJ A;  4U3J B;  5B1O A;  4B3S O;  1D2D A;  3CXH F;  3O9O A;  4EB6 A;  5BZB A;  3TCU A;  5B5E Z;  4J7K A;  1RSO B;  1P4R A;  1M1K W;  3BAA A;  5LA6 B;  2IBZ H;  1BMF G;  3H1I H;  3K9S A;  4K8X A;  3E89 A;  2EUL A;  5E79 Z;  2FL4 A;  1EM1 A;  1TUB A;  4Q6G A;  2EJR A;  2IH1 C;  3ABK B;  3L71 H;  4YJ2 A;  1NJI W;  2JJ2 G;  1F4M A;  4MVS A;  4L87 A;  1BE3 H;  1V54 C;  1KKD A;  3OMI B;  3CE2 A;  2VQE B;  4MSW C;  5K1P A;  2D3O W;  3THO A;  3HR0 A;  1ENV A;  2EIM C;  3JYC A;  4FK5 C;  3DC6 A;  1VF6 C;  4TQD A;  3H1H H;  2NR5 A;  2PI4 A;  4QJF B;  3QF7 A;  1D5N A;  5C8Y B;  1VAR A;  4I4T A;  2BCC H;  3SDL A;  4OXS A;  4DR6 B;  2GV9 A;  2JRI A;  2B9Z A;  2WLI B;  3TXQ A;  2GSM B;  1Y67 A;  3TJT A;  4NXN B;  1R1B A;  3M8A A;  2Y4U A;  2IU3 A;  3CJH A;  5IY5 B;  2YID A;  1K33 A;  3RFR A;  4WFE A;  4H33 A;  1FYJ A;  1M5I A;  3HB3 B;  1GM8 A;  1R73 A;  2YC0 A;  4LNU A;  1W59 A;  2RJZ A;  4JI5 B;  3L70 H;  1IXB A;  1NVP D;  3OGC C;  4FLZ A;  4DR6 O;  1QBZ A;  2ADP A;  1PL4 A;  3BVO A;  1URF A;  4NXN O;  4TOI A;  2RQ6 A;  4H0L B;  2ZE7 A;  5LP6 B;  3ZHR A;  3S3W A;  3ZCC A;  5LHH A;  1YZB A;  1M56 C;  3JSN A;  4CS3 A;  4Z1V A;  2JGD A;  3SYC A;  3RYC A;  1P7B A;  4WFA V;  1SQQ H;  5GTI Z;  4IHJ B;  5LBQ A;  4YY3 B;  4JI5 O;  1WNS A;  4MVZ A;  1DGS A;  2HG5 C;  3AG3 C;  5CBH A;  2QA4 V;  3D36 A;  4RO2 A;  3F7V C;  4EFB A;  1SKV A;  3ZHS A;  3ABL B;  1NBM G;  3RN4 A;  1COW G;  4UCR A;  4YXW G;  4LFB B;  1KP2 A;  4GZR B;  5IYC O;  1RFY A;  2ZM6 O;  4MW8 A;  1E79 G;  1YJN V;  1FXV A;  4JV5 B;  3CC7 V;  1K4C C;  4JYB A;  1AP5 A;  4N21 A;  4JI3 B;  4RUE A;  5IWA B;  2VWJ A;  3JAL B;  4YY3 O;  2P67 A;  2WLH A;  4JGS A;  2PI5 A;  3DC5 A;  1R6K A;  3QVN A;  5H6R A;  2PTM A;  3LDE A;  2RMK B;  4LFB O;  3HKB B;  3CCV V;  1HNZ B;  3JCZ A;  5LXT B;  3OM3 B;  4ZI7 A;  4JV5 O;  2MK3 A;  4PDV A;  3HKE A;  2AZ2 A;  2R9I A;  1GN6 A;  1UFI A;  1I5X A;  2Q73 A;  2NN4 A;  4JI3 O;  4HBN A;  4I50 B;  5L3D A;  4BAY A;  2EZP A;  1SQV H;  4BW5 A;  1OCR B;  4JAS A;  2W6J G;  3X2Q B;  2Y0P A;  3CRM A;  3ZRW A;  1HNZ O;  4MTG A;  2ZIM A;  1X59 A;  3CWB H;  4C7U A;  2LGQ A;  2QWN B;  4J41 A;  1F23 A;  3APO A;  5GON B;  4NKG B;  4LF5 B;  1S76 D;  1Q8I A;  2IH3 C;  3L74 H;  4I9Q A;  2WLN A;  5KX5 B;  3T1Y O;  4GLX A;  1ROP A;  3ABM C;  3UKM A;  2DWD C;  3OT7 A;  3H1J H;  1KU9 A;  1LNQ A;  3OR7 C;  1Z5V A;  3VQV A;  3CMA V;  3CCQ V;  3J81 N;  4MT8 A;  4O4L A;  1VF7 A;  2A79 B;  2XAF A;  3CCL V;  1AI7 A;  2FB5 A;  1B06 A;  5CA0 A;  1E1Q G;  3BAB A;  1AJP A;  2F4V B;  3BA8 A;  2YIB D;  2W0X A;  3W7S A;  4EFE A;  4DV5 B;  1OCC C;  2QDO A;  4JAV A;  3OTO B;  2WAM A;  4TQF A;  1QHT A;  2DE0 X;  4X1I A;  1VMG A;  1IXM A;  1ZAU A;  3L75 H;  4LFC B;  4J7Z A;  4PV1 B;  4CH6 A;  2JGU A;  4X1K A;  5A2Q N;  3BHP A;  2ZE5 A;  1E1R G;  1UPG A;  3BFR A;  1N36 B;  2F4V O;  3JAR A;  1IBL B;  1YJW V;  1F7Y A;  2UUA B;  2YSU B;  3ICX A;  4JTD B;  4CH5 A;  4DV5 O;  1Q5O A;  4ABM A;  3M7M X;  2JEX A;  3OTO O;  2BSK A;  1JNB A;  3G4S V;  1Y4M A;  3CRC A;  2YIB A;  5B66 Z;  3MDS A;  4CC6 A;  2CTR A;  3B2E E;  2R70 A;  5FNV B;  4LFC O;  3GWO A;  1YTF B;  3WB2 A;  1DF5 A;  4DK1 A;  2GUZ B;  2JIZ G;  3OEE G;  1EFR G;  3ZJZ A;  1YF2 A;  5CA1 A;  3IC7 A;  3JAW B;  1NZ6 A;  1N36 O;  2ADQ B;  3FD9 A;  1XHX A;  2F43 G;  1IBL O;  5KUK A;  2UUA O;  1B3Q A;  4DR1 B;  3ZMV A;  3SPG A;  2DWE C;  4YJ3 B;  1YEW A;  2YDE A;  4EEQ A;  2DQ0 A;  3L9D A;  1NT2 B;  1VEW A;  4R6Z A;  1HR0 B;  1QNM A;  1I0H A;  1ZLZ A;  1MSD A;  2NNU A;  4YIP A;  4NB5 A;  3ZX6 A;  2R72 A;  2A9H A;  4DR1 O;  4F4L A;  3K5O A;  2KSD A;  4UVA A;  4PD4 F;  4X64 B;  4JPR A;  4LWS B;  4FFB A;  2FYU H;  1FXH A;  5L3B A;  1GO3 F;  4LF8 B;  2N74 A;  4O4H B;  2IU0 A;  1GMG A;  1SZX A;  4PA7 A;  1HR0 O;  1NH2 D;  4CS2 A;  5LOV B;  4H13 B;  4JZG A;  2V4D A;  5B3S B;  3E8H A;  4YIO A;  1FOU A;  3RYH B;  4P9P A;  5DM6 V;  3T1H B;  4X64 O;  4FLX A;  5H2F Z;  2E75 B;  4AHC A;  4X20 B;  1SQF A;  4G27 B;  3STZ C;  4LF8 O;  2X6A A;  5EZY B;  2WPD G;  3U11 A;  2QM4 A;  5KUM A;  3U10 A;  2XAH A;  3RYF B;  4I55 B;  1QR9 A;  1M57 B;  1I94 B;  4CH3 A;  5IYZ A;  4JAU A;  5GW7 A;  5EBW C;  3G67 A;  4GT1 A;  3T1H O;  4XBF A;  3QO7 A;  3RT3 C;  2RN9 A;  3OE7 G;  1H38 A;  1SER A;  3WB1 A;  1YXB A;  4F6E A;  2EIJ C;  1RM1 B;  3B8N A;  5H9C A;  2N04 A;  3ZS8 C;  2YEV A;  1Z2G A;  1ZUQ A;  4D6T H;  3ETQ A;  1EZV H;  4ZKI A;  5LGN A;  2XOK G;  4IIJ A;  4O4I B;  2YXH A;  4DRX A;  1I94 O;  4L8J A;  4X65 O;  2ZIN A;  4XDK A;  1V55 B;  4BIZ A;  3HPL C;  1H2K A;  4NTY A;  1PNK A;  5LL6 Y;  5FLX N;  4DV0 B;  3N2G B;  3QTC A;  2LW1 A;  3ABU A;  1ZL8 A;  1VQP V;  3H1K H;  2WLJ A;  4MTO A;  5B1N A;  3KCY A;  2JVD A;  3E22 A;  1XNR B;  1IUR A;  1F4N A;  3H1L H;  3ZHQ A;  2DN9 A;  5JCO C;  3MHS C;  3FB8 C;  1Y6X A;  1GTO A;  2EIL B;  4DR2 B;  1GKF A;  3ABK C;  4DV0 O;  2Y48 A;  4J11 A;  4UB6 Z;  4KXR A;  3RVY A;  5KA6 A;  3K5L A;  3VQY A;  1OV9 A;  2Q6A A;  2NLJ C;  4QIW F;  1EBO A;  5JH7 B;  2AZ0 A;  1NS1 A;  1THZ A;  2XAQ A;  5JQG A;  1GAX A;  5LGT A;  1OZ0 A;  4JI6 B;  1XNR O;  1JFF B;  1FFX B;  1N4C A;  2QGN A;  4DO2 A;  3A0B Z;  1N8R W;  5IJ0 B;  4QE7 A;  1GN4 A;  3N2K B;  4UV8 A;  5IYB O;  2HVK C;  2QWQ B;  3OTF A;  5IY5 C;  2ITD C;  2CAZ C;  1FXK B;  2XTA A;  3IAY A;  2KG7 A;  5HFL A;  2Q4P A;  2VRZ A;  4FZ0 A;  1R6T A;  5IJ9 B;  4MTF A;  3UQ8 A;  4O2B A;  2CE4 A;  1R3L C;  5JJJ B;  5LYJ B;  4K0K B;  2P4V A;  5FL7 G;  3B09 A;  4JI6 O;  1H2G A;  1M9N A;  5KHI A;  1Q6I A;  4WFG A;  1AVM A;  5D5P A;  5KAI Z;  5BMV B;  5CA3 A;  1GM9 A;  1N0N A;  5L3F A;  1WP7 A;  3AK1 A;  2DYR B;  5LP6 C;  2LW7 A;  3JAM N;  1W0J G;  2EBO A;  4X89 A;  3GB7 C;  1MAB G;  1ZTE A;  2LQT A;  4K0K O;  1ZSP A;  1NKD A;  3A8T A;  1QVF U;  3W7X A;  2LJ2 A;  2A0L A;  4WF9 V;  3ABL C;  3AG2 B;  4PA6 A;  3LSU A;  3JAS A;  3EXA A;  4FLV A;  1XNQ B;  2D2C B;  4E4E A;  2YIA A;  2O57 A;  4FM2 A;  5EK0 A;  1NR1 A;  5EBL C;  1YIT V;  1VQO V;  4NVP A;  5LA6 A;  1IBM B;  4DV4 B;  4UUJ C;  2PZS A;  1S72 V;  3ZED A;  1JJO A;  1WPB A;  3K5N A;  1O9G A;  3T4D A;  2QR4 A;  4G28 B;  2P5O A;  4Z2W A;  1NU1 H;  1WLE A;  4LNU B;  1XNQ O;  1Q6U A;  5CBF A;  4MVR A;  2WA3 A;  1VQ4 V;  1XL4 A;  2P22 C;  4X62 B;  3BY6 A;  1DLB A;  1EZJ A;  4BWA A;  4B3M B;  1N0J A;  2EIK B;  1IBM O;  2ILM A;  2HJF C;  1TA8 A;  2QM8 A;  3FYE B;  4DV4 O;  5B1A B;  5C8Y A;  3D8C A;  3CXC U;  4FJC C;  1OCR C;  2AW9 A;  2WLI A;  3X2Q C;  2ZM6 B;  3E8G A;  2XAJ A;  4RAI A;  4PI0 A;  2DQ3 A;  3CC4 V;  1IJG A;  3SJA C;  5JJE B;  1U97 A;  4MVM A;  2DOS A;  2DYS B;  4QPK A;  4X62 O;  5EYP A;  4B3M O;  2A06 H;  2OCC B;  4DR4 B;  4TUY B;  1SF9 A;  3RYI A;  4KUM A;  2PYL A;  1BQ0 A;  4X1Y A;  3JCU Z;  3FFQ A;  5KHK A;  3SYQ A;  1YSC A;  4JTA B;  1U96 A;  4DW1 A;  5LP6 A;  1I5Y A;  2BOB C;  3ZMU A;  1DK1 A;  4FVM A;  2HJD A;  4IYI A;  5KHJ A;  1K34 A;  4GCZ A;  1NI8 A;  2P90 A;  4DR5 B;  4IHJ A;  1CP9 A;  1I7F A;  2XND G;  2YXY A;  4LF6 B;  2JJ1 G;  3C90 A;  4DR4 O;  5D5Q A;  4ZI7 B;  1JCH A;  1KKC A;  3HKE B;  3Q4H A;  1PKX A;  3K59 A;  4UXN A;  1GM7 A;  2M7W A;  2Y69 B;  2R9R B;  5B1B B;  2HR3 A;  2Q7G A;  4J10 A;  3QG5 A;  3B8M A;  1VF6 A;  4JAA A;  4DV2 O;  3RW0 A;  1IVS A;  1QU7 A;  4UB8 Z;  4ZBM A;  2HLD G;  2BTQ A;  1AI5 A;  5CMU A;  4DR5 O;  4PDR A;  3K3W A;  1Q90 D;  1Y74 A;  5KMG A;  3JD3 A;  3ZRW B;  4LF6 O;  3T1Y B;  4LH6 A;  4PDL A;  2OYQ A;  2PY5 A;  3ZHU A;  4J9Z B;  2ZE6 A;  1PL0 A;  1XEQ A;  4B3T B;  1BL8 A;  2DJV A;  4HNA B;  4LF4 B;  4J7J A;  4DUZ B;  2G38 A;  3P3N A;  1K5S A;  2VWK A;  1XDC A;  1KQS U;  4JI4 B;  3FB6 C;  2QTO A;  1MZF A;  1SC5 B;  1CXZ B;  3JAK A;  2CGN A;  2BOC C;  1WA8 A;  3UT5 B;  4O4J A;  5E1A C;  3JAT A;  1N32 B;  2V7Q G;  1OCO C;  2IW5 A;  3CRR A;  5IDJ A;  5L3E A;  3H9V A;  1P7G A;  2Q0O C;  2XAG A;  1AI4 A;  2QWR B;  4B3T O;  4LF4 O;  4DUZ O;  4PA3 A;  1L1F A;  4UCT A;  3ZMZ A;  2Z0A A;  1FFT B;  1CPY A;  1T5E A;  4JI4 O;  4WBN B;  5A9G A;  4U3F H;  4AQY B;  2ETN A;  5GON A;  2KKW A;  4MVU A;  5TIS Z;  1SA0 A;  1N32 O;  2A3Q A;  3OUS A;  1EN4 A;  3E2E A;  1KBH A;  5BY1 A;  3K04 A;  4TWK A;  1GH6 A;  2VS0 A;  1GN3 A;  3AK2 A;  1ZX3 A;  2CDY A;  2YI8 A;  3DXR B;  5KAF Z;  4X1K B;  3P30 A;  4AQY O;  2HP8 A;  4D7T A;  4K35 A;  1FS0 G;  1J5E O;  4UFZ A;  2C2A A;  1P49 A;  3VOU A;  1XHZ A;  4PEL A;  3G80 A;  3ASO B;  2HFE C;  1UJW B;  3OGI B;  1AR1 B;  1MNG A;  3SPH A;  5B3S C;  1BS3 A;  1YTF D;  1SS3 A;  1YHQ V;  1KYO F;  4TV8 B;  2H3O A;  1W0K G;  4H37 A;  3CS5 A;  1EN6 A;  3AG4 B;  2ZCE A;  3VQX A;  1SRY A;  3VBB A;  1JOY A;  2B5U A;  3HKD B;  5JVD B;  1JX9 A;  3K79 A;  3TET A;  2X6C A;  2ZR3 A;  4B3R B;  2AGA A;  2H8P C;  2JK5 C;  3A2F A;  3OAA G;  2WA4 A;  1M57 C;  1JJ2 U;  1K97 A;  4MTX A;  1ZWI C;  3GWK C;  3TK1 A;  2ITC C;  4IL6 Z;  4W4K A;  4K8Z A;  2ZXW B;  3SYA A;  3WU2 Z;  2GHY A;  5K1X A;  3JD1 A;  3P32 A;  1H2S B;  4LFA B;  1AB3 A;  2W6I G;  4DV1 B;  1Z5W A;  1MSW D;  1BHA A;  1X4T A;  4WFB V;  2E76 B;  5FNV A;  1RM1 C;  2CGO A;  1VQ8 V;  2GDS A;  1H2L A;  1VIB A;  2GUZ A;  1S5H C;  4NR1 A;  1B04 A;  4FFB B;  4B3R O;  4WFH A;  1L8D A;  4DYL A;  3JSL A;  4PDM A;  1VF5 B;  4IYH A;  4B7E A;  4ZHQ B;  1K73 W;  1S5L Z;  2AXT Z;  1V55 C;  1TVK A;  4ASU G;  4O2A B;  1J95 A;  4CBC A;  4FPP A;  3U0Z A;  4LFA O;  4QPJ A;  3BEH A;  1IX9 A;  4DV1 O;  4IGG A;  2ZKO A;  2DMX A;  1S0V A; 
#chains in the Genus database with same CATH homology
 4C7U A;  2RCV A;  3MDS A;  2P4K A;  1GN4 A;  3CEI A;  1XUQ A;  1WB7 A;  1MNG A;  1N0J A;  2ADQ B;  1BS3 A;  1AR4 A;  1PL4 A;  2CE4 A;  3C3T A;  1WB8 A;  3OT7 A;  2AW9 A;  1XDC A;  1JR9 A;  3K9S A;  4F6E A;  1EN6 A;  5AG2 A;  3RN4 A;  1ZUQ A;  1AVM A;  1EM1 A;  1VEW A;  3KKY A;  1N0N A;  1QNM A;  1I0H A;  3AK1 A;  1ZLZ A;  1MSD A;  1XRE A;  1AP5 A;  4YIP A;  1P7G A;  1B06 A;  3DC6 A;  1I08 A;  1AR5 A;  3DC5 A;  1ZTE A;  1AP6 A;  1ZSP A;  1LUV A;  1EN5 A;  3QVN A;  2QKA A;  1D5N A;  1VAR A;  4GUN A;  5A9G A;  3EVK A;  1BSM A;  3C3S A;  1MMM A;  1PM9 A;  4JYY A;  1Y67 A;  3LSU A;  3TJT A;  2GDS A;  4BR6 A;  1IDS A;  1BT8 A;  1SZX A;  4X9Q A;  4E4E A;  1EN4 A;  1GN6 A;  4JZG A;  1LUW A;  1GN3 A;  3AK2 A;  3BFR A;  2CDY A;  4YIO A;  1JA8 A;  1KKC A;  3IC9 A;  1XIL A;  4FFK A;  1IX9 A;  3KDR A;  1IXB A;  2QKC A;  3AK3 A;  4JZ2 A;  2ADP A;  1GN2 A;  1MA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...