1ZUQA

Contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAVVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zuqA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zuqA02
1AVMA 3MDSA 3DC5A 1IXBA 1PL4A 1MA1A 1IDSA 1IX9A 1QNMA 3TJTA 1EN6A 1ZSPA 1BT8A 2QKAA 3OT7A 1AP5A 1JR9A 5AG2A 4YIPA 1MSDA 3QVNA 2P4KA 3AK1A 1N0JA 3IC9A 1GN6A 4FFKA 1AR4A 1KKCA 3LSUA 3RN4A 1VEWA 4YIOA 3BFRA 1XDCA 2GDSA 3K9SA 1B06A 1XILA 3CEIA 1AR5A 1EN5A 1EM1A 1XREA 1N0NA 1Y67A 2ADPA 1MNGA 4GUNA 1MMMA 3KKYA 1AP6A 1GN4A 5A9GA 2CE4A 1D5NA 3DC6A 1I0HA 4F6EA 4E4EA 4JZ2A 1LUVA 3AK3A 1PM9A 1ZUQA 1WB7A 3EVKA 1GN3A 1ZTEA 2ADQB 4C7UA 1WB8A 2QKCA 2CDYA 1EN4A 1VARA 3AK2A 1BS3A 2RCVA 4JZGA 3C3SA 1JA8A 1I08A 1ZLZA 1SZXA 1LUWA 1GN2A 1XUQA 4X9QA 4JYYA 1P7GA 1BSMA 3C3TA 4BR6A 2AW9A
chains in the Genus database with same CATH superfamily
5IYDO 3T1YO 3CRAA 3FAVA 2OTJV 1M56B 3U0ZA 4LP8A 1K5SA 3JASB 4TWKA 4NYKA 4AQYB 2OCCC 1NTZH 4D7SA 5LMUB 3CHXA 1ROPA 4LFCO 3ZRSA 2IBZH 1ZSPA 3MHHC 1AI5A 1XOUA 1OJHA 1EZVH 2Q73A 3ASOC 5GTIZ 4EFBA 5L3BA 4BAYA 4FM1A 1ZWIC 4YY3B 3SPIA 4LFAB 1FOUA 1NKDA 4G28B 4MTOA 2UXCB 1KU9A 4I4TB 1NVPD 3F7YC 2QE7G 3SPHA 4G2KA 4W4LA 4LR3A 2WLKA 3APOA 3S3XA 4J7KA 4WFBV 2Y48A 2OCHA 1SKVA 3JCUZ 4I50A 1AI6A 1EN5A 3E2EA 2YUAA 5EIBD 2BOBC 4LNUB 5CN0A 1WA8B 2ZNJA 4TQDA 3RBZA 4DV5B 1EFRG 1XHXA 2YIAA 5CBHA 4GKKB 3FB8C 1Z5WA 4D7TA 3UO3A 1HNZO 5LP6A 4JPRA 4DV1B 1GN3A 4H13B 5L3DA 2W0FC 2DQ3A 1B3QA 3ZN0A 1XEQA 2G38A 1Q3EA 2JGUA 1GO3F 1ZL8A 4LWSA 3H1LH 1AJNA 5L3CA 4JZGA 5FLXN 5IT9N 2IJIA 2XTAA 5JH7B 1URFA 5IE9A 1U96A 3OW2U 2EIJB 1XUQA 5CA0B 4RWUA 3G6EV 1M93A 4MVRA 5DM6V 4RAIA 3DGEA 5JVDB 3ZRWA 1RSOA 1OV9A 2JDIG 3QNEA 4X62B 1I94O 5KAFZ 2MK3A 4Q20A 1W0KG 4LF7O 4JI2O 1R6KA 1N4CA 1GM9A 2BOCC 4FPPA 4H37A 3SPGA 2JEXA 3E8HA 3N2GB 4DR4O 3AK1A 3ASNC 3H9VA 4DR2B 4ZBMA 1Q86W 2KG7A 4N21A 3ML0A 2R9IA 1KKCA 2B1IA 5JQGB 2ZKOA 4ICGA 3ZRXA 3K5MA 2OWOA 2WLLA 2WLHA 3CWBH 2WLMA 2CH7B 4EKWA 5BMVB 3APQA 4B7KA 2XAGA 3ABMB 1XILA 4I5SA 4JV5B 3BCCH 1YTFD 1GK9A 1BGYH 3ABUA 3CPWU 3BPZA 2JGDA 3KCYA 2YICA 4QNHB 3EXAA 4PA7A 1VQLV 3OGIB 2X6AA 4JI6B 4RQFA 3JALA 5LYJA 3R66A 4K35A 4F6EA 3GWKC 1QVGU 4LF8O 4LFBO 3I5DA 3W7TA 3RGBA 1NI8A 4I7ZB 3OR6C 1YXBA 2P7TC 4DUZB 3FYEB 1G8MA 1IBMO 2ETNA 3JASA 3AG4C 4H0LB 2QTSA 3SJQC 4LF5O 1JPXA 3STZC 1I5YA 2ZE8A 4PELA 3SJAC 2DJVA 4KP4A 5C93A 5FPOA 3UM7A 5KLVH 4FLTA 4DR1B 3OGCC 3VQWA 4QJFB 4DR7B 1T5EA 1Y4MA 3ZRVA 5EK0A 2KQXA 1M56C 3KZIZ 1XBLA 1EBOA 4XDLA 3K5OA 1NT2B 1XMOO 4I4TA 4GYCB 1P49A 4UXNA 3E83A 2Z3YA 1FYJA 3IJ4A 1KP3A 1TAEA 3X2QC 1Q81W 1EZJA 5EIBC 4PA4A 4NXNB 1CP9A 3ZHRA 1KKDA 3FKSG 1CEZA 2HEPA 3K5LA 1K9MW 1HNXB 2QWQB 2QKSA 5KUKA 2JJ2G 1JJ2U 1PNKA 5LHGA 4D6TH 3G4SV 4LNUA 1WA8A 1W59A 1R3IC 1HR0B 4DR5O 2WA4A 5CBGA 3AEIA 2LGWA 2V7QG 1VQ9V 1RPRA 3T1CA 5H5NA 2XOKG 4R6ZA 2ZR3A 1I5XA 3L72H 2L6LA 4Q6GA 5CA3A 3CCMV 2PTMA 1GM7A 3CXHF 1PNMA 3F5TA 1XNQB 2UXXA 1Y67A 2O57A 1GKFA 2WLNA 3QO8A 5CB4B 2VRZA 2UUBB 4JTDB 5JH7A 5A9GA 2IU3A 3K03A 1KD1W 2L35A 1O9GA 2W0XA 3A8TA 3CCUV 4F6RB 5CA0A 4TV9B 3T1HO 3M8AA 4OGQB 1J5EB 5JVDA 2EIMB 5KMGB 2QKCA 1D2DA 1EN4A 4WBNB 1BE3H 2Y0PA 2UXNA 2IJHA 4GX5A 1DLBA 4U7OA 4G27B 4YJ3B 2EIJC 1YJNV 3JD2A 1IBKB 1DF4A 1SZXA 3JARB 3SPJA 1CPYA 2LGQA 1P7GA 3N2GA 1K73W 5B3SC 1AVMA 3BVOA 1RM1B 3CRMA 5BZBA 1XNRO 1MA1A 3RYHB 1SA0B 5JQGA 2Q9LA 2Y0IA 4PA6A 4B3SB 2IH1C 2CH7A 4FLVA 5BMVA 3BY6A 1R1BA 2BE3A 3K04A 4DR3B 2WAMA 5BR8B 1A32A 5CBFA 3DTUB 4FLUA 3ETEA 1SQGA 4DXWA 3L71H 4PDLA 2LW7A 3IGAC 4UVCA 1FFTB 4FJCC 2YIBD 2A3QA 4KHPO 3AG2B 3G67A 1IXMA 1LNQA 3NR7A 4O2BB 1N36O 2F23A 4EEQA 2PI5A 1VQKV 2EJ7A 4I9QA 4UB6Z 4DV3O 3JSLA 2R9AA 3P32A 4LC1A 1PM9A 2W6JG 4JI5O 4U3JB 4Z1MG 3CCLV 3ZMUA 4K0KO 4JI7B 3B2EE 1K3EA 3ABLC 4U7NA 3H1IH 4WFAV 1NTKH 4WFGA 1YITV 1K7DA 1DF5A 4DO2A 4X65B 2HLDG 2F4VO 1WNSA 4FIPC 2ODMA 4JGSA 4P30A 1N32B 1SQFA 4YHHO 2QA4V 4BR6A 3A0BZ 4WCEV 4X8AA 2XAHA 4RUFA 1Q6HA 2B9ZA 1TUEB 3CCEV 4Z2WA 2QM4A 4UV8A 2EX3A 3WU2Z 2OYQA 4R8CA 3D8CA 2UUAB 4ABMA 3TJTA 4KXRA 4X64O 1BT8A 2QKAA 4ZIBA 2EIKB 3P3PA 1G1XB 5LHIA 3A0HZ 1D5AA 3CRQA 2JK5C 1WN7A 3CB2A 2QWNB 3WG7B 5CB4A 1PPJH 3U10A 1N0JA 3CSXA 3FD9A 4GT1A 4O4HB 1VQNV 1NR1A 4LH6A 4MVOA 4UUJC 1TGOA 1Y76B 5J2TB 5EBLC 4F6RA 2Q7HA 1COWG 3SJCC 4LF6O 4MS2A 4TV9A 4TT3G 4MTGA 2OIEA 1YJ9V 5GONB 3IFXA 1YJWV 5KMGA 4K8ZA 3O9OA 1L0NH 4WBNA 2AHZA 1B6QA 1MMMA 4YJ3A 2HVJC 1XMQO 2CE4A 4XDKA 3JARA 1Q7YW 4CZZA 1WP8A 3B77A 1NQTA 1AR1B 3FYIB 1H8EG 2VQFO 1H8HG 2VQEB 5IDJA 1E1RG 3CMEV 1XMOB 4LF9B 2CAZC 2F93B 3RYHA 4MVMA 2ZXWB 1SA0A 2GV9A 3K58A 4NVPA 1KUQA 2HFEC 5JWPA 2DW4A 1AI4A 4DV7B 5B1AB 3ZHSA 4PJ0Z 2ZIOA 4WFFA 3W7XA 1M57B 5IWAO 1FJGB 1LUWA 4X9QA 4DV0O 1RM1C 1KECA 3MDSA 1SESA 4J41A 3OEHG 1TVKB 3K9AA 3FB7C 1EN6A 1R73A 2XNDG 1H2KA 4DV2O 1NS1A 1VQ8V 1QHTA 2JVDA 1VQ5V 2E5LB 1SRYA 4O2BA 4J7ZA 1E1QG 1PV0A 4Z1VA 3IC7A 3UQ8A 3TCUA 2YXHA 2M6YA 2F66C 3E8BA 1N33B 3WB2A 3JAMN 1VEWA 1S76D 4NB5A 1KMIZ 4DYLA 3EFFK 4U3JA 1OCZB 2DN9A 3K9SA 5FNVB 3A2FA 3JD3A 5F2VO 2HJDA 4X20B 3JYCA 2QTOA 2RNBA 3E8GA 4JAUA 5KUMA 2C2AA 3LUTB 2FMLA 2EZOA 1D5NA 1SS3A 1HNWO 1O9HA 4MVZA 1S77D 1GH6A 3PJSK 4W4KA 3Q4HB 5LXTB 4A5UB 4IHJB 1PNLA 4OX9B 4UCTA 4IL6Z 4J10A 1FD9A 4PA3A 2HHHB 2GUZB 5DEDA 4CH3A 1BS3A 5KA5A 1N34O 3DXRB 2ZCEA 1S5LZ 3RW0A 5CA1B 1WPXA 5KHGA 1JCHA 3ZCCA 4DW0A 2NN4A 2DYRB 5LMNO 2ITDC 2Q8VA 2NNUA 4PI2A 3OR7C 3MD0A 2ILMA 1IXBA 3ZHVA 1OCOB 4O4HA 3SPCA 1L8DA 5EC1C 1Y76A 5J2TA 2EIKC 2WLIB 1P7BA 1IBLB 2AHYA 3ZHUA 2UUCO 4GKJB 4UCUA 4HZ3A 4DV6O 4NXMO 5GONA 5LP6C 2JJ1G 4MSWC 4NTYA 2UXBO 3WG7C 1JVMA 2F1MA 4P9PA 1AI7A 1ZX3A 2M7WA 4NTXA 4FLWA 1GMGA 4DV4B 4JI1B 4JYCA 2KSDA 2Q69A 5L3GA 1R6TA 5TISZ 5EC2C 3SYAA 1YVWA 2V4DA 4TSFG 4FM0A 4AI8A 4JI0B 1UFIA 4OPHA 3MAQA 3ZN1A 1PD3A 2LQTA 2BTOA 3AG1B 4ZOLB 4JZ2A 4J9ZB 2CGNA 2ZT9B 2ZXWC 3RFRA 1DGSA 1JJOA 2Q4PA 4JI4B 1TVKA 3R65A 4WFHA 1FXVA 3B4SA 4JI8O 2CDYA 3K0GA 2RQ6A 2CTQA 1M57C 4IIJB 1ZLZA 3HKDB 3IAYA 2R9RB 5H2FZ 4UCOA 5IY5C 4UCSA 1TA8A 4JTAB 3ZHQA 1MZFA 2ZD9A 4B3TB 5IYZB 3SJBC 3K59A 5LHHA 2DQ0A 2NR5A 1RPOA 4X1IB 2UU9O 5K1XA 2A7WA 2P67A 4J80A 5FNVA 5EZYB 2QWPB 3WFVA 4X20A 5D5QA 3B40A 3BA9A 4PD4F 1K4CC 3ICXA 5KAIZ 2Z0AA 3J80N 1HDJA 1OCZC 2HG5C 3KDRA 3LSUA 4YIOA 4XBFA 1Z5VA 1R6NA 3Q4HA 5LXTA 4JYAB 1MABG 3BFRA 2ZM6B 4IHJA 1PL0A 1AR5A 1QLEB 1SQPH 3JD1A 2GUZA 2UXDB 4UFZA 3SR2C 4X66B 1K34A 2X0LA 3DXRA 5CA1A 3OTOB 3AG7A 1NH2B 1JNBA 3TXSA 1LUVA 1F7YA 4O4JB 1YSCA 2AXTZ 4DUYO 4LF4B 1ZTEA 2Y69B 4CBCA 2K9PA 4JI3B 4B3MB 5D5PA 2WLIA 3TXQA 3W7WA 2XT9A 3JAWB 3C3SA 5LOVB 3U11A 1JA8A 1I08A 2QGNA 3LNMB 2QEXV 1IVSA 3JCZA 4PDMA 3C3TA 2YDEA 1XQ8A 3T1YB 2JS5A 5KX5B 1NH2D 4O2AB 3CX5F 2A0LA 4XDJA 1IDSA 4GX1A 4LFCB 4AQYO 1Z2GA 4IT5A 5LMUO 5HFLA 2OIGA 1S5JA 2GTSA 1P4RA 3HB3B 1AROP 3JATB 3UO2A 3CP1A 1FXKB 4FLYA 2FKXA 2XUMA 3QG5A 3E89A 4HNAB 4JTCB 3B09A 2IJJA 5ITZB 4YY3O 4ASUG 2GSMB 4MVSA 4LFAO 3B8MA 2KB1A 3FX7A 2UXCO 1BQZA 1SETA 4MW8A 2FYUH 2E3CA 2P6JA 1M1KW 4ZOLA 4NTWA 1BHBA 5LA6B 1GAXA 2RJZA 3E35A 3GWOA 3K06A 3OD4A 4P9OA 3QTCA 4WFEA 3STLC 1HP8A 2ZNIA 3G6BA 2IM9A 4CC6A 2FTKA 2IU0A 3ETDA 1E79G 1TUBB 2E74B 2P06A 4J7JA 4IIJA 2DYSB 5KHJA 3ABTA 3HKDA 4IYHA 1QLNA 2GTAA 4J11A 1N8RW 3ABMC 1HNZB 5LMNB 4GKKO 3JD0A 3H1HH 1W0JG 4PDRA 2Q0AA 3EVKA 4OXSA 2YC0A 4HYOA 4RUEA 4QE7A 2QSAA 5HFMA 5IYZA 1WJZA 1QCEA 3G80A 2WA3A 3RYFB 3L70H 3JD4A 2OCCB 4TOIA 4X1IA 1BL8A 5EZYA 1SQQH 1P84F 3FB5C 3M7MX 2RN9A 4K8XA 3ASOB 3RVYA 2JIZG 4BIOA 4L87A 3ZJZA 2BSKB 1Q6UA 1I94B 1K4DC 4X62O 5E79Z 4LF7B 4JI2B 4CH5A 5B1OA 3K79A 3MHSC 2XASA 3RT3C 3OT7A 3CCJV 2FL4A 3HKEB 5B1BB 4GX0A 5J2UB 1Q8IA 1NR7A 1H2GA 4DR4B 5EYPB 2WWWA 2RMKB 3NXSA 2GBOA 2Q6AA 3QO5A 4DR2O 1AJPA 1YDXA 3RVZA 4HBNA 1YEWA 5GTHZ 1JMKC 4JAAA 4IYIA 1CXZB 1KP2A 2DMXA 1DTOA 3SYQA 3UCSC 1X4TA 1QLEC 2Q5ZA 4GLXA 4O4JA 4ZKIA 3N2KB 4X1KB 3K3WA 1B06A 4YJ2B 3OUFA 3CEIA 3GB7C 5FL7G 1MNGA 5DN6G 4GUNA 1KYOF 3ZMZA 4LH7A 1YZBA 2F43G 5J9PC 3JAWA 5LOVA 4FFBB 5EBWC 3CYOA 1Y6XA 4JI6O 3RYCB 4LF8B 4LFBB 3CCQV 4E4EA 5KX5A 4QE9A 3SYPA 4O2AA 2PI4A 5BY1A 1IBMB 3CC2V 4OPAA 4EB6B 4DUZO 3VQVA 1DK1A 2PGGA 4I55B 4LF5B 4MVUA 4GCZA 1IURA 5LL6Y 4UCVA 2H94A 4DR6O 3CS5A 2NLJC 2LFRA 2AGAA 1QU7A 3SYCA 3JATA 1OCCB 4DR1O 1FXKA 4R50A 4DR7O 2YI9A 3ZS8C 4HNAA 1H2MA 2EIMC 2YEVB 5ITZA 1VQMV 3DC5A 2H3OA 3CC4V 4IGGA 1SC5B 4GX2A 1MSWD 3ASNB 2N04A 3VQXA 5LA6A 1FXKC 2BTQB 2CTPA 4NXNO 4BIZA 3ZHTA 4X88A 2ZINA 1GRJA 1XL6A 5KA6A 1SQXH 2QM8A 1H2LA 1QBZA 1HNXO 1OHHG 2P4KA 3DSQA 4JAVA 4BW5A 4ZHQB 2DOSA 1FS0G 3IC9A 1Y74B 1TUBA 3JAKB 2RDCA 1GN6A 3A0RA 4H44B 1OZ0A 4DR5B 3OEEG 3LNNA 1HR0O 1Y66A 2JS3A 5LGUA 5JCOA 5C8YB 5IJ0B 3FB6C 4B3RO 2Q67A 1FKAO 3KCXA 5IJ9B 1R3JC 1XNQO 2DYSC 2ITCC 3RYFA 2JRIA 3AG4B 3RWRD 2UUBO 3OE7G 1S5HC 1NZ6A 4JASA 5JCOC 1SQBH 2QWRB 2A9HA 2B1GA 2Y4TA 1V55B 3ZEDA 3GVMA 2YI8A 4BIUA 3T1HB 2VWKA 3AK3A 1NVPB 4X1YB 4ZI7B 3AG2C 4R7CA 1J5EO 1WB7A 4KUMA 1WPBA 3OMNB 4CH6A 3C90A 2BSKA 3E86A 1Q43A 5JJNB 2QDOA 2XAQA 1BZKA 1ZAUA 4PHZA 2HJFC 2IH3C 2Q0OC 3CE2A 1NJIW 1ENVA 1SQVH 1IBKO 1YCIA 3HKEA 4PI0A 3X2QB 5J2UA 1KQSU 5EYPA 2AW9A 4JF3A 4I9WA 3OM3B 5GW7A 1Q90D 3BRCA 2XAJA 1VQ7V 2CUGA 3BABA 1XNRB 1VF5B 3ETGA 1JOYA 1JFFB 1QNMA 4B7EA 1VQPV 3TETA 3VOUA 5B1BC 1H2SB 2ARHA 1OCRB 4B3SO 2CGOA 1AILA 1AP5A 2Q68A 3N2KA 2QR4A 4X1KA 2E75B 2P90A 3TGUH 4YJ2A 1YHQV 1THZA 3UT5B 2D3OW 3CMAV 3HKCB 1M5IA 3K57A 4FFBA 4DR3O 3OAAG 3WB1A 3KG2A 4FFKA 5BR8O 3RYCA 5LGTA 1X59A 5DECA 3RN4A 4K3AA 2P4VA 2K1EA 4EB6A 4I0XB 4UVAA 4I55A 3ABKB 4DK1A 4KHPB 1L0LH 1MOFA 1R3KC 3TK1A 2ADPA 2N05A 2PZSA 1N36B 1F4MA 3CRCA 2AZ0A 4FLZA 1U97A 1GN4A 2LJ2A 4MW3A 1QQCA 1J95A 4DV3B 1F51A 1WP7A 2X7RB 1JX9A 1WLEA 2YEVA 4JI5B 3N27A 1K92A 3G71V 1V54B 5E1AC 1NU1H 4K0KB 3B8NA 4O4LB 2H8PC 4FMTA 5B3SB 4NR1A 2FB5A 2WPDG 4JI7O 1JQ0A 3AK2A 1OCCC 1AB3A 3D3IA 2BTQA 2PF4E 2R72A 2ZE7A 1K97A 2CK3G 1UJWB 2F4VB 4X65O 4WF9V 1YTFB 2EULA 2WSSG 1QR8A 3EHBB 4YHHB 2KKWA 1BSMA 5LBQA 1N32O 2ZE6A 4BW9A 4ZHQA 1M90W 4AILC 3OUSA 1Y74A 3JAKA 1PL4A 4FM2A 3VQYA 3I55V 2EZPA 4FK5C 2PYJA 1IX9A 5B1AC 5B1NA 2UUAO 1GM8A 4X64B 2JEUA 1QVFU 1W2BU 1Q5OA 1VP7A 5C8YA 1JR9A 1VQOV 5IJ0A 3UKMA 4NKGB 5IJ9A 5BXZA 4PDVA 4N23A 4YIPA 3CXCU 3H01A 2N74A 3ZX6A 3ZMTA 5H6RA 1UPGA 3E22B 4TUYB 3OFNG 2ZE5A 1VMGA 3LSSA 1R3LC 4LF6B 4GZRB 4X89A 3RYIB 1RP3B 2EILB 4X1YA 4ZI7A 2DWEC 4LBEC 3ZIAG 1VIBA 5LGNA 1NTMH 1EM1A 1Q6IA 4DR6B 3W7UA 1YIJV 2CTRA 1XMQB 1V55C 5H6QA 3ABLB 5K1PA 1I0HA 3M99B 2VQFB 3BA8A 2EJRA 3VBBA 5IYBO 4EFEA 2VQEO 4PA9A 4LF9O 2DWDC 4QPJA 2P5OA 1I7FA 1JFFA 1VARA 2OT5A 2A79B 4DV7O 4CS4A 1VQ6V 5IWAB 2YXLA 1FFXB 3QF7A 4DV0B 1LR1A 1FJGO 3ZBHA 1K5QA 4U3FH 3L74H 1XI1A 3HKBB 1M4UA 4L8JA 3UT5A 4RQEA 3HKCA 1XHZA 1KC8W 2EINB 5KHIA 4H33A 1OCRC 2X6CA 2R70A 1H5WA 2Y4UA 4DV2B 5CMUA 2DYRC 2VWJA 3L75H 2XAFA 4I0XA 4B3RB 3T4DA 2Q7GA 3H1JH 4O4IB 1MG1A 4UCRA 1IZ3A 4TV8B 1OCOC 1MSDA 3QVNA 4FZ1A 1SERA 2E5LO 1MZEA 2ATKC 4MT8A 3LDDA 2E76B 2YS8A 4F4LA 5KHKA 3ABKC 1N33O 3K08A 2ZR2A 2GDSA 3HR0A 4O4LA 2HR3A 3W7SA 3CJHB 4DW1A 3AG3B 1QR9A 1AP6A 3BEHA 3T2MA 1HNWB 1V54C 4RO2A 3F5WC 2MW2B 3PN1A 1AJQA 2ZDIA 1S3JA 2XHBA 4DRXB 3K0DA 1Q82W 3SYOA 4OX9O 3LSQA 4QIWF 3I56V 2HHHO 3AG1C 1PP9H 1N34B 1VF6A 4DK0A 4DV5O 2ZDIC 1VF7A 3CRRA 4UB8Z 1SZTA 4DV1O 3E22A 4TUYA 3CCSV 5L3EA 2X6BA 3O65A 3JSNA 1V9PA 1VF6C 5FPRA 3H1KH 5A2QN 5B5EZ 4MTXA 1K8AW 3RYIA 2UUCB 2YIDA 1IBLO 4DV6B 4NXMB 1FPOA 4YXWG 4GKJO 2UXBB 2CTWA 1ORQC 3ZMVA 3ETQA 1GTOA 4LCUC 3F7VC 2HVKC 2LFSA 4KFMA 2WLJA 3D3QA 4HAMA 1NBMG 3CC7V 4QGPA 3CCRV 4FVMA 2ZIMA 4TQFA 3FAVB 3K5NA 2GHYA 4FLXA 2EILC 1XL4A 4DV4O 4JI1O 1F23A 3D36A 2F95B 3P3NA 1VQ4V 2DE0X 3BAAA 1XDCA 3FFQA 3P30A 1FAFA 4KL1A 4MVQA 2YSUB 1SF9A 1N0NA 4CS3A 4JI0O 1S72V 3KKYA 3OMIB 1US6A 4UV9A 3D36C 1KBHA 1BCCH 1FFXA 3LDCA 3SDLA 3THOA 3HKBA 1PKXA 2LW1A 3L73H 4I50B 3E8FA 1WB8A 3HPLC 4JV5O 4JI4O 4JI8B 1RFYA 2QM7A 3S3WA 1L1FA 2RCVA 2HP8A 3WB0A 4J42A 5EBMC 1M9NA 1BHAA 4O4IA 1FXHA 1GN2A 4TV8A 1HW7A 5KHHA 5B66Z 4JYYA 2Y69C 4MTFA 2EINC 2VS0A 5LP6B 3OMAB 4AHCA 4P2ZA 2W6IG 2LO1A 3CCVV 4BWAA 4B3TO 1ZL8B 4LWSB 1BMFG 3CD6V 2Z5UA 4CS2A 4UVBA 1HWYA 2A06H 2UU9B 2P22C 3J7AU 2BCCH 2OTLV 2AZ2A 5AG2A 4CH4A 1WAZA 1B04A 2IJKA 3SGIA 3CJHA 3L9DA 2HKOA 3BHPA 2YXYA 2QWOB 3ZRWB 4J9YB 5H9CA 4QPKA 1RSOB 1AR4A 5JJEB 4CC5A 3OTFA 1YI2V 4JYBA 2IW5A 2ZQMA 4DRXA 1KB9F 2LP7A 4JYAO 2ZM6O 3AG3C 3T4ZA 1G6UA 1XREA 2D2CB 1IJGA 2V1DA 2UXDO 1BQ0A 5IYCO 5JJJB 2YIBA 4X66O 2KG7B 3LDEA 3OTOO 3DC6A 1S0VA 2WLLB 4B08A 4FZ0A 4DUYB 1ZUQA 2PYLA 2EBOA 5L3FA 2ADQB 4C7UA 5IY5B 4LF4O 2QJ1A 3QO7A 1G4YB 3J81N 2Q7EA 4JI3O 2B5UA 4B3MO 1YF2A 2JGDB 2PUSA 4E2LA 1F4NA 3JALB 3ZMSA 5LYJB 1K33A 4PV1B 1H38A 1H2NA 2PY5A
chains in the Genus database with same CATH topology
1AVMA 3MDSA 3DC5A 1IXBA 1PL4A 1MA1A 1IDSA 1IX9A 1QNMA 3TJTA 1EN6A 1ZSPA 1BT8A 2QKAA 3OT7A 1AP5A 1JR9A 5AG2A 4YIPA 1MSDA 3QVNA 2P4KA 3AK1A 1N0JA 3IC9A 1GN6A 4FFKA 1AR4A 1KKCA 3KDRA 3LSUA 3RN4A 1VEWA 4YIOA 3BFRA 1XDCA 2GDSA 3K9SA 1B06A 1XILA 3CEIA 1AR5A 1EN5A 1EM1A 1XREA 1N0NA 1Y67A 2ADPA 1MNGA 4GUNA 1MMMA 3KKYA 1AP6A 1GN4A 5A9GA 2CE4A 1D5NA 3DC6A 1I0HA 4F6EA 4E4EA 4JZ2A 1LUVA 3AK3A 1PM9A 1ZUQA 1WB7A 3EVKA 1GN3A 1ZTEA 2ADQB 4C7UA 1WB8A 2QKCA 2CDYA 1EN4A 1VARA 3AK2A 1BS3A 2RCVA 4JZGA 3C3SA 1JA8A 1I08A 1ZLZA 1SZXA 1LUWA 1GN2A 1XUQA 4X9QA 4JYYA 1P7GA 1BSMA 3C3TA 4BR6A 2AW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVM A;  3MDS A;  3DC5 A;  1IXB A;  1PL4 A;  1MA1 A;  1IDS A;  1IX9 A;  1QNM A;  3TJT A;  1EN6 A;  1ZSP A;  1BT8 A;  2QKA A;  3OT7 A;  1AP5 A;  1JR9 A;  5AG2 A;  4YIP A;  1MSD A;  3QVN A;  2P4K A;  3AK1 A;  1N0J A;  3IC9 A;  1GN6 A;  4FFK A;  1AR4 A;  1KKC A;  3LSU A;  3RN4 A;  1VEW A;  4YIO A;  3BFR A;  1XDC A;  2GDS A;  3K9S A;  1B06 A;  1XIL A;  3CEI A;  1AR5 A;  1EN5 A;  1EM1 A;  1XRE A;  1N0N A;  1Y67 A;  2ADP A;  1MNG A;  4GUN A;  1MMM A;  3KKY A;  1AP6 A;  1GN4 A;  5A9G A;  2CE4 A;  1D5N A;  3DC6 A;  1I0H A;  4F6E A;  4E4E A;  4JZ2 A;  1LUV A;  3AK3 A;  1PM9 A;  1ZUQ A;  1WB7 A;  3EVK A;  1GN3 A;  1ZTE A;  2ADQ B;  4C7U A;  1WB8 A;  2QKC A;  2CDY A;  1EN4 A;  1VAR A;  3AK2 A;  1BS3 A;  2RCV A;  4JZG A;  3C3S A;  1JA8 A;  1I08 A;  1ZLZ A;  1SZX A;  1LUW A;  1GN2 A;  1XUQ A;  4X9Q A;  4JYY A;  1P7G A;  1BSM A;  3C3T A;  4BR6 A;  2AW9 A; 
#chains in the Genus database with same CATH topology
 5IYD O;  3T1Y O;  3CRA A;  3FAV A;  2OTJ V;  1M56 B;  3U0Z A;  4LP8 A;  1K5S A;  3JAS B;  4TWK A;  4NYK A;  4AQY B;  2OCC C;  1NTZ H;  4D7S A;  5LMU B;  3CHX A;  1ROP A;  4LFC O;  3ZRS A;  2IBZ H;  1ZSP A;  3MHH C;  1AI5 A;  1XOU A;  1OJH A;  1EZV H;  2Q73 A;  3ASO C;  5GTI Z;  4EFB A;  5L3B A;  4BAY A;  4FM1 A;  1ZWI C;  4YY3 B;  3SPI A;  4LFA B;  1FOU A;  1NKD A;  4G28 B;  4MTO A;  2UXC B;  1KU9 A;  4I4T B;  1NVP D;  3F7Y C;  2QE7 G;  3SPH A;  4G2K A;  4W4L A;  4LR3 A;  2WLK A;  3APO A;  3S3X A;  4J7K A;  4WFB V;  2Y48 A;  2OCH A;  1SKV A;  3JCU Z;  4I50 A;  1AI6 A;  1EN5 A;  3E2E A;  2YUA A;  5EIB D;  2BOB C;  4LNU B;  5CN0 A;  1WA8 B;  2ZNJ A;  4TQD A;  3RBZ A;  4DV5 B;  1EFR G;  1XHX A;  2YIA A;  5CBH A;  4GKK B;  3FB8 C;  1Z5W A;  4D7T A;  3UO3 A;  1HNZ O;  5LP6 A;  4JPR A;  4DV1 B;  1GN3 A;  4H13 B;  5L3D A;  2W0F C;  2DQ3 A;  1B3Q A;  3ZN0 A;  1XEQ A;  2G38 A;  1Q3E A;  2JGU A;  1GO3 F;  1ZL8 A;  4LWS A;  3H1L H;  1AJN A;  5L3C A;  4JZG A;  5FLX N;  5IT9 N;  2IJI A;  2XTA A;  5JH7 B;  1URF A;  5IE9 A;  1U96 A;  3OW2 U;  2EIJ B;  1XUQ A;  5CA0 B;  4RWU A;  3G6E V;  1M93 A;  4MVR A;  5DM6 V;  4RAI A;  3DGE A;  5JVD B;  3ZRW A;  1RSO A;  1OV9 A;  2JDI G;  3QNE A;  4X62 B;  1I94 O;  5KAF Z;  2MK3 A;  4Q20 A;  1W0K G;  4LF7 O;  4JI2 O;  1R6K A;  1N4C A;  1GM9 A;  2BOC C;  4FPP A;  4H37 A;  3SPG A;  2JEX A;  3E8H A;  3N2G B;  4DR4 O;  3AK1 A;  3ASN C;  3H9V A;  4DR2 B;  4ZBM A;  1Q86 W;  2KG7 A;  4N21 A;  3ML0 A;  2R9I A;  1KKC A;  2B1I A;  5JQG B;  2ZKO A;  4ICG A;  3ZRX A;  3K5M A;  2OWO A;  2WLL A;  2WLH A;  3CWB H;  2WLM A;  2CH7 B;  4EKW A;  5BMV B;  3APQ A;  4B7K A;  2XAG A;  3ABM B;  1XIL A;  4I5S A;  4JV5 B;  3BCC H;  1YTF D;  1GK9 A;  1BGY H;  3ABU A;  3CPW U;  3BPZ A;  2JGD A;  3KCY A;  2YIC A;  4QNH B;  3EXA A;  4PA7 A;  1VQL V;  3OGI B;  2X6A A;  4JI6 B;  4RQF A;  3JAL A;  5LYJ A;  3R66 A;  4K35 A;  4F6E A;  3GWK C;  1QVG U;  4LF8 O;  4LFB O;  3I5D A;  3W7T A;  3RGB A;  1NI8 A;  4I7Z B;  3OR6 C;  1YXB A;  2P7T C;  4DUZ B;  3FYE B;  1G8M A;  1IBM O;  2ETN A;  3JAS A;  3AG4 C;  4H0L B;  2QTS A;  3SJQ C;  4LF5 O;  1JPX A;  3STZ C;  1I5Y A;  2ZE8 A;  4PEL A;  3SJA C;  2DJV A;  4KP4 A;  5C93 A;  5FPO A;  3UM7 A;  5KLV H;  4FLT A;  4DR1 B;  3OGC C;  3VQW A;  4QJF B;  4DR7 B;  1T5E A;  1Y4M A;  3ZRV A;  5EK0 A;  2KQX A;  1M56 C;  3KZI Z;  1XBL A;  1EBO A;  4XDL A;  3K5O A;  1NT2 B;  1XMO O;  4I4T A;  4GYC B;  1P49 A;  4UXN A;  3E83 A;  2Z3Y A;  1FYJ A;  3IJ4 A;  1KP3 A;  1TAE A;  3X2Q C;  1Q81 W;  1EZJ A;  5EIB C;  4PA4 A;  4NXN B;  1CP9 A;  3ZHR A;  1KKD A;  3FKS G;  1CEZ A;  2HEP A;  3K5L A;  1K9M W;  1HNX B;  2QWQ B;  2QKS A;  5KUK A;  2JJ2 G;  1JJ2 U;  1PNK A;  5LHG A;  4D6T H;  3G4S V;  4LNU A;  1WA8 A;  1W59 A;  1R3I C;  1HR0 B;  4DR5 O;  2WA4 A;  5CBG A;  3AEI A;  2LGW A;  2V7Q G;  1VQ9 V;  1RPR A;  3T1C A;  5H5N A;  2XOK G;  4R6Z A;  2ZR3 A;  1I5X A;  3L72 H;  2L6L A;  4Q6G A;  5CA3 A;  3CCM V;  2PTM A;  1GM7 A;  3CXH F;  1PNM A;  3F5T A;  1XNQ B;  2UXX A;  1Y67 A;  2O57 A;  1GKF A;  2WLN A;  3QO8 A;  5CB4 B;  2VRZ A;  2UUB B;  4JTD B;  5JH7 A;  5A9G A;  2IU3 A;  3K03 A;  1KD1 W;  2L35 A;  1O9G A;  2W0X A;  3A8T A;  3CCU V;  4F6R B;  5CA0 A;  4TV9 B;  3T1H O;  3M8A A;  4OGQ B;  1J5E B;  5JVD A;  2EIM B;  5KMG B;  2QKC A;  1D2D A;  1EN4 A;  4WBN B;  1BE3 H;  2Y0P A;  2UXN A;  2IJH A;  4GX5 A;  1DLB A;  4U7O A;  4G27 B;  4YJ3 B;  2EIJ C;  1YJN V;  3JD2 A;  1IBK B;  1DF4 A;  1SZX A;  3JAR B;  3SPJ A;  1CPY A;  2LGQ A;  1P7G A;  3N2G A;  1K73 W;  5B3S C;  1AVM A;  3BVO A;  1RM1 B;  3CRM A;  5BZB A;  1XNR O;  1MA1 A;  3RYH B;  1SA0 B;  5JQG A;  2Q9L A;  2Y0I A;  4PA6 A;  4B3S B;  2IH1 C;  2CH7 A;  4FLV A;  5BMV A;  3BY6 A;  1R1B A;  2BE3 A;  3K04 A;  4DR3 B;  2WAM A;  5BR8 B;  1A32 A;  5CBF A;  3DTU B;  4FLU A;  3ETE A;  1SQG A;  4DXW A;  3L71 H;  4PDL A;  2LW7 A;  3IGA C;  4UVC A;  1FFT B;  4FJC C;  2YIB D;  2A3Q A;  4KHP O;  3AG2 B;  3G67 A;  1IXM A;  1LNQ A;  3NR7 A;  4O2B B;  1N36 O;  2F23 A;  4EEQ A;  2PI5 A;  1VQK V;  2EJ7 A;  4I9Q A;  4UB6 Z;  4DV3 O;  3JSL A;  2R9A A;  3P32 A;  4LC1 A;  1PM9 A;  2W6J G;  4JI5 O;  4U3J B;  4Z1M G;  3CCL V;  3ZMU A;  4K0K O;  4JI7 B;  3B2E E;  1K3E A;  3ABL C;  4U7N A;  3H1I H;  4WFA V;  1NTK H;  4WFG A;  1YIT V;  1K7D A;  1DF5 A;  4DO2 A;  4X65 B;  2HLD G;  2F4V O;  1WNS A;  4FIP C;  2ODM A;  4JGS A;  4P30 A;  1N32 B;  1SQF A;  4YHH O;  2QA4 V;  4BR6 A;  3A0B Z;  4WCE V;  4X8A A;  2XAH A;  4RUF A;  1Q6H A;  2B9Z A;  1TUE B;  3CCE V;  4Z2W A;  2QM4 A;  4UV8 A;  2EX3 A;  3WU2 Z;  2OYQ A;  4R8C A;  3D8C A;  2UUA B;  4ABM A;  3TJT A;  4KXR A;  4X64 O;  1BT8 A;  2QKA A;  4ZIB A;  2EIK B;  3P3P A;  1G1X B;  5LHI A;  3A0H Z;  1D5A A;  3CRQ A;  2JK5 C;  1WN7 A;  3CB2 A;  2QWN B;  3WG7 B;  5CB4 A;  1PPJ H;  3U10 A;  1N0J A;  3CSX A;  3FD9 A;  4GT1 A;  4O4H B;  1VQN V;  1NR1 A;  4LH6 A;  4MVO A;  4UUJ C;  1TGO A;  1Y76 B;  5J2T B;  5EBL C;  4F6R A;  2Q7H A;  1COW G;  3SJC C;  4LF6 O;  4MS2 A;  4TV9 A;  4TT3 G;  4MTG A;  2OIE A;  1YJ9 V;  5GON B;  3IFX A;  1YJW V;  5KMG A;  4K8Z A;  3O9O A;  1L0N H;  4WBN A;  2AHZ A;  1B6Q A;  1MMM A;  4YJ3 A;  2HVJ C;  1XMQ O;  2CE4 A;  4XDK A;  3JAR A;  1Q7Y W;  4CZZ A;  1WP8 A;  3B77 A;  1NQT A;  1AR1 B;  3FYI B;  1H8E G;  2VQF O;  1H8H G;  2VQE B;  5IDJ A;  1E1R G;  3CME V;  1XMO B;  4LF9 B;  2CAZ C;  2F93 B;  3RYH A;  4MVM A;  2ZXW B;  1SA0 A;  2GV9 A;  3K58 A;  4NVP A;  1KUQ A;  2HFE C;  5JWP A;  2DW4 A;  1AI4 A;  4DV7 B;  5B1A B;  3ZHS A;  4PJ0 Z;  2ZIO A;  4WFF A;  3W7X A;  1M57 B;  5IWA O;  1FJG B;  1LUW A;  4X9Q A;  4DV0 O;  1RM1 C;  1KEC A;  3MDS A;  1SES A;  4J41 A;  3OEH G;  1TVK B;  3K9A A;  3FB7 C;  1EN6 A;  1R73 A;  2XND G;  1H2K A;  4DV2 O;  1NS1 A;  1VQ8 V;  1QHT A;  2JVD A;  1VQ5 V;  2E5L B;  1SRY A;  4O2B A;  4J7Z A;  1E1Q G;  1PV0 A;  4Z1V A;  3IC7 A;  3UQ8 A;  3TCU A;  2YXH A;  2M6Y A;  2F66 C;  3E8B A;  1N33 B;  3WB2 A;  3JAM N;  1VEW A;  1S76 D;  4NB5 A;  1KMI Z;  4DYL A;  3EFF K;  4U3J A;  1OCZ B;  2DN9 A;  3K9S A;  5FNV B;  3A2F A;  3JD3 A;  5F2V O;  2HJD A;  4X20 B;  3JYC A;  2QTO A;  2RNB A;  3E8G A;  4JAU A;  5KUM A;  2C2A A;  3LUT B;  2FML A;  2EZO A;  1D5N A;  1SS3 A;  1HNW O;  1O9H A;  4MVZ A;  1S77 D;  1GH6 A;  3PJS K;  4W4K A;  3Q4H B;  5LXT B;  4A5U B;  4IHJ B;  1PNL A;  4OX9 B;  4UCT A;  4IL6 Z;  4J10 A;  1FD9 A;  4PA3 A;  2HHH B;  2GUZ B;  5DED A;  4CH3 A;  1BS3 A;  5KA5 A;  1N34 O;  3DXR B;  2ZCE A;  1S5L Z;  3RW0 A;  5CA1 B;  1WPX A;  5KHG A;  1JCH A;  3ZCC A;  4DW0 A;  2NN4 A;  2DYR B;  5LMN O;  2ITD C;  2Q8V A;  2NNU A;  4PI2 A;  3OR7 C;  3MD0 A;  2ILM A;  1IXB A;  3ZHV A;  1OCO B;  4O4H A;  3SPC A;  1L8D A;  5EC1 C;  1Y76 A;  5J2T A;  2EIK C;  2WLI B;  1P7B A;  1IBL B;  2AHY A;  3ZHU A;  2UUC O;  4GKJ B;  4UCU A;  4HZ3 A;  4DV6 O;  4NXM O;  5GON A;  5LP6 C;  2JJ1 G;  4MSW C;  4NTY A;  2UXB O;  3WG7 C;  1JVM A;  2F1M A;  4P9P A;  1AI7 A;  1ZX3 A;  2M7W A;  4NTX A;  4FLW A;  1GMG A;  4DV4 B;  4JI1 B;  4JYC A;  2KSD A;  2Q69 A;  5L3G A;  1R6T A;  5TIS Z;  5EC2 C;  3SYA A;  1YVW A;  2V4D A;  4TSF G;  4FM0 A;  4AI8 A;  4JI0 B;  1UFI A;  4OPH A;  3MAQ A;  3ZN1 A;  1PD3 A;  2LQT A;  2BTO A;  3AG1 B;  4ZOL B;  4JZ2 A;  4J9Z B;  2CGN A;  2ZT9 B;  2ZXW C;  3RFR A;  1DGS A;  1JJO A;  2Q4P A;  4JI4 B;  1TVK A;  3R65 A;  4WFH A;  1FXV A;  3B4S A;  4JI8 O;  2CDY A;  3K0G A;  2RQ6 A;  2CTQ A;  1M57 C;  4IIJ B;  1ZLZ A;  3HKD B;  3IAY A;  2R9R B;  5H2F Z;  4UCO A;  5IY5 C;  4UCS A;  1TA8 A;  4JTA B;  3ZHQ A;  1MZF A;  2ZD9 A;  4B3T B;  5IYZ B;  3SJB C;  3K59 A;  5LHH A;  2DQ0 A;  2NR5 A;  1RPO A;  4X1I B;  2UU9 O;  5K1X A;  2A7W A;  2P67 A;  4J80 A;  5FNV A;  5EZY B;  2QWP B;  3WFV A;  4X20 A;  5D5Q A;  3B40 A;  3BA9 A;  4PD4 F;  1K4C C;  3ICX A;  5KAI Z;  2Z0A A;  3J80 N;  1HDJ A;  1OCZ C;  2HG5 C;  3KDR A;  3LSU A;  4YIO A;  4XBF A;  1Z5V A;  1R6N A;  3Q4H A;  5LXT A;  4JYA B;  1MAB G;  3BFR A;  2ZM6 B;  4IHJ A;  1PL0 A;  1AR5 A;  1QLE B;  1SQP H;  3JD1 A;  2GUZ A;  2UXD B;  4UFZ A;  3SR2 C;  4X66 B;  1K34 A;  2X0L A;  3DXR A;  5CA1 A;  3OTO B;  3AG7 A;  1NH2 B;  1JNB A;  3TXS A;  1LUV A;  1F7Y A;  4O4J B;  1YSC A;  2AXT Z;  4DUY O;  4LF4 B;  1ZTE A;  2Y69 B;  4CBC A;  2K9P A;  4JI3 B;  4B3M B;  5D5P A;  2WLI A;  3TXQ A;  3W7W A;  2XT9 A;  3JAW B;  3C3S A;  5LOV B;  3U11 A;  1JA8 A;  1I08 A;  2QGN A;  3LNM B;  2QEX V;  1IVS A;  3JCZ A;  4PDM A;  3C3T A;  2YDE A;  1XQ8 A;  3T1Y B;  2JS5 A;  5KX5 B;  1NH2 D;  4O2A B;  3CX5 F;  2A0L A;  4XDJ A;  1IDS A;  4GX1 A;  4LFC B;  4AQY O;  1Z2G A;  4IT5 A;  5LMU O;  5HFL A;  2OIG A;  1S5J A;  2GTS A;  1P4R A;  3HB3 B;  1ARO P;  3JAT B;  3UO2 A;  3CP1 A;  1FXK B;  4FLY A;  2FKX A;  2XUM A;  3QG5 A;  3E89 A;  4HNA B;  4JTC B;  3B09 A;  2IJJ A;  5ITZ B;  4YY3 O;  4ASU G;  2GSM B;  4MVS A;  4LFA O;  3B8M A;  2KB1 A;  3FX7 A;  2UXC O;  1BQZ A;  1SET A;  4MW8 A;  2FYU H;  2E3C A;  2P6J A;  1M1K W;  4ZOL A;  4NTW A;  1BHB A;  5LA6 B;  1GAX A;  2RJZ A;  3E35 A;  3GWO A;  3K06 A;  3OD4 A;  4P9O A;  3QTC A;  4WFE A;  3STL C;  1HP8 A;  2ZNI A;  3G6B A;  2IM9 A;  4CC6 A;  2FTK A;  2IU0 A;  3ETD A;  1E79 G;  1TUB B;  2E74 B;  2P06 A;  4J7J A;  4IIJ A;  2DYS B;  5KHJ A;  3ABT A;  3HKD A;  4IYH A;  1QLN A;  2GTA A;  4J11 A;  1N8R W;  3ABM C;  1HNZ B;  5LMN B;  4GKK O;  3JD0 A;  3H1H H;  1W0J G;  4PDR A;  2Q0A A;  3EVK A;  4OXS A;  2YC0 A;  4HYO A;  4RUE A;  4QE7 A;  2QSA A;  5HFM A;  5IYZ A;  1WJZ A;  1QCE A;  3G80 A;  2WA3 A;  3RYF B;  3L70 H;  3JD4 A;  2OCC B;  4TOI A;  4X1I A;  1BL8 A;  5EZY A;  1SQQ H;  1P84 F;  3FB5 C;  3M7M X;  2RN9 A;  4K8X A;  3ASO B;  3RVY A;  2JIZ G;  4BIO A;  4L87 A;  3ZJZ A;  2BSK B;  1Q6U A;  1I94 B;  1K4D C;  4X62 O;  5E79 Z;  4LF7 B;  4JI2 B;  4CH5 A;  5B1O A;  3K79 A;  3MHS C;  2XAS A;  3RT3 C;  3OT7 A;  3CCJ V;  2FL4 A;  3HKE B;  5B1B B;  4GX0 A;  5J2U B;  1Q8I A;  1NR7 A;  1H2G A;  4DR4 B;  5EYP B;  2WWW A;  2RMK B;  3NXS A;  2GBO A;  2Q6A A;  3QO5 A;  4DR2 O;  1AJP A;  1YDX A;  3RVZ A;  4HBN A;  1YEW A;  5GTH Z;  1JMK C;  4JAA A;  4IYI A;  1CXZ B;  1KP2 A;  2DMX A;  1DTO A;  3SYQ A;  3UCS C;  1X4T A;  1QLE C;  2Q5Z A;  4GLX A;  4O4J A;  4ZKI A;  3N2K B;  4X1K B;  3K3W A;  1B06 A;  4YJ2 B;  3OUF A;  3CEI A;  3GB7 C;  5FL7 G;  1MNG A;  5DN6 G;  4GUN A;  1KYO F;  3ZMZ A;  4LH7 A;  1YZB A;  2F43 G;  5J9P C;  3JAW A;  5LOV A;  4FFB B;  5EBW C;  3CYO A;  1Y6X A;  4JI6 O;  3RYC B;  4LF8 B;  4LFB B;  3CCQ V;  4E4E A;  5KX5 A;  4QE9 A;  3SYP A;  4O2A A;  2PI4 A;  5BY1 A;  1IBM B;  3CC2 V;  4OPA A;  4EB6 B;  4DUZ O;  3VQV A;  1DK1 A;  2PGG A;  4I55 B;  4LF5 B;  4MVU A;  4GCZ A;  1IUR A;  5LL6 Y;  4UCV A;  2H94 A;  4DR6 O;  3CS5 A;  2NLJ C;  2LFR A;  2AGA A;  1QU7 A;  3SYC A;  3JAT A;  1OCC B;  4DR1 O;  1FXK A;  4R50 A;  4DR7 O;  2YI9 A;  3ZS8 C;  4HNA A;  1H2M A;  2EIM C;  2YEV B;  5ITZ A;  1VQM V;  3DC5 A;  2H3O A;  3CC4 V;  4IGG A;  1SC5 B;  4GX2 A;  1MSW D;  3ASN B;  2N04 A;  3VQX A;  5LA6 A;  1FXK C;  2BTQ B;  2CTP A;  4NXN O;  4BIZ A;  3ZHT A;  4X88 A;  2ZIN A;  1GRJ A;  1XL6 A;  5KA6 A;  1SQX H;  2QM8 A;  1H2L A;  1QBZ A;  1HNX O;  1OHH G;  2P4K A;  3DSQ A;  4JAV A;  4BW5 A;  4ZHQ B;  2DOS A;  1FS0 G;  3IC9 A;  1Y74 B;  1TUB A;  3JAK B;  2RDC A;  1GN6 A;  3A0R A;  4H44 B;  1OZ0 A;  4DR5 B;  3OEE G;  3LNN A;  1HR0 O;  1Y66 A;  2JS3 A;  5LGU A;  5JCO A;  5C8Y B;  5IJ0 B;  3FB6 C;  4B3R O;  2Q67 A;  1FKA O;  3KCX A;  5IJ9 B;  1R3J C;  1XNQ O;  2DYS C;  2ITC C;  3RYF A;  2JRI A;  3AG4 B;  3RWR D;  2UUB O;  3OE7 G;  1S5H C;  1NZ6 A;  4JAS A;  5JCO C;  1SQB H;  2QWR B;  2A9H A;  2B1G A;  2Y4T A;  1V55 B;  3ZED A;  3GVM A;  2YI8 A;  4BIU A;  3T1H B;  2VWK A;  3AK3 A;  1NVP B;  4X1Y B;  4ZI7 B;  3AG2 C;  4R7C A;  1J5E O;  1WB7 A;  4KUM A;  1WPB A;  3OMN B;  4CH6 A;  3C90 A;  2BSK A;  3E86 A;  1Q43 A;  5JJN B;  2QDO A;  2XAQ A;  1BZK A;  1ZAU A;  4PHZ A;  2HJF C;  2IH3 C;  2Q0O C;  3CE2 A;  1NJI W;  1ENV A;  1SQV H;  1IBK O;  1YCI A;  3HKE A;  4PI0 A;  3X2Q B;  5J2U A;  1KQS U;  5EYP A;  2AW9 A;  4JF3 A;  4I9W A;  3OM3 B;  5GW7 A;  1Q90 D;  3BRC A;  2XAJ A;  1VQ7 V;  2CUG A;  3BAB A;  1XNR B;  1VF5 B;  3ETG A;  1JOY A;  1JFF B;  1QNM A;  4B7E A;  1VQP V;  3TET A;  3VOU A;  5B1B C;  1H2S B;  2ARH A;  1OCR B;  4B3S O;  2CGO A;  1AIL A;  1AP5 A;  2Q68 A;  3N2K A;  2QR4 A;  4X1K A;  2E75 B;  2P90 A;  3TGU H;  4YJ2 A;  1YHQ V;  1THZ A;  3UT5 B;  2D3O W;  3CMA V;  3HKC B;  1M5I A;  3K57 A;  4FFB A;  4DR3 O;  3OAA G;  3WB1 A;  3KG2 A;  4FFK A;  5BR8 O;  3RYC A;  5LGT A;  1X59 A;  5DEC A;  3RN4 A;  4K3A A;  2P4V A;  2K1E A;  4EB6 A;  4I0X B;  4UVA A;  4I55 A;  3ABK B;  4DK1 A;  4KHP B;  1L0L H;  1MOF A;  1R3K C;  3TK1 A;  2ADP A;  2N05 A;  2PZS A;  1N36 B;  1F4M A;  3CRC A;  2AZ0 A;  4FLZ A;  1U97 A;  1GN4 A;  2LJ2 A;  4MW3 A;  1QQC A;  1J95 A;  4DV3 B;  1F51 A;  1WP7 A;  2X7R B;  1JX9 A;  1WLE A;  2YEV A;  4JI5 B;  3N27 A;  1K92 A;  3G71 V;  1V54 B;  5E1A C;  1NU1 H;  4K0K B;  3B8N A;  4O4L B;  2H8P C;  4FMT A;  5B3S B;  4NR1 A;  2FB5 A;  2WPD G;  4JI7 O;  1JQ0 A;  3AK2 A;  1OCC C;  1AB3 A;  3D3I A;  2BTQ A;  2PF4 E;  2R72 A;  2ZE7 A;  1K97 A;  2CK3 G;  1UJW B;  2F4V B;  4X65 O;  4WF9 V;  1YTF B;  2EUL A;  2WSS G;  1QR8 A;  3EHB B;  4YHH B;  2KKW A;  1BSM A;  5LBQ A;  1N32 O;  2ZE6 A;  4BW9 A;  4ZHQ A;  1M90 W;  4AIL C;  3OUS A;  1Y74 A;  3JAK A;  1PL4 A;  4FM2 A;  3VQY A;  3I55 V;  2EZP A;  4FK5 C;  2PYJ A;  1IX9 A;  5B1A C;  5B1N A;  2UUA O;  1GM8 A;  4X64 B;  2JEU A;  1QVF U;  1W2B U;  1Q5O A;  1VP7 A;  5C8Y A;  1JR9 A;  1VQO V;  5IJ0 A;  3UKM A;  4NKG B;  5IJ9 A;  5BXZ A;  4PDV A;  4N23 A;  4YIP A;  3CXC U;  3H01 A;  2N74 A;  3ZX6 A;  3ZMT A;  5H6R A;  1UPG A;  3E22 B;  4TUY B;  3OFN G;  2ZE5 A;  1VMG A;  3LSS A;  1R3L C;  4LF6 B;  4GZR B;  4X89 A;  3RYI B;  1RP3 B;  2EIL B;  4X1Y A;  4ZI7 A;  2DWE C;  4LBE C;  3ZIA G;  1VIB A;  5LGN A;  1NTM H;  1EM1 A;  1Q6I A;  4DR6 B;  3W7U A;  1YIJ V;  2CTR A;  1XMQ B;  1V55 C;  5H6Q A;  3ABL B;  5K1P A;  1I0H A;  3M99 B;  2VQF B;  3BA8 A;  2EJR A;  3VBB A;  5IYB O;  4EFE A;  2VQE O;  4PA9 A;  4LF9 O;  2DWD C;  4QPJ A;  2P5O A;  1I7F A;  1JFF A;  1VAR A;  2OT5 A;  2A79 B;  4DV7 O;  4CS4 A;  1VQ6 V;  5IWA B;  2YXL A;  1FFX B;  3QF7 A;  4DV0 B;  1LR1 A;  1FJG O;  3ZBH A;  1K5Q A;  4U3F H;  3L74 H;  1XI1 A;  3HKB B;  1M4U A;  4L8J A;  3UT5 A;  4RQE A;  3HKC A;  1XHZ A;  1KC8 W;  2EIN B;  5KHI A;  4H33 A;  1OCR C;  2X6C A;  2R70 A;  1H5W A;  2Y4U A;  4DV2 B;  5CMU A;  2DYR C;  2VWJ A;  3L75 H;  2XAF A;  4I0X A;  4B3R B;  3T4D A;  2Q7G A;  3H1J H;  4O4I B;  1MG1 A;  4UCR A;  1IZ3 A;  4TV8 B;  1OCO C;  1MSD A;  3QVN A;  4FZ1 A;  1SER A;  2E5L O;  1MZE A;  2ATK C;  4MT8 A;  3LDD A;  2E76 B;  2YS8 A;  4F4L A;  5KHK A;  3ABK C;  1N33 O;  3K08 A;  2ZR2 A;  2GDS A;  3HR0 A;  4O4L A;  2HR3 A;  3W7S A;  3CJH B;  4DW1 A;  3AG3 B;  1QR9 A;  1AP6 A;  3BEH A;  3T2M A;  1HNW B;  1V54 C;  4RO2 A;  3F5W C;  2MW2 B;  3PN1 A;  1AJQ A;  2ZDI A;  1S3J A;  2XHB A;  4DRX B;  3K0D A;  1Q82 W;  3SYO A;  4OX9 O;  3LSQ A;  4QIW F;  3I56 V;  2HHH O;  3AG1 C;  1PP9 H;  1N34 B;  1VF6 A;  4DK0 A;  4DV5 O;  2ZDI C;  1VF7 A;  3CRR A;  4UB8 Z;  1SZT A;  4DV1 O;  3E22 A;  4TUY A;  3CCS V;  5L3E A;  2X6B A;  3O65 A;  3JSN A;  1V9P A;  1VF6 C;  5FPR A;  3H1K H;  5A2Q N;  5B5E Z;  4MTX A;  1K8A W;  3RYI A;  2UUC B;  2YID A;  1IBL O;  4DV6 B;  4NXM B;  1FPO A;  4YXW G;  4GKJ O;  2UXB B;  2CTW A;  1ORQ C;  3ZMV A;  3ETQ A;  1GTO A;  4LCU C;  3F7V C;  2HVK C;  2LFS A;  4KFM A;  2WLJ A;  3D3Q A;  4HAM A;  1NBM G;  3CC7 V;  4QGP A;  3CCR V;  4FVM A;  2ZIM A;  4TQF A;  3FAV B;  3K5N A;  2GHY A;  4FLX A;  2EIL C;  1XL4 A;  4DV4 O;  4JI1 O;  1F23 A;  3D36 A;  2F95 B;  3P3N A;  1VQ4 V;  2DE0 X;  3BAA A;  1XDC A;  3FFQ A;  3P30 A;  1FAF A;  4KL1 A;  4MVQ A;  2YSU B;  1SF9 A;  1N0N A;  4CS3 A;  4JI0 O;  1S72 V;  3KKY A;  3OMI B;  1US6 A;  4UV9 A;  3D36 C;  1KBH A;  1BCC H;  1FFX A;  3LDC A;  3SDL A;  3THO A;  3HKB A;  1PKX A;  2LW1 A;  3L73 H;  4I50 B;  3E8F A;  1WB8 A;  3HPL C;  4JV5 O;  4JI4 O;  4JI8 B;  1RFY A;  2QM7 A;  3S3W A;  1L1F A;  2RCV A;  2HP8 A;  3WB0 A;  4J42 A;  5EBM C;  1M9N A;  1BHA A;  4O4I A;  1FXH A;  1GN2 A;  4TV8 A;  1HW7 A;  5KHH A;  5B66 Z;  4JYY A;  2Y69 C;  4MTF A;  2EIN C;  2VS0 A;  5LP6 B;  3OMA B;  4AHC A;  4P2Z A;  2W6I G;  2LO1 A;  3CCV V;  4BWA A;  4B3T O;  1ZL8 B;  4LWS B;  1BMF G;  3CD6 V;  2Z5U A;  4CS2 A;  4UVB A;  1HWY A;  2A06 H;  2UU9 B;  2P22 C;  3J7A U;  2BCC H;  2OTL V;  2AZ2 A;  5AG2 A;  4CH4 A;  1WAZ A;  1B04 A;  2IJK A;  3SGI A;  3CJH A;  3L9D A;  2HKO A;  3BHP A;  2YXY A;  2QWO B;  3ZRW B;  4J9Y B;  5H9C A;  4QPK A;  1RSO B;  1AR4 A;  5JJE B;  4CC5 A;  3OTF A;  1YI2 V;  4JYB A;  2IW5 A;  2ZQM A;  4DRX A;  1KB9 F;  2LP7 A;  4JYA O;  2ZM6 O;  3AG3 C;  3T4Z A;  1G6U A;  1XRE A;  2D2C B;  1IJG A;  2V1D A;  2UXD O;  1BQ0 A;  5IYC O;  5JJJ B;  2YIB A;  4X66 O;  2KG7 B;  3LDE A;  3OTO O;  3DC6 A;  1S0V A;  2WLL B;  4B08 A;  4FZ0 A;  4DUY B;  1ZUQ A;  2PYL A;  2EBO A;  5L3F A;  2ADQ B;  4C7U A;  5IY5 B;  4LF4 O;  2QJ1 A;  3QO7 A;  1G4Y B;  3J81 N;  2Q7E A;  4JI3 O;  2B5U A;  4B3M O;  1YF2 A;  2JGD B;  2PUS A;  4E2L A;  1F4N A;  3JAL B;  3ZMS A;  5LYJ B;  1K33 A;  4PV1 B;  1H38 A;  1H2N A;  2PY5 A; 
#chains in the Genus database with same CATH homology
 1AVM A;  3MDS A;  3DC5 A;  1IXB A;  1PL4 A;  1MA1 A;  1IDS A;  1IX9 A;  1QNM A;  3TJT A;  1EN6 A;  1ZSP A;  1BT8 A;  2QKA A;  3OT7 A;  1AP5 A;  1JR9 A;  5AG2 A;  4YIP A;  1MSD A;  3QVN A;  2P4K A;  3AK1 A;  1N0J A;  3IC9 A;  1GN6 A;  4FFK A;  1AR4 A;  1KKC A;  3KDR A;  3LSU A;  3RN4 A;  1VEW A;  4YIO A;  3BFR A;  1XDC A;  2GDS A;  3K9S A;  1B06 A;  1XIL A;  3CEI A;  1AR5 A;  1EN5 A;  1EM1 A;  1XRE A;  1N0N A;  1Y67 A;  2ADP A;  1MNG A;  4GUN A;  1MMM A;  3KKY A;  1AP6 A;  1GN4 A;  5A9G A;  2CE4 A;  1D5N A;  3DC6 A;  1I0H A;  4F6E A;  4E4E A;  4JZ2 A;  1LUV A;  3AK3 A;  1PM9 A;  1ZUQ A;  1WB7 A;  3EVK A;  1GN3 A;  1ZTE A;  2ADQ B;  4C7U A;  1WB8 A;  2QKC A;  2CDY A;  1EN4 A;  1VAR A;  3AK2 A;  1BS3 A;  2RCV A;  4JZG A;  3C3S A;  1JA8 A;  1I08 A;  1ZLZ A;  1SZX A;  1LUW A;  1GN2 A;  1XUQ A;  4X9Q A;  4JYY A;  1P7G A;  1BSM A;  3C3T A;  4BR6 A;  2AW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...