1ZUQA

Contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAVVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zuqA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zuqA02
4GUNA 2ADQB 4FFKA 1WB7A 1ZTEA 1VARA 3BFRA 1IDSA 3TJTA 1EM1A 1GN2A 1EN6A 1GN4A 1P7GA 3C3SA 5AG2A 1MA1A 1JA8A 1QNMA 5A9GA 1GN3A 2CDYA 3QVNA 2QKAA 1PM9A 3MDSA 1KKCA 4C7UA 1XDCA 1MMMA 1I08A 3LSUA 3IC9A 4JYYA 3C3TA 1MNGA 1BT8A 1AR5A 1IX9A 1VEWA 2RCVA 1AP6A 1N0JA 1I0HA 3DC5A 1AR4A 1IXBA 1JR9A 1LUVA 1LUWA 4YIOA 2AW9A 1ZUQA 1Y67A 1EN5A 4BR6A 4F6EA 4E4EA 2QKCA 1WB8A 1ZLZA 4JZGA 1D5NA 3AK2A 2CE4A 1ZSPA 1EN4A 1GN6A 4X9QA 3DC6A 1XUQA 1BS3A 1MSDA 2ADPA 3CEIA 1XREA 3OT7A 2GDSA 3EVKA 3K9SA 1B06A 1N0NA 3KKYA 4YIPA 3RN4A 3AK1A 1SZXA 1BSMA 2P4KA 1AP5A 4JZ2A 1XILA 3AK3A 1AVMA 1PL4A
chains in the Genus database with same CATH superfamily
1NKDA 2FYUH 4ABMA 2CAZC 1ROPA 1Z2GA 4FM1A 1XNRB 3CCEV 1KU9A 1RPRA 4X1YA 2OCCC 2NN4A 3B40A 1GK9A 3RYCA 4ZOLA 2XUMA 1GO3F 1JX9A 1TUBA 1WP8A 2DQ3A 3OD4A 4LWSB 2ZNJA 1Y6XA 4PD4F 1PNKA 2A79B 1DF5A 5IY5B 5LL6Y 1AR1B 4RAIA 1K8AW 1I5YA 4I55B 2IBZH 1FS0G 4DR7O 4X1IB 4PDVA 2JK5C 2B9ZA 3L72H 1YJ9V 2R9IA 4O4IB 5KLVH 3UT5A 4CS2A 4DRXB 1NBMG 2YICA 2G38A 1VQ6V 1KMIZ 4OPAA 3AG2C 5JVDB 2JIZG 2C2AA 2PYJA 5HFLA 4KUMA 2ARHA 2UUAO 4J41A 4MVMA 3NXSA 4D6TH 1PPJH 3VQVA 1FYJA 5GW7A 1F4NA 2YI8A 5L3BA 2P22C 1L0LH 4K8ZA 3LSQA 4LFCO 4GX2A 3CC2V 2H8PC 2QKSA 1S72V 3K9SA 4TOIA 3WB0A 4K3AA 4FLUA 4TQDA 4HZ3A 2QTOA 4PA7A 2XNDG 4EFBA 4JI5B 4NTWA 4CC6A 3BA9A 5H9CA 2JRIA 1IURA 4LH7A 3D3IA 1VIBA 3G4SV 3JD2A 2W6JG 3JSNA 4CH6A 2Q6AA 1XMQB 3HKBA 5E1AC 1NTZH 1I7FA 4LFBB 2Q67A 1RSOA 1JA8A 3T1CA 5ITZA 4WCEV 3CCJV 4UB8Z 1SQGA 5IJ0A 1IBLB 4OXSA 1YI2V 2ZDIC 5IJ9B 4A5UB 1KKDA 1NR1A 3RYIA 3SYCA 2RMKB 4DV7B 3T4DA 2YS8A 3JATB 4K0KO 2F95B 4B3TB 1XL6A 3SPJA 1SRYA 4UCOA 1YCIA 4WFFA 1HWYA 3THOA 5KA5A 5C8YB 2Q7GA 5D5QA 3DSQA 1G6UA 4ZOLB 1VEWA 3K79A 4U3FH 5IYCO 4EEQA 1N8RW 3L74H 4LF7O 1VQOV 2AW9A 3CCVV 4IIJA 1PKXA 3ZMTA 1K34A 3EFFK 1NVPB 4MTGA 2PGGA 4J9YB 5LOVA 4J7KA 2F23A 2Z0AA 2UXNA 2UXXA 3FAVA 1Q8IA 4X9QA 3T1HB 2BE3A 4JAAA 2ZE8A 4MTFA 5LMUO 1NH2D 3OM3B 1E1RG 1S5JA 4LFAO 4I4TB 2LGQA 2HP8A 4TV8A 5L3GA 2PZSA 3GWKC 1B06A 2WPDG 2ZXWC 4EB6A 1IVSA 4YIPA 1BSMA 2MW2B 2F4VO 2P90A 2GHYA 1ZWIC 4YJ3A 4FFKA 1N36O 5CBGA 2Q69A 2W0XA 1N33B 2WAMA 3ZHRA 4KXRA 5BMVA 2D2CB 2ZR2A 1EBOA 1FXKC 1FXKA 1EM1A 4ZI7B 2UXDO 3C3SA 1WA8B 3ZX6A 4LNUA 5KHGA 2CTWA 2CDYA 1NU1H 1AILA 4RO2A 1W0JG 4X1KA 1BQZA 3OAAG 5LGUA 2OT5A 1K9MW 5D5PA 2CGOA 2ZINA 3CD6V 1AR5A 3E8GA 1SQFA 1HNZO 3CCRV 4TV8B 4B7KA 1LR1A 2XAFA 3JARA 4DV0B 1N34O 2QDOA 2XASA 2BOCC 2WLIA 2R72A 2ZIMA 3RVZA 1IBKO 4B3RO 2JJ2G 4AQYO 4QE9A 2QWNB 4FZ1A 1GAXA 1AI7A 1R3JC 4N21A 1MSWD 2YC0A 2R70A 5B3SB 4JTDB 1XBLA 1VQKV 3MHHC 1M93A 3QNEA 4DV5B 1H2NA 4LFAB 4PA9A 2ATKC 4WF9V 3K3WA 3WG7C 1QVGU 3UT5B 5JCOC 1N0NA 5LMUB 5JH7B 2IU3A 5CA1B 4JV5O 1F23A 4HNAA 4X62O 5H6RA 2BTQB 3LNMB 4GLXA 1XNRO 3ETDA 2DN9A 4JGSA 4MS2A 5L3DA 1VARA 1JCHA 1HNXB 5LYJA 3G67A 3B2EE 1YEWA 1TA8A 4X65B 1H2MA 4ZKIA 1R1BA 1JQ0A 2OCHA 3SR2C 2LFRA 3B8NA 3K5LA 3ABKC 3W7SA 4IYHA 3N2GB 2E3CA 4BIZA 1AJPA 3AG4B 4CC5A 3OUFA 1TVKB 4P9OA 3ML0A 3LUTB 1QLEB 3KCXA 4NKGB 4JI1O 3BEHA 3LSUA 2JVDA 3C3TA 1MNGA 2WWWA 1R73A 1QLEC 4O2BB 2ZNIA 2HJDA 1IBLO 2RCVA 1AP6A 3DC5A 3AG4C 4PJ0Z 4IIJB 3HB3B 1GM8A 4LF9B 3MHSC 4LF4O 3T2MA 1KBHA 4E4EA 2AZ2A 3CSXA 1HDJA 2QGNA 4RUEA 1JFFA 1V54C 3JCZA 3DC6A 4JI5O 2WLLB 1YJNV 1XMOO 4R6ZA 5E79Z 4O4JB 1XREA 4OX9O 2EULA 2WA4A 2ZD9A 2B1IA 3PJSK 2Q0AA 2IJHA 5FNVA 1Q43A 3JALA 2Z5UA 2P4KA 4O4IA 2Y4UA 3RWRD 2FMLA 3F5WC 1H8EG 1Q7YW 1QLNA 4TV9B 1SERA 3HKEB 3A0BZ 4FLTA 3AG1B 1NR7A 1SQVH 2O57A 4U7NA 3SJAC 3FB6C 2UU9O 4LF8B 4JYAB 3S3WA 3BFRA 5H5NA 2JS3A 5HFMA 3RVYA 2DWDC 2CUGA 3JD3A 1RFYA 4QE7A 1X59A 4JI4B 2A0LA 1XMOB 4UUJC 1YJWV 4FIPC 4NYKA 3UO3A 4XDJA 3AG7A 1UJWB 3RGBA 1JJ2U 2A06H 2PYLA 3W7UA 1DK1A 3K5NA 3OW2U 2IJKA 2Y69B 4J11A 4LF9O 2JGDA 4P9PA 5EBWC 1WPXA 3CJHB 5GONA 3B09A 1AR4A 1PNMA 2IJJA 1NJIW 2DMXA 4MTXA 1JR9A 3N2KB 5CA3A 2KB1A 2E5LB 4RWUA 4TSFG 1BZKA 4I9WA 2FB5A 1VQPV 5B5EZ 5ITZB 3ETGA 1K92A 3WFVA 3E86A 2HHHO 2QA4V 3P32A 3OMNB 2VQEO 3JCUZ 1MSDA 2KG7B 5LGTA 2Q9LA 1AJQA 5DN6G 3JASA 1G1XB 2R9AA 2ODMA 3G6BA 2LQTA 3FX7A 4GZRB 5KUKA 2ZM6B 2UUAB 3IGAC 3AK1A 2DYSB 5CA0A 2JEXA 4DV2B 3TK1A 3BRCA 4QPKA 2EIMB 1N33O 3ABLB 4J10A 4TV9A 4JI6O 4NXNO 1H38A 4BIUA 3ABKB 4TUYA 5BR8B 2QE7G 4IHJB 2EIKC 4L8JA 2LGWA 1JOYA 3OMAB 4PDLA 2CK3G 2V7QG 5LMNB 1GN4A 4DV1B 1QCEA 4X20A 1GN3A 4OPHA 1KECA 2HFEC 2X7RB 4JI3O 2EINC 1BMFG 2JJ1G 3ZRVA 1XDCA 3SJBC 4ZHQA 2XHBA 4EKWA 2RJZA 4LC1A 3SJQC 3DXRB 3ASNC 3TXQA 1OV9A 5EZYB 1ZAUA 4JYAO 1Q82W 5IYDO 5IJ0B 3K08A 1URFA 3LDCA 4J80A 3SPCA 5JQGA 3D36A 3L71H 5B1OA 5J2UA 3IAYA 1GM7A 3OR7C 1R3LC 3AG3B 2RN9A 4UFZA 4I9QA 1E1QG 3CB2A 1Q90D 3P30A 3CRAA 4B7EA 2P6JA 1V55B 4K0KB 4GKJO 2LJ2A 1FXVA 1U96A 2Q0OC 4R8CA 4DR3B 3BA8A 5C93A 5IYZB 3OTOO 4MVQA 2ILMA 4TWKA 1OCOC 5GTHZ 3SYQA 4JAUA 4GKKO 3K06A 3Q4HA 3BPZA 1SZXA 1KD1W 4LF4B 2P06A 5LXTB 4FVMA 4DR4O 3HKEA 4X1KB 5JCOA 1VQ8V 4MVOA 1CP9A 4GX5A 4YXWG 5J2UB 4GKJB 4XDKA 3RW0A 3OTOB 2YIDA 4KFMA 4U3JA 3TETA 2FTKA 4DR3O 4W4LA 5FPRA 2FL4A 2ZDIA 1WP7A 5IJ9A 3ZN1A 3QVNA 3B77A 5IYZA 4YJ3B 1W59A 5CA1A 2YIBD 1VQMV 4I50A 3APQA 4X1IA 2DJVA 1W0KG 3RBZA 1HR0B 1FAFA 4JI7O 2ZXWB 1IX9A 1SQQH 4H13B 4X20B 4DV3B 4UCUA 1NI8A 1H2LA 2UUCB 1RPOA 2HR3A 1WJZA 2OIGA 4PA3A 1LUWA 3ETQA 5A2QN 1SF9A 4RQEA 3T1YB 5IE9A 4DYLA 1FJGO 5KUMA 3ZHQA 3BVOA 3M99B 4N23A 1VQNV 3CRMA 4DR5O 4DV7O 4LR3A 1QR8A 4DV6B 2GBOA 4FMTA 4ICGA 4I50B 4QNHB 1HP8A 4B3SO 1IBMB 3ZRXA 4PI2A 1J5EB 1BCCH 2E75B 2IH1C 1VQ5V 1H2GA 4AQYB 3ZHUA 3W7XA 2HVJC 1XMQO 2YDEA 4NR1A 2PY5A 5LA6B 3L70H 1P49A 1SQPH 4UCVA 3UCSC 2ADQB 3I55V 2GSMB 1ZTEA 2VQEB 2HG5C 3OE7G 1AJNA 3Q4HB 2P4VA 5FL7G 2NNUA 5K1PA 5A9GA 3CWBH 4TUYB 5KHKA 2QWRB 3ZRWB 2HHHB 1FPOA 2QKAA 1FFXA 1Q6IA 3W7WA 2ZQMA 1M57C 2Q5ZA 1V55C 3E2EA 1SA0A 1S5LZ 3FB8C 3IC9A 4X1YB 3A2FA 4DR4B 4GYCB 2H94A 4LF6O 2UXCB 5CBHA 4XBFA 3JASB 3QTCA 4HYOA 2QSAA 4X66B 1PL0A 5KHJA 4MT8A 5LOVB 4PHZA 3RT3C 4DV6O 2AHZA 2XAJA 5LA6A 5KMGB 5EC1C 3SPHA 2F93B 3T1HO 3ABMB 4IL6Z 3K0GA 3ZRSA 2UUBB 3AG2B 4E2LA 2JS5A 3LDDA 4LF8O 3A0HZ 3KZIZ 2IU0A 1PV0A 2UUCO 1FXHA 1NZ6A 3EHBB 5J2TA 1IJGA 4H33A 3SYPA 4PV1B 1COWG 5KAIZ 1Q5OA 5EBLC 5LBQA 5JJJB 5KMGA 2PI5A 3J7AU 1XEQA 2GTSA 3JD4A 4W4KA 3BCCH 4YY3B 4PDMA 4BIOA 2X0LA 1HW7A 4UCSA 3BHPA 5IY5C 1G4YB 4GUNA 4MW3A 4R50A 3A0RA 2ZIOA 3GWOA 1VQLV 3ABLC 3I56V 2ZCEA 2CGNA 3N2GA 2DYSC 3RYCB 3TXSA 1P7GA 2VWJA 3S3XA 3K0DA 2YIBA 1A32A 4LBEC 4O2BA 3G6EV 2JDIG 1RP3B 3D3QA 3UQ8A 4FLXA 2EZPA 3E8FA 4O2AA 1ZX3A 3HKCB 4JI6B 4C7UA 1US6A 3HKDA 4BW5A 4TT3G 3T4ZA 3JALB 1K33A 4DUYB 4GX1A 4X8AA 3DGEA 1BL8A 1Z5WA 4KHPO 4MW8A 3EXAA 3R65A 1QU7A 4HNAB 1RSOB 4D7SA 5JH7A 3CCQV 1ZL8A 4DXWA 1NS1A 1V9PA 4YHHO 1LUVA 3CRRA 4LFCB 1I94O 3B4SA 3P3PA 2HJFC 1EZJA 3OGCC 1M4UA 1SESA 1UFIA 4JF3A 4F6RB 3WU2Z 4JI1B 5LHGA 1R3KC 4JZGA 2F43G 1BGYH 2R9RB 2LO1A 2VQFO 2F1MA 3E8BA 1K4CC 3HKDB 3LNNA 1T5EA 1RM1C 4DR1O 1YTFB 1JVMA 1BHBA 3MAQA 4Z1MG 2AGAA 2GV9A 4YY3O 3K58A 4I0XA 2YXLA 4JYBA 1N32B 1B6QA 4UB6Z 4DW0A 1EZVH 5EYPA 2EILB 3QF7A 3RN4A 1M56C 1PNLA 4O2AB 2UUBO 1YZBA 5B1AB 2QJ1A 1TVKA 2F66C 1R6TA 1IBMO 3N27A 1H2SB 1JMKC 4B3MB 4DR7B 1XQ8A 1TUEB 3E35A 3P3NA 1K5QA 1X4TA 4JI4O 1EN6A 3RYHB 4DR5B 2KSDA 1O9GA 2VWKA 1F7YA 3DXRA 4NXNB 2D3OW 4UXNA 5L3FA 4UVAA 1TGOA 3ABMC 1HNWB 2XAQA 1YXBA 2YXHA 2N04A 4PA6A 4FM0A 3UKMA 2PF4E 1P4RA 1M1KW 1OCCC 2A9HA 1M9NA 4DO2A 2EZOA 5LP6A 5LP6C 1DLBA 5IWAO 1DF4A 1YDXA 3ZCCA 3CCSV 1WPBA 4LP8A 4DR6O 3O9OA 4G28B 1GN6A 1Q86W 2ITDC 4FLWA 4K8XA 4BAYA 3E89A 4JI0B 2BCCH 5DEDA 1VMGA 4YHHB 1OCRC 3IJ4A 2XTAA 5CA0B 4CH3A 2GTAA 3ZHSA 1J5EO 1AI5A 1G8MA 4Z1VA 1B04A 1R6NA 3FKSG 1FFXB 4GKKB 1XILA 2GUZB 1PL4A 4R7CA 3RYFA 5BMVB 3JSLA 4PI0A 4X64B 3D8CA 3RYIB 4UCRA 4FPPA 4QGPA 4X88A 4UVBA 4RQFA 4HAMA 2OTLV 3GB7C 3J80N 2LP7A 3OTFA 2BTOA 3OMIB 1GN2A 1WAZA 1OHHG 2X6BA 4IGGA 4UV9A 4FFBB 3E83A 5C8YA 2W0FC 4LCUC 1AI6A 1K4DC 3TGUH 3CS5A 3I5DA 2FKXA 4WFHA 4ZBMA 1Y66A 2K1EA 2YEVA 4JI7B 1VQ9V 3SPIA 4I4TA 1NT2B 1HR0O 2Y0IA 5KX5A 2N74A 2A7WA 2QTSA 2HVKC 2XT9A 2X6CA 3JAKA 4GT1A 4I5SA 1THZA 4IT5A 4JYYA 2EIKB 4B08A 1FKAO 1WLEA 3X2QC 2RNBA 3SYAA 4WBNB 4X62B 4DV4O 2LW7A 3K57A 2V4DA 1BE3H 3K59A 1OZ0A 4FLZA 1D5AA 2PUSA 3M8AA 3H1IH 4NTYA 1ZLZA 2Y0PA 4FM2A 3SGIA 2X6AA 3AK2A 3K9AA 2EJ7A 4BW9A 3ZRWA 1KUQA 2YUAA 1M90W 5KAFZ 2YEVB 1BS3A 4JI8B 1AB3A 3CEIA 3E22A 5LP6B 3JATA 3K5MA 2WLMA 1H8HG 3ABUA 3CMEV 1E79G 5J9PC 3OT7A 4J42A 2P67A 1SC5B 1V54B 1Y76B 2VRZA 3K04A 1Q3EA 1GKFA 4JZ2A 1K73W 1YHQV 4PDRA 3KCYA 2OTJV 4DR6B 3H1HH 3AEIA 2A3QA 2Q73A 3E22B 3RYFB 2GUZA 1XNQB 5LXTA 5CBFA 4MVUA 3CRQA 4X89A 3F5TA 3RYHA 2Y69C 2BSKA 2LW1A 4LH6A 3QO7A 2YXYA 2CH7A 3BAAA 3CP1A 3RFRA 3U0ZA 2OYQA 4CH4A 2E5LO 3MDSA 4MSWC 4I55A 4Q20A 2EIJB 3OGIB 3K5OA 1L0NH 4CH5A 4JV5B 3JD0A 4JYCA 3X2QB 4LWSA 5DECA 1YF2A 2F4VB 4JI2O 1H5WA 4H37A 2QEXV 5BXZA 4DV5O 5F2VO 2E76B 5JQGB 4MVZA 1EFRG 4JAVA 4F6RA 1JJOA 5BR8O 2BOBC 3CCUV 5B1NA 1KB9F 2PTMA 4G27B 3CPWU 1Y67A 1SS3A 1KP2A 4DRXA 5LMNO 2XAGA 2ZE6A 2QKCA 5IYBO 4FFBA 1D5NA 4L87A 2DE0X 2WLJA 2DOSA 2JEUA 4WFAV 4GCZA 4ZHQB 1U97A 3B8MA 5IDJA 3WG7B 3MD0A 1NTMH 4IYIA 1XUQA 2ZE7A 5EBMC 1WN7A 1SETA 3CXCU 1SQXH 2MK3A 2WLLA 4UV8A 4Z2WA 3BY6A 3QO5A 3ZEDA 5B3SC 4O4HA 3ASOB 2YIAA 3EVKA 4FLVA 1WNSA 4DR1B 1QQCA 3JD1A 2QM7A 1BHAA 1VP7A 5IWAB 2WLIB 4NVPA 1XNQO 2EBOA 3F7VC 2EIMC 1NVPD 1XOUA 3ZMVA 3JAWB 1UPGA 1DTOA 2WLNA 1KP3A 1XL4A 5IT9N 3HPLC 1M5IA 2P5OA 1NH2B 3F7YC 5FPOA 1I94B 4OGQB 1TUBB 4NB5A 4DK1A 2IH3C 1MA1A 2KKWA 3C90A 5GTIZ 1L1FA 5JWPA 3VQWA 5KX5B 4DUYO 1ORQC 1XHXA 2WLKA 5KHHA 4KHPB 1SA0B 3OEHG 5JJEB 4JI8O 4DR2B 4LF5O 1GRJA 4WFGA 1OCCB 3JAKB 1PP9H 3N2KA 4I7ZB 3ASOC 2NR5A 2EJRA 2L6LA 4O4HB 4O4LB 3CCMV 1S0VA 3STZC 3ICXA 3L9DA 4H44B 1YVWA 2IM9A 2UU9B 2WLHA 2YSUB 1MZFA 5EIBC 2HLDG 2BTQA 1VF6C 4BR6A 2M6YA 2RQ6A 5K1XA 1VF5B 4MVSA 2DQ0A 3CX5F 1ZSPA 3ABTA 2L35A 2H3OA 3HKBB 3PN1A 4O4LA 2IW5A 2ZR3A 3APOA 4LF7B 1W2BU 3W7TA 2DWEC 2QWOB 2Q7EA 2ITCC 3CYOA 2ZT9B 3ETEA 3FYIB 5CN0A 4QJFB 2ZE5A 1P84F 1M56B 3FD9A 3H01A 3ZHVA 2KG7A 4DUZO 3SDLA 2W6IG 3M7MX 3ZIAG 5EYPB 1AP5A 1S76D 2EIJC 1S77D 2EX3A 3ZBHA 3QO8A 2QWQB 3AG1C 1MABG 2KQXA 3O65A 1KYOF 3ZMSA 4XDLA 1K97A 3G80A 1ENVA 4X66O 1H2KA 4LFBO 5DM6V 5BY1A 1IDSA 1VF7A 5H6QA 5KA6A 4O4JA 4LF6B 3TJTA 2JGUA 3VQXA 5LYJB 1Z5VA 5AG2A 4LF5B 2WSSG 5EK0A 1R6KA 3H9VA 1JFFB 4DV0O 1GM9A 1LNQA 4LNUB 3SYOA 1Q6UA 1QHTA 1PM9A 4DV2O 2M7WA 3L73H 5TISZ 1WA8A 3A8TA 4J7ZA 1MOFA 1MMMA 2CTQA 4WFEA 5EIBD 1Q81W 1AI4A 3ZJZA 5LHHA 2P7TC 4EFEA 1R3IC 1L8DA 4GX0A 4QIWF 1OJHA 5B1BB 4X65O 1N0JA 1IXBA 4DV4B 4MVRA 4U3JB 4PA4A 3D36C 4QPJA 1EN5A 4F6EA 3U11A 2N05A 4FK5C 2VS0A 2QR4A 1P7BA 3L75H 1YSCA 2OIEA 4UVCA 4JPRA 2LFSA 3OUSA 2CE4A 1NQTA 5BZBA 3CCLV 2HEPA 5FLXN 1HNWO 1IZ3A 1FOUA 5CMUA 3VQYA 2AZ0A 1N36B 4JI3B 4DW1A 4YJ2A 2GDSA 3FB7C 4B3SB 1B3QA 2EILC 2BSKB 3KKYA 4CZZA 3WB2A 1MG1A 1JNBA 4JI2B 4FLYA 4ZIBA 2K9PA 5EZYA 3CC4V 1AVMA 1IBKB 2XOKG 4B3RB 5CB4A 5KHIA 4CS3A 5JVDA 4D7TA 1N34B 2UXCO 3T1YO 2E74B 1ZL8B 3J81N 4ZI7A 3OR6C 4CBCA 1FJGB 4CS4A 3CC7V 3R66A 4UCTA 2B1GA 2DW4A 2Z3YA 4KL1A 4KP4A 3BABA 3JAMN 2ZM6O 1N32O 1YIJV 4JI0O 3HKCA 3VBBA 1HNZB 1XHZA 4JASA 1TAEA 1GMGA 1KQSU 1YTFD 1D2DA 3JARB 1DGSA 4JTCB 4K35A 2UXBO 2VQFB 2DYRB 3LDEA 2QM8A 1QR9A 1AROP 2CH7B 4MTOA 1OCRB 3IC7A 1K3EA 5H2FZ 3TCUA 2UXDB 3KDRA 3DTUB 3ZN0A 3UO2A 1FFTB 3WB1A 4NTXA 1I5XA 2WA3A 5LGNA 2DYRC 2AHYA 3AG3C 3ZS8C 1SZTA 2V1DA 3UM7A 4AHCA 4P30A 4ASUG 2RDCA 3QG5A 4BWAA 2YI9A 3U10A 4RUFA 1OCZB 5JJNB 3VOUA 2CTRA 1SQBH 1S5HC 2OWOA 4B3MO 4WFBV 1FXKB 4AI8A 3CJHA 1CPYA 1S3JA 4NXMO 3JYCA 2QWPB 1J95A 1Y74A 3ASNB 1XI1A 2UXBB 3G71V 4JTAB 3NR7A 1GTOA 2Q68A 4FJCC 5EC2C 1WB7A 2EINB 1VQ7V 2Q7HA 4DUZB 4DV3O 5CB4B 1VQ4V 1Y76A 2PI4A 1FD9A 1IXMA 1YITV 3OFNG 1NTKH 1HNXO 3H1KH 4G2KA 3FB5C 1QNMA 3STLC 3CRCA 4WBNA 1JPXA 4YJ2B 1PD3A 3KG2A 4B3TO 4OX9B 3CMAV 3LSSA 4HBNA 5B1AC 1CXZB 1KKCA 4J7JA 4X64O 3JAWA 4IHJA 4EB6B 4U7OA 3ZMUA 1I08A 2B5UA 4NXMB 4H0LB 1K5SA 1F51A 2OCCB 2IJIA 3FFQA 5LHIA 3E8HA 1M57B 1BT8A 2Y4TA 3HR0A 3K03A 1QBZA 1GH6A 4AILC 5FNVB 4I0XB 2Q4PA 4P2ZA 3ZHTA 1I0HA 4DR2O 4F4LA 1KC8W 4J9ZB 1N4CA 4YIOA 1ZUQA 4FZ0A 5L3EA 4DV1O 1RM1B 5L3CA 3SPGA 5B1BC 3IFXA 2HKOA 1WB8A 3GVMA 1QVFU 5GONB 2ZKOA 2NLJC 3FYEB 1O9HA 1Q6HA 4PELA 4TQFA 3H1JH 1EN4A 3ZMZA 1VF6A 5J2TB 5B66Z 1OCZC 2ADPA 2AXTZ 2ETNA 2QM4A 2CTPA 1Y74B 1F4MA 1MZEA 3SJCC 3OEEG 3CE2A 3CHXA 2Q8VA 1SKVA 1Y4MA 2XAHA 1K7DA 3H1LH 1CEZA 3CXHF 1OCOB 4Q6GA 1BQ0A 4DK0A 3AK3A 3FAVB 2JGDB 2Y48A
chains in the Genus database with same CATH topology
4GUNA 2ADQB 4FFKA 1WB7A 1ZTEA 1VARA 3BFRA 1IDSA 3TJTA 1EM1A 1GN2A 1EN6A 1GN4A 1P7GA 3C3SA 5AG2A 1MA1A 1JA8A 1QNMA 5A9GA 1GN3A 2CDYA 3QVNA 2QKAA 1PM9A 3MDSA 1KKCA 4C7UA 1XDCA 1MMMA 1I08A 3LSUA 3IC9A 4JYYA 3C3TA 1MNGA 1BT8A 1AR5A 1IX9A 1VEWA 2RCVA 1AP6A 1N0JA 1I0HA 3DC5A 1AR4A 1IXBA 1JR9A 1LUVA 1LUWA 4YIOA 2AW9A 1ZUQA 3KDRA 1Y67A 1EN5A 4BR6A 4F6EA 4E4EA 2QKCA 1WB8A 1ZLZA 4JZGA 1D5NA 3AK2A 2CE4A 1ZSPA 1EN4A 1GN6A 4X9QA 3DC6A 1XUQA 1BS3A 1MSDA 2ADPA 3CEIA 1XREA 3OT7A 2GDSA 3EVKA 3K9SA 1B06A 1N0NA 3KKYA 4YIPA 3RN4A 3AK1A 1SZXA 1BSMA 2P4KA 1AP5A 4JZ2A 1XILA 3AK3A 1AVMA 1PL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GUN A;  2ADQ B;  4FFK A;  1WB7 A;  1ZTE A;  1VAR A;  3BFR A;  1IDS A;  3TJT A;  1EM1 A;  1GN2 A;  1EN6 A;  1GN4 A;  1P7G A;  3C3S A;  5AG2 A;  1MA1 A;  1JA8 A;  1QNM A;  5A9G A;  1GN3 A;  2CDY A;  3QVN A;  2QKA A;  1PM9 A;  3MDS A;  1KKC A;  4C7U A;  1XDC A;  1MMM A;  1I08 A;  3LSU A;  3IC9 A;  4JYY A;  3C3T A;  1MNG A;  1BT8 A;  1AR5 A;  1IX9 A;  1VEW A;  2RCV A;  1AP6 A;  1N0J A;  1I0H A;  3DC5 A;  1AR4 A;  1IXB A;  1JR9 A;  1LUV A;  1LUW A;  4YIO A;  2AW9 A;  1ZUQ A;  1Y67 A;  1EN5 A;  4BR6 A;  4F6E A;  4E4E A;  2QKC A;  1WB8 A;  1ZLZ A;  4JZG A;  1D5N A;  3AK2 A;  2CE4 A;  1ZSP A;  1EN4 A;  1GN6 A;  4X9Q A;  3DC6 A;  1XUQ A;  1BS3 A;  1MSD A;  2ADP A;  3CEI A;  1XRE A;  3OT7 A;  2GDS A;  3EVK A;  3K9S A;  1B06 A;  1N0N A;  3KKY A;  4YIP A;  3RN4 A;  3AK1 A;  1SZX A;  1BSM A;  2P4K A;  1AP5 A;  4JZ2 A;  1XIL A;  3AK3 A;  1AVM A;  1PL4 A; 
#chains in the Genus database with same CATH topology
 1NKD A;  2FYU H;  4ABM A;  2CAZ C;  1ROP A;  1Z2G A;  4FM1 A;  1XNR B;  3CCE V;  1KU9 A;  1RPR A;  4X1Y A;  2OCC C;  2NN4 A;  3B40 A;  1GK9 A;  3RYC A;  4ZOL A;  2XUM A;  1GO3 F;  1JX9 A;  1TUB A;  1WP8 A;  2DQ3 A;  3OD4 A;  4LWS B;  2ZNJ A;  1Y6X A;  4PD4 F;  1PNK A;  2A79 B;  1DF5 A;  5IY5 B;  5LL6 Y;  1AR1 B;  4RAI A;  1K8A W;  1I5Y A;  4I55 B;  2IBZ H;  1FS0 G;  4DR7 O;  4X1I B;  4PDV A;  2JK5 C;  2B9Z A;  3L72 H;  1YJ9 V;  2R9I A;  4O4I B;  5KLV H;  3UT5 A;  4CS2 A;  4DRX B;  1NBM G;  2YIC A;  2G38 A;  1VQ6 V;  1KMI Z;  4OPA A;  3AG2 C;  5JVD B;  2JIZ G;  2C2A A;  2PYJ A;  5HFL A;  4KUM A;  2ARH A;  2UUA O;  4J41 A;  4MVM A;  3NXS A;  4D6T H;  1PPJ H;  3VQV A;  1FYJ A;  5GW7 A;  1F4N A;  2YI8 A;  5L3B A;  2P22 C;  1L0L H;  4K8Z A;  3LSQ A;  4LFC O;  4GX2 A;  3CC2 V;  2H8P C;  2QKS A;  1S72 V;  3K9S A;  4TOI A;  3WB0 A;  4K3A A;  4FLU A;  4TQD A;  4HZ3 A;  2QTO A;  4PA7 A;  2XND G;  4EFB A;  4JI5 B;  4NTW A;  4CC6 A;  3BA9 A;  5H9C A;  2JRI A;  1IUR A;  4LH7 A;  3D3I A;  1VIB A;  3G4S V;  3JD2 A;  2W6J G;  3JSN A;  4CH6 A;  2Q6A A;  1XMQ B;  3HKB A;  5E1A C;  1NTZ H;  1I7F A;  4LFB B;  2Q67 A;  1RSO A;  1JA8 A;  3T1C A;  5ITZ A;  4WCE V;  3CCJ V;  4UB8 Z;  1SQG A;  5IJ0 A;  1IBL B;  4OXS A;  1YI2 V;  2ZDI C;  5IJ9 B;  4A5U B;  1KKD A;  1NR1 A;  3RYI A;  3SYC A;  2RMK B;  4DV7 B;  3T4D A;  2YS8 A;  3JAT B;  4K0K O;  2F95 B;  4B3T B;  1XL6 A;  3SPJ A;  1SRY A;  4UCO A;  1YCI A;  4WFF A;  1HWY A;  3THO A;  5KA5 A;  5C8Y B;  2Q7G A;  5D5Q A;  3DSQ A;  1G6U A;  4ZOL B;  1VEW A;  3K79 A;  4U3F H;  5IYC O;  4EEQ A;  1N8R W;  3L74 H;  4LF7 O;  1VQO V;  2AW9 A;  3CCV V;  4IIJ A;  1PKX A;  3ZMT A;  1K34 A;  3EFF K;  1NVP B;  4MTG A;  2PGG A;  4J9Y B;  5LOV A;  4J7K A;  2F23 A;  2Z0A A;  2UXN A;  2UXX A;  3FAV A;  1Q8I A;  4X9Q A;  3T1H B;  2BE3 A;  4JAA A;  2ZE8 A;  4MTF A;  5LMU O;  1NH2 D;  3OM3 B;  1E1R G;  1S5J A;  4LFA O;  4I4T B;  2LGQ A;  2HP8 A;  4TV8 A;  5L3G A;  2PZS A;  3GWK C;  1B06 A;  2WPD G;  2ZXW C;  4EB6 A;  1IVS A;  4YIP A;  1BSM A;  2MW2 B;  2F4V O;  2P90 A;  2GHY A;  1ZWI C;  4YJ3 A;  4FFK A;  1N36 O;  5CBG A;  2Q69 A;  2W0X A;  1N33 B;  2WAM A;  3ZHR A;  4KXR A;  5BMV A;  2D2C B;  2ZR2 A;  1EBO A;  1FXK C;  1FXK A;  1EM1 A;  4ZI7 B;  2UXD O;  3C3S A;  1WA8 B;  3ZX6 A;  4LNU A;  5KHG A;  2CTW A;  2CDY A;  1NU1 H;  1AIL A;  4RO2 A;  1W0J G;  4X1K A;  1BQZ A;  3OAA G;  5LGU A;  2OT5 A;  1K9M W;  5D5P A;  2CGO A;  2ZIN A;  3CD6 V;  1AR5 A;  3E8G A;  1SQF A;  1HNZ O;  3CCR V;  4TV8 B;  4B7K A;  1LR1 A;  2XAF A;  3JAR A;  4DV0 B;  1N34 O;  2QDO A;  2XAS A;  2BOC C;  2WLI A;  2R72 A;  2ZIM A;  3RVZ A;  1IBK O;  4B3R O;  2JJ2 G;  4AQY O;  4QE9 A;  2QWN B;  4FZ1 A;  1GAX A;  1AI7 A;  1R3J C;  4N21 A;  1MSW D;  2YC0 A;  2R70 A;  5B3S B;  4JTD B;  1XBL A;  1VQK V;  3MHH C;  1M93 A;  3QNE A;  4DV5 B;  1H2N A;  4LFA B;  4PA9 A;  2ATK C;  4WF9 V;  3K3W A;  3WG7 C;  1QVG U;  3UT5 B;  5JCO C;  1N0N A;  5LMU B;  5JH7 B;  2IU3 A;  5CA1 B;  4JV5 O;  1F23 A;  4HNA A;  4X62 O;  5H6R A;  2BTQ B;  3LNM B;  4GLX A;  1XNR O;  3ETD A;  2DN9 A;  4JGS A;  4MS2 A;  5L3D A;  1VAR A;  1JCH A;  1HNX B;  5LYJ A;  3G67 A;  3B2E E;  1YEW A;  1TA8 A;  4X65 B;  1H2M A;  4ZKI A;  1R1B A;  1JQ0 A;  2OCH A;  3SR2 C;  2LFR A;  3B8N A;  3K5L A;  3ABK C;  3W7S A;  4IYH A;  3N2G B;  2E3C A;  4BIZ A;  1AJP A;  3AG4 B;  4CC5 A;  3OUF A;  1TVK B;  4P9O A;  3ML0 A;  3LUT B;  1QLE B;  3KCX A;  4NKG B;  4JI1 O;  3BEH A;  3LSU A;  2JVD A;  3C3T A;  1MNG A;  2WWW A;  1R73 A;  1QLE C;  4O2B B;  2ZNI A;  2HJD A;  1IBL O;  2RCV A;  1AP6 A;  3DC5 A;  3AG4 C;  4PJ0 Z;  4IIJ B;  3HB3 B;  1GM8 A;  4LF9 B;  3MHS C;  4LF4 O;  3T2M A;  1KBH A;  4E4E A;  2AZ2 A;  3CSX A;  1HDJ A;  2QGN A;  4RUE A;  1JFF A;  1V54 C;  3JCZ A;  3DC6 A;  4JI5 O;  2WLL B;  1YJN V;  1XMO O;  4R6Z A;  5E79 Z;  4O4J B;  1XRE A;  4OX9 O;  2EUL A;  2WA4 A;  2ZD9 A;  2B1I A;  3PJS K;  2Q0A A;  2IJH A;  5FNV A;  1Q43 A;  3JAL A;  2Z5U A;  2P4K A;  4O4I A;  2Y4U A;  3RWR D;  2FML A;  3F5W C;  1H8E G;  1Q7Y W;  1QLN A;  4TV9 B;  1SER A;  3HKE B;  3A0B Z;  4FLT A;  3AG1 B;  1NR7 A;  1SQV H;  2O57 A;  4U7N A;  3SJA C;  3FB6 C;  2UU9 O;  4LF8 B;  4JYA B;  3S3W A;  3BFR A;  5H5N A;  2JS3 A;  5HFM A;  3RVY A;  2DWD C;  2CUG A;  3JD3 A;  1RFY A;  4QE7 A;  1X59 A;  4JI4 B;  2A0L A;  1XMO B;  4UUJ C;  1YJW V;  4FIP C;  4NYK A;  3UO3 A;  4XDJ A;  3AG7 A;  1UJW B;  3RGB A;  1JJ2 U;  2A06 H;  2PYL A;  3W7U A;  1DK1 A;  3K5N A;  3OW2 U;  2IJK A;  2Y69 B;  4J11 A;  4LF9 O;  2JGD A;  4P9P A;  5EBW C;  1WPX A;  3CJH B;  5GON A;  3B09 A;  1AR4 A;  1PNM A;  2IJJ A;  1NJI W;  2DMX A;  4MTX A;  1JR9 A;  3N2K B;  5CA3 A;  2KB1 A;  2E5L B;  4RWU A;  4TSF G;  1BZK A;  4I9W A;  2FB5 A;  1VQP V;  5B5E Z;  5ITZ B;  3ETG A;  1K92 A;  3WFV A;  3E86 A;  2HHH O;  2QA4 V;  3P32 A;  3OMN B;  2VQE O;  3JCU Z;  1MSD A;  2KG7 B;  5LGT A;  2Q9L A;  1AJQ A;  5DN6 G;  3JAS A;  1G1X B;  2R9A A;  2ODM A;  3G6B A;  2LQT A;  3FX7 A;  4GZR B;  5KUK A;  2ZM6 B;  2UUA B;  3IGA C;  3AK1 A;  2DYS B;  5CA0 A;  2JEX A;  4DV2 B;  3TK1 A;  3BRC A;  4QPK A;  2EIM B;  1N33 O;  3ABL B;  4J10 A;  4TV9 A;  4JI6 O;  4NXN O;  1H38 A;  4BIU A;  3ABK B;  4TUY A;  5BR8 B;  2QE7 G;  4IHJ B;  2EIK C;  4L8J A;  2LGW A;  1JOY A;  3OMA B;  4PDL A;  2CK3 G;  2V7Q G;  5LMN B;  1GN4 A;  4DV1 B;  1QCE A;  4X20 A;  1GN3 A;  4OPH A;  1KEC A;  2HFE C;  2X7R B;  4JI3 O;  2EIN C;  1BMF G;  2JJ1 G;  3ZRV A;  1XDC A;  3SJB C;  4ZHQ A;  2XHB A;  4EKW A;  2RJZ A;  4LC1 A;  3SJQ C;  3DXR B;  3ASN C;  3TXQ A;  1OV9 A;  5EZY B;  1ZAU A;  4JYA O;  1Q82 W;  5IYD O;  5IJ0 B;  3K08 A;  1URF A;  3LDC A;  4J80 A;  3SPC A;  5JQG A;  3D36 A;  3L71 H;  5B1O A;  5J2U A;  3IAY A;  1GM7 A;  3OR7 C;  1R3L C;  3AG3 B;  2RN9 A;  4UFZ A;  4I9Q A;  1E1Q G;  3CB2 A;  1Q90 D;  3P30 A;  3CRA A;  4B7E A;  2P6J A;  1V55 B;  4K0K B;  4GKJ O;  2LJ2 A;  1FXV A;  1U96 A;  2Q0O C;  4R8C A;  4DR3 B;  3BA8 A;  5C93 A;  5IYZ B;  3OTO O;  4MVQ A;  2ILM A;  4TWK A;  1OCO C;  5GTH Z;  3SYQ A;  4JAU A;  4GKK O;  3K06 A;  3Q4H A;  3BPZ A;  1SZX A;  1KD1 W;  4LF4 B;  2P06 A;  5LXT B;  4FVM A;  4DR4 O;  3HKE A;  4X1K B;  5JCO A;  1VQ8 V;  4MVO A;  1CP9 A;  4GX5 A;  4YXW G;  5J2U B;  4GKJ B;  4XDK A;  3RW0 A;  3OTO B;  2YID A;  4KFM A;  4U3J A;  3TET A;  2FTK A;  4DR3 O;  4W4L A;  5FPR A;  2FL4 A;  2ZDI A;  1WP7 A;  5IJ9 A;  3ZN1 A;  3QVN A;  3B77 A;  5IYZ A;  4YJ3 B;  1W59 A;  5CA1 A;  2YIB D;  1VQM V;  4I50 A;  3APQ A;  4X1I A;  2DJV A;  1W0K G;  3RBZ A;  1HR0 B;  1FAF A;  4JI7 O;  2ZXW B;  1IX9 A;  1SQQ H;  4H13 B;  4X20 B;  4DV3 B;  4UCU A;  1NI8 A;  1H2L A;  2UUC B;  1RPO A;  2HR3 A;  1WJZ A;  2OIG A;  4PA3 A;  1LUW A;  3ETQ A;  5A2Q N;  1SF9 A;  4RQE A;  3T1Y B;  5IE9 A;  4DYL A;  1FJG O;  5KUM A;  3ZHQ A;  3BVO A;  3M99 B;  4N23 A;  1VQN V;  3CRM A;  4DR5 O;  4DV7 O;  4LR3 A;  1QR8 A;  4DV6 B;  2GBO A;  4FMT A;  4ICG A;  4I50 B;  4QNH B;  1HP8 A;  4B3S O;  1IBM B;  3ZRX A;  4PI2 A;  1J5E B;  1BCC H;  2E75 B;  2IH1 C;  1VQ5 V;  1H2G A;  4AQY B;  3ZHU A;  3W7X A;  2HVJ C;  1XMQ O;  2YDE A;  4NR1 A;  2PY5 A;  5LA6 B;  3L70 H;  1P49 A;  1SQP H;  4UCV A;  3UCS C;  2ADQ B;  3I55 V;  2GSM B;  1ZTE A;  2VQE B;  2HG5 C;  3OE7 G;  1AJN A;  3Q4H B;  2P4V A;  5FL7 G;  2NNU A;  5K1P A;  5A9G A;  3CWB H;  4TUY B;  5KHK A;  2QWR B;  3ZRW B;  2HHH B;  1FPO A;  2QKA A;  1FFX A;  1Q6I A;  3W7W A;  2ZQM A;  1M57 C;  2Q5Z A;  1V55 C;  3E2E A;  1SA0 A;  1S5L Z;  3FB8 C;  3IC9 A;  4X1Y B;  3A2F A;  4DR4 B;  4GYC B;  2H94 A;  4LF6 O;  2UXC B;  5CBH A;  4XBF A;  3JAS B;  3QTC A;  4HYO A;  2QSA A;  4X66 B;  1PL0 A;  5KHJ A;  4MT8 A;  5LOV B;  4PHZ A;  3RT3 C;  4DV6 O;  2AHZ A;  2XAJ A;  5LA6 A;  5KMG B;  5EC1 C;  3SPH A;  2F93 B;  3T1H O;  3ABM B;  4IL6 Z;  3K0G A;  3ZRS A;  2UUB B;  3AG2 B;  4E2L A;  2JS5 A;  3LDD A;  4LF8 O;  3A0H Z;  3KZI Z;  2IU0 A;  1PV0 A;  2UUC O;  1FXH A;  1NZ6 A;  3EHB B;  5J2T A;  1IJG A;  4H33 A;  3SYP A;  4PV1 B;  1COW G;  5KAI Z;  1Q5O A;  5EBL C;  5LBQ A;  5JJJ B;  5KMG A;  2PI5 A;  3J7A U;  1XEQ A;  2GTS A;  3JD4 A;  4W4K A;  3BCC H;  4YY3 B;  4PDM A;  4BIO A;  2X0L A;  1HW7 A;  4UCS A;  3BHP A;  5IY5 C;  1G4Y B;  4GUN A;  4MW3 A;  4R50 A;  3A0R A;  2ZIO A;  3GWO A;  1VQL V;  3ABL C;  3I56 V;  2ZCE A;  2CGN A;  3N2G A;  2DYS C;  3RYC B;  3TXS A;  1P7G A;  2VWJ A;  3S3X A;  3K0D A;  2YIB A;  1A32 A;  4LBE C;  4O2B A;  3G6E V;  2JDI G;  1RP3 B;  3D3Q A;  3UQ8 A;  4FLX A;  2EZP A;  3E8F A;  4O2A A;  1ZX3 A;  3HKC B;  4JI6 B;  4C7U A;  1US6 A;  3HKD A;  4BW5 A;  4TT3 G;  3T4Z A;  3JAL B;  1K33 A;  4DUY B;  4GX1 A;  4X8A A;  3DGE A;  1BL8 A;  1Z5W A;  4KHP O;  4MW8 A;  3EXA A;  3R65 A;  1QU7 A;  4HNA B;  1RSO B;  4D7S A;  5JH7 A;  3CCQ V;  1ZL8 A;  4DXW A;  1NS1 A;  1V9P A;  4YHH O;  1LUV A;  3CRR A;  4LFC B;  1I94 O;  3B4S A;  3P3P A;  2HJF C;  1EZJ A;  3OGC C;  1M4U A;  1SES A;  1UFI A;  4JF3 A;  4F6R B;  3WU2 Z;  4JI1 B;  5LHG A;  1R3K C;  4JZG A;  2F43 G;  1BGY H;  2R9R B;  2LO1 A;  2VQF O;  2F1M A;  3E8B A;  1K4C C;  3HKD B;  3LNN A;  1T5E A;  1RM1 C;  4DR1 O;  1YTF B;  1JVM A;  1BHB A;  3MAQ A;  4Z1M G;  2AGA A;  2GV9 A;  4YY3 O;  3K58 A;  4I0X A;  2YXL A;  4JYB A;  1N32 B;  1B6Q A;  4UB6 Z;  4DW0 A;  1EZV H;  5EYP A;  2EIL B;  3QF7 A;  3RN4 A;  1M56 C;  1PNL A;  4O2A B;  2UUB O;  1YZB A;  5B1A B;  2QJ1 A;  1TVK A;  2F66 C;  1R6T A;  1IBM O;  3N27 A;  1H2S B;  1JMK C;  4B3M B;  4DR7 B;  1XQ8 A;  1TUE B;  3E35 A;  3P3N A;  1K5Q A;  1X4T A;  4JI4 O;  1EN6 A;  3RYH B;  4DR5 B;  2KSD A;  1O9G A;  2VWK A;  1F7Y A;  3DXR A;  4NXN B;  2D3O W;  4UXN A;  5L3F A;  4UVA A;  1TGO A;  3ABM C;  1HNW B;  2XAQ A;  1YXB A;  2YXH A;  2N04 A;  4PA6 A;  4FM0 A;  3UKM A;  2PF4 E;  1P4R A;  1M1K W;  1OCC C;  2A9H A;  1M9N A;  4DO2 A;  2EZO A;  5LP6 A;  5LP6 C;  1DLB A;  5IWA O;  1DF4 A;  1YDX A;  3ZCC A;  3CCS V;  1WPB A;  4LP8 A;  4DR6 O;  3O9O A;  4G28 B;  1GN6 A;  1Q86 W;  2ITD C;  4FLW A;  4K8X A;  4BAY A;  3E89 A;  4JI0 B;  2BCC H;  5DED A;  1VMG A;  4YHH B;  1OCR C;  3IJ4 A;  2XTA A;  5CA0 B;  4CH3 A;  2GTA A;  3ZHS A;  1J5E O;  1AI5 A;  1G8M A;  4Z1V A;  1B04 A;  1R6N A;  3FKS G;  1FFX B;  4GKK B;  1XIL A;  2GUZ B;  1PL4 A;  4R7C A;  3RYF A;  5BMV B;  3JSL A;  4PI0 A;  4X64 B;  3D8C A;  3RYI B;  4UCR A;  4FPP A;  4QGP A;  4X88 A;  4UVB A;  4RQF A;  4HAM A;  2OTL V;  3GB7 C;  3J80 N;  2LP7 A;  3OTF A;  2BTO A;  3OMI B;  1GN2 A;  1WAZ A;  1OHH G;  2X6B A;  4IGG A;  4UV9 A;  4FFB B;  3E83 A;  5C8Y A;  2W0F C;  4LCU C;  1AI6 A;  1K4D C;  3TGU H;  3CS5 A;  3I5D A;  2FKX A;  4WFH A;  4ZBM A;  1Y66 A;  2K1E A;  2YEV A;  4JI7 B;  1VQ9 V;  3SPI A;  4I4T A;  1NT2 B;  1HR0 O;  2Y0I A;  5KX5 A;  2N74 A;  2A7W A;  2QTS A;  2HVK C;  2XT9 A;  2X6C A;  3JAK A;  4GT1 A;  4I5S A;  1THZ A;  4IT5 A;  4JYY A;  2EIK B;  4B08 A;  1FKA O;  1WLE A;  3X2Q C;  2RNB A;  3SYA A;  4WBN B;  4X62 B;  4DV4 O;  2LW7 A;  3K57 A;  2V4D A;  1BE3 H;  3K59 A;  1OZ0 A;  4FLZ A;  1D5A A;  2PUS A;  3M8A A;  3H1I H;  4NTY A;  1ZLZ A;  2Y0P A;  4FM2 A;  3SGI A;  2X6A A;  3AK2 A;  3K9A A;  2EJ7 A;  4BW9 A;  3ZRW A;  1KUQ A;  2YUA A;  1M90 W;  5KAF Z;  2YEV B;  1BS3 A;  4JI8 B;  1AB3 A;  3CEI A;  3E22 A;  5LP6 B;  3JAT A;  3K5M A;  2WLM A;  1H8H G;  3ABU A;  3CME V;  1E79 G;  5J9P C;  3OT7 A;  4J42 A;  2P67 A;  1SC5 B;  1V54 B;  1Y76 B;  2VRZ A;  3K04 A;  1Q3E A;  1GKF A;  4JZ2 A;  1K73 W;  1YHQ V;  4PDR A;  3KCY A;  2OTJ V;  4DR6 B;  3H1H H;  3AEI A;  2A3Q A;  2Q73 A;  3E22 B;  3RYF B;  2GUZ A;  1XNQ B;  5LXT A;  5CBF A;  4MVU A;  3CRQ A;  4X89 A;  3F5T A;  3RYH A;  2Y69 C;  2BSK A;  2LW1 A;  4LH6 A;  3QO7 A;  2YXY A;  2CH7 A;  3BAA A;  3CP1 A;  3RFR A;  3U0Z A;  2OYQ A;  4CH4 A;  2E5L O;  3MDS A;  4MSW C;  4I55 A;  4Q20 A;  2EIJ B;  3OGI B;  3K5O A;  1L0N H;  4CH5 A;  4JV5 B;  3JD0 A;  4JYC A;  3X2Q B;  4LWS A;  5DEC A;  1YF2 A;  2F4V B;  4JI2 O;  1H5W A;  4H37 A;  2QEX V;  5BXZ A;  4DV5 O;  5F2V O;  2E76 B;  5JQG B;  4MVZ A;  1EFR G;  4JAV A;  4F6R A;  1JJO A;  5BR8 O;  2BOB C;  3CCU V;  5B1N A;  1KB9 F;  2PTM A;  4G27 B;  3CPW U;  1Y67 A;  1SS3 A;  1KP2 A;  4DRX A;  5LMN O;  2XAG A;  2ZE6 A;  2QKC A;  5IYB O;  4FFB A;  1D5N A;  4L87 A;  2DE0 X;  2WLJ A;  2DOS A;  2JEU A;  4WFA V;  4GCZ A;  4ZHQ B;  1U97 A;  3B8M A;  5IDJ A;  3WG7 B;  3MD0 A;  1NTM H;  4IYI A;  1XUQ A;  2ZE7 A;  5EBM C;  1WN7 A;  1SET A;  3CXC U;  1SQX H;  2MK3 A;  2WLL A;  4UV8 A;  4Z2W A;  3BY6 A;  3QO5 A;  3ZED A;  5B3S C;  4O4H A;  3ASO B;  2YIA A;  3EVK A;  4FLV A;  1WNS A;  4DR1 B;  1QQC A;  3JD1 A;  2QM7 A;  1BHA A;  1VP7 A;  5IWA B;  2WLI B;  4NVP A;  1XNQ O;  2EBO A;  3F7V C;  2EIM C;  1NVP D;  1XOU A;  3ZMV A;  3JAW B;  1UPG A;  1DTO A;  2WLN A;  1KP3 A;  1XL4 A;  5IT9 N;  3HPL C;  1M5I A;  2P5O A;  1NH2 B;  3F7Y C;  5FPO A;  1I94 B;  4OGQ B;  1TUB B;  4NB5 A;  4DK1 A;  2IH3 C;  1MA1 A;  2KKW A;  3C90 A;  5GTI Z;  1L1F A;  5JWP A;  3VQW A;  5KX5 B;  4DUY O;  1ORQ C;  1XHX A;  2WLK A;  5KHH A;  4KHP B;  1SA0 B;  3OEH G;  5JJE B;  4JI8 O;  4DR2 B;  4LF5 O;  1GRJ A;  4WFG A;  1OCC B;  3JAK B;  1PP9 H;  3N2K A;  4I7Z B;  3ASO C;  2NR5 A;  2EJR A;  2L6L A;  4O4H B;  4O4L B;  3CCM V;  1S0V A;  3STZ C;  3ICX A;  3L9D A;  4H44 B;  1YVW A;  2IM9 A;  2UU9 B;  2WLH A;  2YSU B;  1MZF A;  5EIB C;  2HLD G;  2BTQ A;  1VF6 C;  4BR6 A;  2M6Y A;  2RQ6 A;  5K1X A;  1VF5 B;  4MVS A;  2DQ0 A;  3CX5 F;  1ZSP A;  3ABT A;  2L35 A;  2H3O A;  3HKB B;  3PN1 A;  4O4L A;  2IW5 A;  2ZR3 A;  3APO A;  4LF7 B;  1W2B U;  3W7T A;  2DWE C;  2QWO B;  2Q7E A;  2ITC C;  3CYO A;  2ZT9 B;  3ETE A;  3FYI B;  5CN0 A;  4QJF B;  2ZE5 A;  1P84 F;  1M56 B;  3FD9 A;  3H01 A;  3ZHV A;  2KG7 A;  4DUZ O;  3SDL A;  2W6I G;  3M7M X;  3ZIA G;  5EYP B;  1AP5 A;  1S76 D;  2EIJ C;  1S77 D;  2EX3 A;  3ZBH A;  3QO8 A;  2QWQ B;  3AG1 C;  1MAB G;  2KQX A;  3O65 A;  1KYO F;  3ZMS A;  4XDL A;  1K97 A;  3G80 A;  1ENV A;  4X66 O;  1H2K A;  4LFB O;  5DM6 V;  5BY1 A;  1IDS A;  1VF7 A;  5H6Q A;  5KA6 A;  4O4J A;  4LF6 B;  3TJT A;  2JGU A;  3VQX A;  5LYJ B;  1Z5V A;  5AG2 A;  4LF5 B;  2WSS G;  5EK0 A;  1R6K A;  3H9V A;  1JFF B;  4DV0 O;  1GM9 A;  1LNQ A;  4LNU B;  3SYO A;  1Q6U A;  1QHT A;  1PM9 A;  4DV2 O;  2M7W A;  3L73 H;  5TIS Z;  1WA8 A;  3A8T A;  4J7Z A;  1MOF A;  1MMM A;  2CTQ A;  4WFE A;  5EIB D;  1Q81 W;  1AI4 A;  3ZJZ A;  5LHH A;  2P7T C;  4EFE A;  1R3I C;  1L8D A;  4GX0 A;  4QIW F;  1OJH A;  5B1B B;  4X65 O;  1N0J A;  1IXB A;  4DV4 B;  4MVR A;  4U3J B;  4PA4 A;  3D36 C;  4QPJ A;  1EN5 A;  4F6E A;  3U11 A;  2N05 A;  4FK5 C;  2VS0 A;  2QR4 A;  1P7B A;  3L75 H;  1YSC A;  2OIE A;  4UVC A;  4JPR A;  2LFS A;  3OUS A;  2CE4 A;  1NQT A;  5BZB A;  3CCL V;  2HEP A;  5FLX N;  1HNW O;  1IZ3 A;  1FOU A;  5CMU A;  3VQY A;  2AZ0 A;  1N36 B;  4JI3 B;  4DW1 A;  4YJ2 A;  2GDS A;  3FB7 C;  4B3S B;  1B3Q A;  2EIL C;  2BSK B;  3KKY A;  4CZZ A;  3WB2 A;  1MG1 A;  1JNB A;  4JI2 B;  4FLY A;  4ZIB A;  2K9P A;  5EZY A;  3CC4 V;  1AVM A;  1IBK B;  2XOK G;  4B3R B;  5CB4 A;  5KHI A;  4CS3 A;  5JVD A;  4D7T A;  1N34 B;  2UXC O;  3T1Y O;  2E74 B;  1ZL8 B;  3J81 N;  4ZI7 A;  3OR6 C;  4CBC A;  1FJG B;  4CS4 A;  3CC7 V;  3R66 A;  4UCT A;  2B1G A;  2DW4 A;  2Z3Y A;  4KL1 A;  4KP4 A;  3BAB A;  3JAM N;  2ZM6 O;  1N32 O;  1YIJ V;  4JI0 O;  3HKC A;  3VBB A;  1HNZ B;  1XHZ A;  4JAS A;  1TAE A;  1GMG A;  1KQS U;  1YTF D;  1D2D A;  3JAR B;  1DGS A;  4JTC B;  4K35 A;  2UXB O;  2VQF B;  2DYR B;  3LDE A;  2QM8 A;  1QR9 A;  1ARO P;  2CH7 B;  4MTO A;  1OCR B;  3IC7 A;  1K3E A;  5H2F Z;  3TCU A;  2UXD B;  3KDR A;  3DTU B;  3ZN0 A;  3UO2 A;  1FFT B;  3WB1 A;  4NTX A;  1I5X A;  2WA3 A;  5LGN A;  2DYR C;  2AHY A;  3AG3 C;  3ZS8 C;  1SZT A;  2V1D A;  3UM7 A;  4AHC A;  4P30 A;  4ASU G;  2RDC A;  3QG5 A;  4BWA A;  2YI9 A;  3U10 A;  4RUF A;  1OCZ B;  5JJN B;  3VOU A;  2CTR A;  1SQB H;  1S5H C;  2OWO A;  4B3M O;  4WFB V;  1FXK B;  4AI8 A;  3CJH A;  1CPY A;  1S3J A;  4NXM O;  3JYC A;  2QWP B;  1J95 A;  1Y74 A;  3ASN B;  1XI1 A;  2UXB B;  3G71 V;  4JTA B;  3NR7 A;  1GTO A;  2Q68 A;  4FJC C;  5EC2 C;  1WB7 A;  2EIN B;  1VQ7 V;  2Q7H A;  4DUZ B;  4DV3 O;  5CB4 B;  1VQ4 V;  1Y76 A;  2PI4 A;  1FD9 A;  1IXM A;  1YIT V;  3OFN G;  1NTK H;  1HNX O;  3H1K H;  4G2K A;  3FB5 C;  1QNM A;  3STL C;  3CRC A;  4WBN A;  1JPX A;  4YJ2 B;  1PD3 A;  3KG2 A;  4B3T O;  4OX9 B;  3CMA V;  3LSS A;  4HBN A;  5B1A C;  1CXZ B;  1KKC A;  4J7J A;  4X64 O;  3JAW A;  4IHJ A;  4EB6 B;  4U7O A;  3ZMU A;  1I08 A;  2B5U A;  4NXM B;  4H0L B;  1K5S A;  1F51 A;  2OCC B;  2IJI A;  3FFQ A;  5LHI A;  3E8H A;  1M57 B;  1BT8 A;  2Y4T A;  3HR0 A;  3K03 A;  1QBZ A;  1GH6 A;  4AIL C;  5FNV B;  4I0X B;  2Q4P A;  4P2Z A;  3ZHT A;  1I0H A;  4DR2 O;  4F4L A;  1KC8 W;  4J9Z B;  1N4C A;  4YIO A;  1ZUQ A;  4FZ0 A;  5L3E A;  4DV1 O;  1RM1 B;  5L3C A;  3SPG A;  5B1B C;  3IFX A;  2HKO A;  1WB8 A;  3GVM A;  1QVF U;  5GON B;  2ZKO A;  2NLJ C;  3FYE B;  1O9H A;  1Q6H A;  4PEL A;  4TQF A;  3H1J H;  1EN4 A;  3ZMZ A;  1VF6 A;  5J2T B;  5B66 Z;  1OCZ C;  2ADP A;  2AXT Z;  2ETN A;  2QM4 A;  2CTP A;  1Y74 B;  1F4M A;  1MZE A;  3SJC C;  3OEE G;  3CE2 A;  3CHX A;  2Q8V A;  1SKV A;  1Y4M A;  2XAH A;  1K7D A;  3H1L H;  1CEZ A;  3CXH F;  1OCO B;  4Q6G A;  1BQ0 A;  4DK0 A;  3AK3 A;  3FAV B;  2JGD B;  2Y48 A; 
#chains in the Genus database with same CATH homology
 4GUN A;  2ADQ B;  4FFK A;  1WB7 A;  1ZTE A;  1VAR A;  3BFR A;  1IDS A;  3TJT A;  1EM1 A;  1GN2 A;  1EN6 A;  1GN4 A;  1P7G A;  3C3S A;  5AG2 A;  1MA1 A;  1JA8 A;  1QNM A;  5A9G A;  1GN3 A;  2CDY A;  3QVN A;  2QKA A;  1PM9 A;  3MDS A;  1KKC A;  4C7U A;  1XDC A;  1MMM A;  1I08 A;  3LSU A;  3IC9 A;  4JYY A;  3C3T A;  1MNG A;  1BT8 A;  1AR5 A;  1IX9 A;  1VEW A;  2RCV A;  1AP6 A;  1N0J A;  1I0H A;  3DC5 A;  1AR4 A;  1IXB A;  1JR9 A;  1LUV A;  1LUW A;  4YIO A;  2AW9 A;  1ZUQ A;  3KDR A;  1Y67 A;  1EN5 A;  4BR6 A;  4F6E A;  4E4E A;  2QKC A;  1WB8 A;  1ZLZ A;  4JZG A;  1D5N A;  3AK2 A;  2CE4 A;  1ZSP A;  1EN4 A;  1GN6 A;  4X9Q A;  3DC6 A;  1XUQ A;  1BS3 A;  1MSD A;  2ADP A;  3CEI A;  1XRE A;  3OT7 A;  2GDS A;  3EVK A;  3K9S A;  1B06 A;  1N0N A;  3KKY A;  4YIP A;  3RN4 A;  3AK1 A;  1SZX A;  1BSM A;  2P4K A;  1AP5 A;  4JZ2 A;  1XIL A;  3AK3 A;  1AVM A;  1PL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...