1ZUQA

Contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAVVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
publication title Contribution of human manganese superoxide dismutase tyrosine 34 to structure and catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zuqA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zuqA02
1D5NA 1VEWA 1MNGA 1ZLZA 3C3TA 1MMMA 1QNMA 2CE4A 3TJTA 3DC5A 1AR4A 4GUNA 1LUWA 1IDSA 3IC9A 1PL4A 4C7UA 1B06A 1BSMA 1JA8A 1AP5A 1GN4A 3RN4A 2RCVA 1AR5A 3KKYA 1ZTEA 1Y67A 1XUQA 1XREA 1I08A 2CDYA 3EVKA 2QKAA 1P7GA 1XDCA 4FFKA 4YIOA 2AW9A 1GN2A 4BR6A 1N0NA 3LSUA 1BT8A 1WB8A 1SZXA 1JR9A 3QVNA 2GDSA 1EN5A 1MSDA 1ZSPA 1VARA 1N0JA 2P4KA 4JZ2A 1KKCA 1AP6A 3K9SA 5A9GA 1EN6A 3OT7A 4E4EA 2ADQB 1ZUQA 1MA1A 5AG2A 3DC6A 1IX9A 3AK2A 3CEIA 1GN3A 2QKCA 4JYYA 3MDSA 4JZGA 3BFRA 1BS3A 1AVMA 1XILA 2ADPA 1LUVA 1I0HA 1EN4A 3AK1A 1IXBA 1EM1A 3AK3A 4YIPA 1GN6A 3C3SA 4F6EA 1PM9A 4X9QA 1WB7A
chains in the Genus database with same CATH superfamily
3CP1A 4MTOA 3JARA 5H5NA 4DV2B 3OUSA 3OMNB 5D5QA 2Y48A 1FXKB 3C90A 2XAGA 5GONB 1M57B 4GKKO 4C7UA 1B06A 1QR9A 2EIKB 1DK1A 4UCRA 1AP5A 1OCCC 1Q5OA 5KX5B 1RPOA 3RYCB 1AI5A 3BA8A 5LGTA 4IYHA 1D5AA 4DV0B 3EHBB 4H44B 4WBNB 4GX1A 1I08A 4HBNA 2CDYA 1UPGA 1N8RW 2GV9A 1P7GA 2B1GA 2WPDG 1MSWD 2P4VA 2CTQA 2Q7GA 2B5UA 5D5PA 3BRCA 5IY5C 3ZEDA 1F4NA 4TSFG 3LSUA 2VQFO 5A2QN 2GUZA 4CH6A 2LFRA 4MTXA 1CP9A 2LGWA 1Q86W 4X1YA 2DWEC 2WLJA 2UUAO 2E76B 3OFNG 4MTFA 2X7RB 4LC1A 2EJ7A 3SYCA 2BOCC 4PA6A 2D3OW 2PTMA 2ADQB 2XT9A 2YC0A 5AG2A 2BTOA 1SF9A 4KXRA 4BAYA 5LA6B 3JALB 5EYPB 2IH1C 4L8JA 3VBBA 1MOFA 4DRXA 4PA3A 2ZXWB 1PD3A 1HW7A 2JK5C 1LUVA 4DV5O 3JAWA 4RUEA 3T1CA 4NXMB 4O4HB 1JJOA 4MVQA 3GVMA 2LJ2A 2VWKA 3G67A 2CTPA 3RYIB 5LGUA 4I7ZB 4JYBA 1VEWA 4J11A 1K4DC 4J10A 3N27A 2E5LO 4ZOLA 3JAKB 2Y69C 3ASOC 2YS8A 5CBFA 5LGNA 1E1RG 5CBGA 1S72V 3OE7G 3I55V 3HKDB 1AR5A 1WP7A 1IZ3A 2CH7A 3JAMN 3ZHQA 4DV3B 2F93B 2HR3A 3RBZA 3FX7A 5EC2C 3S3WA 3OR6C 1KU9A 2A06H 1NVPD 2OWOA 4YJ2B 4DR7B 2UXDO 5EIBC 5LMUO 4L87A 1CPYA 4MW3A 1H8HG 3CPWU 5IYZB 3UO3A 2LW1A 3Q4HB 1XMOB 2ZM6B 3CCSV 3IC7A 1VQMV 2X6BA 1Q3EA 2Q6AA 4QE9A 3CMAV 2YEVA 3K9SA 1BCCH 3R66A 2N74A 4PA9A 2CGOA 5KHGA 4JAAA 5B1NA 3DC6A 3TK1A 5ITZB 1Y74B 3L71H 1OCRB 1SZTA 3CS5A 2OIGA 3A0HZ 4Z2WA 2HJDA 4I0XA 3CD6V 2XAJA 3H9VA 4JI5O 2DN9A 2G38A 1H2SB 4YJ3A 1V55C 2Z0AA 5LL6Y 4JI6B 3ZHVA 4AQYO 3NR7A 3ETEA 4CC5A 1KP3A 3AK3A 1SESA 2CGNA 2WLNA 3ZN0A 3CC4V 4QJFB 4XBFA 4X65B 3K5OA 4NR1A 2K9PA 2NLJC 3OD4A 4JTDB 1D5NA 1PV0A 5B5EZ 3JSLA 1FXVA 4FPPA 3DXRB 4JAVA 4YXWG 4I55B 1PP9H 3L70H 3OTFA 1VQNV 5JJEB 4LF9B 3T4DA 1JJ2U 3ABMB 1VQ6V 4P30A 3B40A 1Z5WA 1FS0G 1Q6IA 4JASA 4JV5B 2Q4PA 4BIZA 5FLXN 2IU0A 2DJVA 4K0KO 2RNBA 3F5WC 1P7BA 4JYAO 3P3NA 1BT8A 3SPJA 1HNXB 2F66C 2QR4A 2GDSA 2P7TC 1VQ8V 2JGUA 3WB1A 2WLLA 4I9WA 5JVDA 2PUSA 4PA4A 4WFEA 2Q0OC 4DV2O 1HNWB 1KMIZ 3QO8A 5E79Z 1OCZB 3JYCA 1VMGA 3O9OA 4NYKA 4TQFA 3OAAG 4DV4B 1KECA 4P9OA 3APOA 4IYIA 4K3AA 1YHQV 2VWJA 1Y6XA 4EFBA 2ARHA 3BCCH 4WFFA 5LP6C 2BCCH 4WCEV 2GSMB 2QWPB 3RYFA 5C8YB 1VQ5V 5CMUA 1NU1H 3CHXA 4K35A 4UCVA 1NH2B 2EIJC 3FB8C 1QBZA 2ZR3A 3FYIB 4EB6B 2ZIOA 3B09A 4O2AB 5H2FZ 1K7DA 4TV9A 3H01A 1JQ0A 3IC9A 2M6YA 5LHGA 3QG5A 3JD2A 3K59A 2OCCC 3RT3C 2DYRB 1M93A 2EIMB 3J81N 4B3MB 3A2FA 1KYOF 4RQFA 3OM3B 4YIOA 4DR3B 3LSQA 2LFSA 1BMFG 1RSOA 1NH2D 4NXMO 1ZL8B 3E8BA 2IH3C 4ICGA 4LF7B 4FLYA 3RW0A 4FLVA 3KDRA 2ZIMA 3ZHRA 3LNNA 3UT5B 4X1IA 5J2TB 4I50A 4AILC 1MABG 1KKCA 3RYHA 4B7KA 2QTOA 4EFEA 4ZKIA 2NR5A 1GAXA 1G1XB 1ZAUA 1VQ4V 1SQFA 4UCTA 4DR4B 2YXHA 3K79A 4DV3O 5B1AB 3CRQA 3MDSA 4EKWA 5IYBO 2JGDB 3BFRA 1YTFB 1ORQC 1QLEC 1S76D 4NXNB 2MW2B 1N36B 3CJHB 3ZRSA 2OYQA 1QVFU 2EILC 4HAMA 4UV9A 3C3SA 4O4JA 3JD4A 2EINB 5TISZ 4AHCA 4GX0A 4FLUA 1WB7A 3CXCU 2H3OA 1QVGU 2ZM6O 1O9GA 3K0DA 3B8NA 3RFRA 4R50A 3CMEV 1U97A 1YXBA 4FLZA 2P6JA 2BSKA 1AR1B 2Q5ZA 4FM1A 2HG5C 2HJFC 3L9DA 4B7EA 4RAIA 5BY1A 3CSXA 2Q7EA 4H13B 5IJ0B 1FKAO 1E1QG 1BHBA 1I5XA 4CS4A 3G80A 4TUYB 5LXTA 3I56V 2ZNIA 5HFMA 2RMKB 3N2GB 5FL7G 5BXZA 1XNRO 2GHYA 2F1MA 4FFBB 2A9HA 1QCEA 3AG2B 4I9QA 1NR7A 1JPXA 3L74H 2QWRB 3K5LA 4E2LA 4BW9A 2GTSA 3B77A 4JI6O 5CB4B 1S3JA 4R6ZA 4K8ZA 2Q8VA 5FPRA 3QVNA 1NJIW 3CX5F 2ZNJA 4ZI7B 2PI5A 4X65O 2QM4A 2BTQA 2R72A 2HKOA 3A0RA 3ABKC 3OT7A 3HKEB 2YDEA 1K8AW 2P06A 2R9RB 4NVPA 1VQ9V 4JGSA 2JS5A 3AK2A 3APQA 4PD4F 4YY3B 4GT1A 2R9AA 3LDCA 4GLXA 4LF9O 4IL6Z 3KCXA 1BZKA 4RQEA 4X62B 2EX3A 4IIJB 1R6NA 1KQSU 5KUKA 1W0KG 4JV5O 4DK0A 1R6KA 2VRZA 4LF4B 2FYUH 3ZMTA 5KLVH 5J9PC 4BIOA 1YDXA 3HB3B 2X6AA 3UCSC 4QPKA 4ABMA 5EZYB 1HNXO 1GTOA 4U7NA 2KG7A 4FZ1A 1F4MA 5B1BC 3OMIB 5CA1A 4RUFA 3ZX6A 1ZLZA 2QSAA 2V7QG 4DO2A 4G2KA 3A0BZ 4X64B 3ZMSA 2CE4A 2WLIA 1S0VA 2RDCA 1HNWO 5BMVB 1JA8A 3CXHF 5GTIZ 2DQ3A 1YF2A 4F6RA 1WNSA 1OCCB 4JI4B 4DV4O 4BIUA 3HKBA 1JMKC 1FJGO 5J2UA 2UXCO 3E22A 1PPJH 1O9HA 4NB5A 1YJWV 4TV8B 3X2QC 1YJNV 4DV7B 4B3TB 1TAEA 5KMGA 1W2BU 1ZX3A 1M9NA 5DECA 4BR6A 4O2BA 4I5SA 1N4CA 1N0NA 1GM9A 4X88A 4J7ZA 1WB8A 4U3FH 4OPHA 3UQ8A 3ETGA 4R7CA 1PKXA 2DYSC 4UUJC 5K1XA 2ZDIC 2HHHO 1GM7A 2EBOA 3KCYA 1HP8A 1Y76A 3HKCB 1EZJA 2FL4A 5A9GA 1FPOA 1XMQB 4HZ3A 4D7TA 2X0LA 1VQLV 4DYLA 3N2KB 4LFAB 3OGCC 1NTKH 4D6TH 5GW7A 2UUCB 4FVMA 2DW4A 1TUEB 3SDLA 4R8CA 4OXSA 1FXKC 3JCUZ 4B3MO 2EIKC 4PDRA 1K9MW 4J80A 1SA0B 2ITDC 5LOVB 5JH7B 4DR3O 4BW5A 3FKSG 5KHHA 1Q81W 1AI4A 1BHAA 1GKFA 3CCVV 4LF7O 5EK0A 3RVZA 3ML0A 3G6EV 4IHJB 1JOYA 3ZRXA 1AJNA 5JQGA 3ZN1A 2R9IA 5LHIA 5CA0A 2YUAA 4FZ0A 2Q68A 1Q8IA 1OZ0A 1IDSA 3QO5A 5L3DA 1J5EB 1DF4A 4KFMA 1NVPB 4NTWA 4I4TB 4Z1VA 1OHHG 5C93A 1N34B 4DR4O 5EC1C 5KHKA 1TGOA 1AJQA 2PGGA 5LBQA 1V9PA 1MZFA 3BHPA 3FAVA 1XOUA 4K8XA 4JAUA 4NXNO 1N36O 2IBZH 3G6BA 3I5DA 1EBOA 4JI1B 1KC8W 4TOIA 1RP3B 1VQOV 1SKVA 1XHXA 2F43G 2ZDIA 3OR7C 1B04A 5IJ9B 5KUMA 2QWOB 1R3LC 1CXZB 1QLNA 1KD1W 4E4EA 3ZS8C 5GTHZ 4LF6B 3E89A 3ZBHA 1XEQA 5EBWC 5F2VO 2PYLA 4MSWC 4HNAB 3QNEA 4ASUG 1XI1A 4RWUA 1FXKA 1V54B 5GONA 4X89A 1QR8A 4JZGA 3CCUV 5CN0A 2YIDA 3JD1A 5EIBD 5KX5A 3JCZA 3RYCA 4W4KA 3J7AU 4P2ZA 4LBEC 5CA3A 1S5JA 1G6UA 3JASB 4MVRA 4WBNA 4LNUB 1RM1B 3JATB 1FFXB 4LWSB 1EFRG 2YIAA 4GX5A 1XNRB 3A8TA 2ZKOA 2JEXA 1EZVH 3IFXA 1LR1A 2ZE5A 1AR4A 1BQZA 4DK1A 2ZQMA 4MVMA 1GRJA 2K1EA 4TT3G 3CRMA 3CCLV 1QHTA 5H6RA 4YY3O 2Y0IA 3OGIB 2L6LA 1ZTEA 2Z3YA 3W7TA 4X1KB 3AG4B 2M7WA 4X62O 4LCUC 5LOVA 1XL6A 4G28B 2LGQA 2Q9LA 3E8HA 4G27B 1J95A 3D8CA 4LF4O 1OCRC 1Q7YW 3H1IH 5LA6A 3OEHG 3JALA 1AROP 4J9YB 5EYPA 1PL0A 4OGQB 3UM7A 4ZHQB 2KKWA 3TXQA 2ODMA 2QM7A 2Y0PA 4MW8A 4X66B 2LQTA 1AI7A 2CTRA 4O4HA 3VQXA 3SR2C 2FKXA 4X64O 5KHJA 3S3XA 5BZBA 3THOA 2Q69A 4GZRB 3GB7C 4XDLA 3RYIA 5B3SB 1IBLB 4JI4O 3ZRWB 3EXAA 4B3SB 4DR1B 3W7UA 2OCHA 4LF5O 4H37A 5LP6B 3JAKA 2JS3A 2O57A 5L3EA 3K03A 3HR0A 3AG3B 4X20B 3ZMZA 4DV7O 3K3WA 4B3TO 4PDLA 2CTWA 3HKDA 1NBMG 1K33A 1TVKB 1K73W 1EM1A 4JI3B 2FMLA 1WA8B 3ABMC 1FJGB 2UXCB 3VQVA 3SJQC 4YJ2A 2ZE6A 3ZMUA 5K1PA 1GM8A 1QNMA 3DC5A 5IYZA 1VF5B 1PL4A 1BSMA 3Q4HA 2ZINA 1XMQO 1IJGA 3RN4A 4LFBB 4LFAO 1H2NA 3FB6C 4QIWF 4FLXA 4DUZB 2UUCO 4FLTA 3L72H 2UXBB 1AJPA 4H33A 1Y67A 1YZBA 2HHHB 3IGAC 1M4UA 4PA7A 2Q0AA 3CRCA 1OCZC 3UKMA 4B08A 5ITZA 1Y74A 2F95B 1N33B 3CCJV 2P22C 4NTYA 1SZXA 4MVZA 3T1YB 3T4ZA 1ZSPA 3U11A 2OTLV 1IXMA 1Y66A 2CK3G 4CZZA 5LYJB 2CUGA 2F4VB 1MZEA 4PDMA 1Y4MA 4EEQA 4ZIBA 3UO2A 3M99B 1J5EO 2ZD9A 5JJNB 4PHZA 1FD9A 3CB2A 3SYAA 1COWG 3ABLB 4CS2A 4JTCB 1N34O 2HVJC 3BABA 3DXRA 1ZWIC 2H8PC 4KHPB 4I55A 3B2EE 1RPRA 3WB2A 4LR3A 3B4SA 1IXBA 1F23A 2DWDC 3JSNA 2DYRC 2EIMC 2ZE8A 2RN9A 5FNVB 4JI1O 3CCEV 1G4YB 3ZMVA 1WN7A 2WSSG 3DSQA 1KBHA 1NI8A 5EBMC 2MK3A 5KHIA 3DTUB 4UCSA 1JFFB 2ATKC 3MAQA 4QPJA 4TWKA 3KZIZ 3FB5C 1YI2V 4LF6O 1GN4A 2IJKA 3W7XA 3GWKC 2Q7HA 4DR5B 2JVDA 4O4LB 5DM6V 1PNMA 3F5TA 4DXWA 3TGUH 2QJ1A 4PI2A 3ZJZA 4CH4A 4O4IB 4DR2B 3E2EA 1TUBB 2A3QA 3AG1B 4A5UB 3M7MX 2WLMA 3BPZA 2EZOA 3JARB 1S5LZ 5L3FA 5B1OA 1AB3A 4J9ZB 1M56B 1M5IA 4U7OA 5B1AC 2XHBA 1GK9A 2CAZC 3E8FA 1SETA 3FB7C 3STZC 5C8YA 5IWAO 2P4KA 1RFYA 2UU9B 4FIPC 4WF9V 3T2MA 1ENVA 3SJCC 3SPHA 1SQPH 4NTXA 1UJWB 2QEXV 2QM8A 2EINC 1IX9A 4EB6A 1KB9F 3CEIA 1U96A 4O2AA 1WLEA 3ASNC 3P3PA 4UFZA 2GUZB 2N04A 4JYYA 2NN4A 3WU2Z 2WA3A 1SQGA 3U0ZA 2IJHA 3T1HB 2AXTZ 1AILA 2P67A 4CC6A 4X1YB 5IE9A 1IVSA 2XAFA 2R70A 1UFIA 1GN6A 3WG7C 3JD3A 2XAHA 1YCIA 2OTJV 2WLHA 1US6A 5B1BB 1L1FA 3H1JH 3FD9A 4X66O 1ZL8A 2BOBC 2GTAA 1YJ9V 2HVKC 1LUWA 4DRXB 1YITV 1AI6A 2AHYA 3W7WA 1NZ6A 3E83A 4LF8B 4FM2A 1VQKV 4GYCB 1I94B 5HFLA 3JAWB 1Q82W 5JWPA 2XASA 3UT5A 2KQXA 5J2TA 2YIBA 1IBLO 5BR8B 5H6QA 4B3SO 3E35A 4DR1O 1OCOC 2W0FC 2IJJA 1S77D 2QKAA 3G4SV 3CCMV 1XDCA 1GH6A 2ZT9B 1SQXH 1FOUA 3RVYA 1SQBH 1VQPV 2Y4UA 4ZOLB 2Q67A 3QTCA 5L3BA 4JYCA 1H2KA 5LMNB 4JI3O 2JRIA 2JGDA 2AZ0A 1QQCA 4LF5B 4JI8B 2CH7B 4DV1B 1WPBA 4CH5A 1PNKA 2V1DA 1Q90D 3CJHA 3E86A 1H2GA 2DOSA 1AP6A 4MVOA 4YHHB 1OJHA 1EN6A 3BAAA 3CYOA 2UXXA 2ITCC 1MA1A 1FAFA 1SQQH 2W0XA 2EJRA 3CC2V 4PJ0Z 5IY5B 4LFBO 5CBHA 5JCOA 4J7JA 4UCOA 1XQ8A 4DUZO 2XTAA 4J42A 1VF7A 2UXBO 4MT8A 2RQ6A 2KSDA 1H38A 4MVSA 3IJ4A 2AZ2A 2ADPA 4UB6Z 5IJ0A 2QWQB 3MHSC 3SPGA 1R73A 1JNBA 4U3JB 1I0HA 1EN4A 2X6CA 3H1LH 4LH6A 4TUYA 4RO2A 3N2GA 3AK1A 3BA9A 4YIPA 2YEVB 1N33O 5IYCO 1H2LA 1H5WA 4MS2A 4FFBA 2LW7A 4X8AA 4D7SA 1PM9A 1M90W 3FFQA 5FPOA 3T1YO 4LP8A 5H9CA 1F51A 1IBMB 1W59A 1M57C 2LP7A 4I0XB 3P32A 5CB4A 1P4RA 2EULA 4WFHA 2F4VO 3B8MA 1CEZA 4YJ3B 1HNZB 2OT5A 5IDJA 1NTZH 1THZA 3SPIA 4ZI7A 3WB0A 3IAYA 1FYJA 5IT9N 4UVBA 5IYDO 2E75B 1KUQA 1S5HC 1XREA 1XNQB 2XOKG 5KAFZ 3HKEA 4FM0A 4KHPO 2QA4V 1YEWA 2AW9A 3OTOB 4XDJA 2AGAA 2Y69B 3ASOB 4IT5A 1NTMH 3BVOA 1N32B 1JR9A 4IIJA 3QF7A 1EN5A 3D3IA 1L0NH 4NKGB 4W4LA 2B1IA 1R3KC 1X4TA 4DV6B 2FTKA 4FJCC 4H0LB 1XBLA 1H2MA 5EZYA 1JCHA 2P90A 2YI8A 4DR5O 3F7YC 1W0JG 2WAMA 3KG2A 1YVWA 2ZXWC 3K5MA 3PJSK 1BS3A 2WLLB 5JVDB 5BMVA 3K5NA 4DR2O 2JDIG 5DN6G 3WFVA 3ZRVA 1SS3A 2AHZA 3W7SA 4QNHB 3LNMB 3SYPA 4TV8A 4DW1A 2YXLA 1K5QA 2XAQA 5L3CA 2VQEB 4P9PA 4N21A 2WWWA 4F4LA 3K04A 3TJTA 2UU9O 4GUNA 1KKDA 4QGPA 2QKSA 1V55B 3ABUA 1B3QA 3RYFB 1XHZA 4UB8Z 3FYEB 3LDDA 2H94A 3HKCA 3ZHTA 1G8MA 1K3EA 4U3JA 3EVKA 5IWAB 4TQDA 2W6JG 4LH7A 3T1HO 1LNQA 4KUMA 1HR0B 4BWAA 4PELA 4JI0O 3N2KA 2DE0X 4TV9B 2UXNA 1X59A 4Q6GA 2ZE7A 5E1AC 2W6IG 3SYQA 4OPAA 1NS1A 1V54C 3MD0A 4FK5C 2QDOA 1IBKB 3BEHA 1MG1A 1SA0A 3CWBH 3D3QA 1GMGA 3H1HH 5JH7A 1I7FA 1FXHA 2YXYA 2D2CB 3ZHUA 4XDKA 2ETNA 4KL1A 1RM1C 1ZUQA 4LF8O 3K58A 3K06A 3SYOA 4IHJA 1RSOB 4JF3A 1I94O 1VF6C 3CRAA 5BR8O 1QU7A 2JJ1G 1A32A 4UCUA 1Z2GA 3F7VC 3SPCA 1XILA 2LO1A 4X1IB 3RGBA 4QE7A 4I50B 4I4TA 3K9AA 3SJAC 4DR6B 2HP8A 3RYHB 3ABTA 3OEEG 5LMNO 4JI2B 2UUBB 3AG4C 4JI7B 1E79G 4MTGA 4GX2A 4JI8O 3STLC 5EBLC 4DV1O 1URFA 3ETDA 4GKJB 3K57A 2JJ2G 1WPXA 2XNDG 3D36C 1Q43A 4LFCB 3DGEA 4Q20A 4YHHO 3SGIA 4DUYB 4MVUA 1NQTA 4B3RB 2RCVA 3L73H 4IGGA 5B66Z 4OX9B 5IJ9A 4UXNA 4FLWA 2A0LA 5JJJB 2EIJB 4JPRA 3ZCCA 1K97A 4O4JB 3M8AA 3E8GA 2B9ZA 3LUTB 1VIBA 4FFKA 1GN2A 5B3SC 3H1KH 1WJZA 2BSKB 4J41A 4HNAA 2PZSA 2E74B 4DV0O 2DQ0A 4WFAV 2OCCB 2PI4A 5LXTB 3AG3C 1DF5A 1YSCA 1FFTB 4JZ2A 3EFFK 1IBMO 4GKKB 3JASA 1VP7A 3PN1A 4LNUA 3JATA 1FFXA 4LWSA 4PV1B 1H8EG 2GBOA 2FB5A 2ILMA 1HNZO 1BGYH 3QO7A 4ZBMA 2NNUA 3R65A 1VF6A 3AEIA 2C2AA 2QKCA 4UV8A 1DLBA 1BE3H 5LHHA 1XNQO 1NR1A 1Q6HA 2BTQB 2Y4TA 3J80N 2F23A 4FMTA 4JTAB 3OTOO 1K4CC 2VQFB 1P84F 3U10A 4X1KA 1DTOA 5KAIZ 1N32O 3CC7V 1MNGA 3OUFA 4UVCA 2UUAB 2A79B 1I5YA 1MMMA 3D36A 1HWYA 3G71V 4WFGA 1BL8A 4DV6O 2WLKA 2QTSA 2IU3A 1K34A 1K5SA 3K08A 1QLEB 1NT2B 4DW0A 1VQ7V 1R3IC 3O65A 4ZHQA 1ROPA 2DMXA 2EILB 1PNLA 2OIEA 1XUQA 2YSUB 1DGSA 2KG7B 1Z5VA 5CA1B 4DV5B 1HDJA 3BY6A 3ZIAG 1R3JC 3ZRWA 3CCQV 2V4DA 2WLIB 3HPLC 3ABLC 2WA4A 4UVAA 3GWOA 3RWRD 3TXSA 5LP6A 4F6RB 3AG7A 2N05A 1MSDA 4X20A 4PDVA 2E5LB 3HKBB 1GO3F 4AI8A 2VQEO 5J2UB 2PYJA 3E22B 3ZHSA 1TVKA 4DR7O 1WAZA 1SERA 1WA8A 2YI9A 4J7KA 5KA5A 5KMGB 4HYOA 1L0LH 1JVMA 1Q6UA 4O2BB 4CBCA 2L35A 1B6QA 2YIBD 5KA6A 1XMOO 4Z1MG 1WP8A 3ASNB 3SJBC 2RJZA 3ETQA 2Z5UA 2UXDB 1R6TA 5LMUB 2QE7G 1HR0O 1Y76B 2PY5A 2HLDG 1SRYA 2XUMA 2QWNB 3ABKB 3LSSA 3VOUA 4F6EA 4X9QA 3WG7B 3TCUA 5JCOC 1YTFD 1IURA 2EZPA 2P5OA 3AG1C 3CCRV 2IJIA 1IBKO 3C3TA 3ICXA 5L3GA 4JI0B 1L8DA 3P30A 1M56C 2YICA 5DEDA 1R1BA 1XL4A 1F7YA 3KKYA 3AG2C 5LYJA 1YIJV 4JI5B 3OW2U 2VS0A 2ZR2A 3VQYA 1OCOB 2Q73A 2HEPA 5JQGB 4AQYB 5CA0B 2ZCEA 2JIZG 4PI0A 4DR6O 2PF4E 1K92A 3L75H 3JD0A 4JI2O 2HFEC 2UUBO 3OMAB 1JX9A 4JI7O 2A7WA 1TA8A 1VARA 1D2DA 2IM9A 1N0JA 2IW5A 2E3CA 1SQVH 3X2QB 4GKJO 3VQWA 1SC5B 4LFCO 3K0GA 4GCZA 1KP2A 3FAVB 5FNVA 4CS3A 4DUYO 1T5EA 2BE3A 4B3RO 2QGNA 1BQ0A 1GN3A 4OX9O 4WFBV 1JFFA 4CH3A 2DYSB 2KB1A 1AVMA 1M1KW 1P49A 4N23A 4K0KB 3CE2A 4JYAB 3CRRA 3NXSA 4O4LA 3MHHC 2JEUA 3LDEA 1NKDA 4KP4A 3TETA 4O4IA 1TUBA 1OV9A
chains in the Genus database with same CATH topology
1D5NA 1VEWA 1MNGA 1ZLZA 3C3TA 1MMMA 1QNMA 2CE4A 3TJTA 3DC5A 1AR4A 4GUNA 1LUWA 1IDSA 3IC9A 1PL4A 4C7UA 1B06A 1BSMA 1JA8A 1AP5A 1GN4A 3RN4A 2RCVA 1AR5A 3KKYA 1ZTEA 1Y67A 1XUQA 1XREA 1I08A 2CDYA 3EVKA 2QKAA 1P7GA 1XDCA 4FFKA 4YIOA 2AW9A 1GN2A 4BR6A 1N0NA 3LSUA 1BT8A 1WB8A 3KDRA 1SZXA 1JR9A 3QVNA 2GDSA 1EN5A 1MSDA 1ZSPA 1VARA 1N0JA 2P4KA 4JZ2A 1KKCA 1AP6A 3K9SA 5A9GA 1EN6A 3OT7A 4E4EA 2ADQB 1ZUQA 1MA1A 5AG2A 3DC6A 1IX9A 3AK2A 3CEIA 1GN3A 2QKCA 4JYYA 3MDSA 4JZGA 3BFRA 1BS3A 1AVMA 1XILA 2ADPA 1LUVA 1I0HA 1EN4A 3AK1A 1IXBA 1EM1A 3AK3A 4YIPA 1GN6A 3C3SA 4F6EA 1PM9A 4X9QA 1WB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D5N A;  1VEW A;  1MNG A;  1ZLZ A;  3C3T A;  1MMM A;  1QNM A;  2CE4 A;  3TJT A;  3DC5 A;  1AR4 A;  4GUN A;  1LUW A;  1IDS A;  3IC9 A;  1PL4 A;  4C7U A;  1B06 A;  1BSM A;  1JA8 A;  1AP5 A;  1GN4 A;  3RN4 A;  2RCV A;  1AR5 A;  3KKY A;  1ZTE A;  1Y67 A;  1XUQ A;  1XRE A;  1I08 A;  2CDY A;  3EVK A;  2QKA A;  1P7G A;  1XDC A;  4FFK A;  4YIO A;  2AW9 A;  1GN2 A;  4BR6 A;  1N0N A;  3LSU A;  1BT8 A;  1WB8 A;  1SZX A;  1JR9 A;  3QVN A;  2GDS A;  1EN5 A;  1MSD A;  1ZSP A;  1VAR A;  1N0J A;  2P4K A;  4JZ2 A;  1KKC A;  1AP6 A;  3K9S A;  5A9G A;  1EN6 A;  3OT7 A;  4E4E A;  2ADQ B;  1ZUQ A;  1MA1 A;  5AG2 A;  3DC6 A;  1IX9 A;  3AK2 A;  3CEI A;  1GN3 A;  2QKC A;  4JYY A;  3MDS A;  4JZG A;  3BFR A;  1BS3 A;  1AVM A;  1XIL A;  2ADP A;  1LUV A;  1I0H A;  1EN4 A;  3AK1 A;  1IXB A;  1EM1 A;  3AK3 A;  4YIP A;  1GN6 A;  3C3S A;  4F6E A;  1PM9 A;  4X9Q A;  1WB7 A; 
#chains in the Genus database with same CATH topology
 3CP1 A;  4MTO A;  3JAR A;  5H5N A;  4DV2 B;  3OUS A;  3OMN B;  5D5Q A;  2Y48 A;  1FXK B;  3C90 A;  2XAG A;  5GON B;  1M57 B;  4GKK O;  4C7U A;  1B06 A;  1QR9 A;  2EIK B;  1DK1 A;  4UCR A;  1AP5 A;  1OCC C;  1Q5O A;  5KX5 B;  1RPO A;  3RYC B;  1AI5 A;  3BA8 A;  5LGT A;  4IYH A;  1D5A A;  4DV0 B;  3EHB B;  4H44 B;  4WBN B;  4GX1 A;  1I08 A;  4HBN A;  2CDY A;  1UPG A;  1N8R W;  2GV9 A;  1P7G A;  2B1G A;  2WPD G;  1MSW D;  2P4V A;  2CTQ A;  2Q7G A;  2B5U A;  5D5P A;  3BRC A;  5IY5 C;  3ZED A;  1F4N A;  4TSF G;  3LSU A;  2VQF O;  5A2Q N;  2GUZ A;  4CH6 A;  2LFR A;  4MTX A;  1CP9 A;  2LGW A;  1Q86 W;  4X1Y A;  2DWE C;  2WLJ A;  2UUA O;  2E76 B;  3OFN G;  4MTF A;  2X7R B;  4LC1 A;  2EJ7 A;  3SYC A;  2BOC C;  4PA6 A;  2D3O W;  2PTM A;  2ADQ B;  2XT9 A;  2YC0 A;  5AG2 A;  2BTO A;  1SF9 A;  4KXR A;  4BAY A;  5LA6 B;  3JAL B;  5EYP B;  2IH1 C;  4L8J A;  3VBB A;  1MOF A;  4DRX A;  4PA3 A;  2ZXW B;  1PD3 A;  1HW7 A;  2JK5 C;  1LUV A;  4DV5 O;  3JAW A;  4RUE A;  3T1C A;  4NXM B;  4O4H B;  1JJO A;  4MVQ A;  3GVM A;  2LJ2 A;  2VWK A;  3G67 A;  2CTP A;  3RYI B;  5LGU A;  4I7Z B;  4JYB A;  1VEW A;  4J11 A;  1K4D C;  4J10 A;  3N27 A;  2E5L O;  4ZOL A;  3JAK B;  2Y69 C;  3ASO C;  2YS8 A;  5CBF A;  5LGN A;  1E1R G;  5CBG A;  1S72 V;  3OE7 G;  3I55 V;  3HKD B;  1AR5 A;  1WP7 A;  1IZ3 A;  2CH7 A;  3JAM N;  3ZHQ A;  4DV3 B;  2F93 B;  2HR3 A;  3RBZ A;  3FX7 A;  5EC2 C;  3S3W A;  3OR6 C;  1KU9 A;  2A06 H;  1NVP D;  2OWO A;  4YJ2 B;  4DR7 B;  2UXD O;  5EIB C;  5LMU O;  4L87 A;  1CPY A;  4MW3 A;  1H8H G;  3CPW U;  5IYZ B;  3UO3 A;  2LW1 A;  3Q4H B;  1XMO B;  2ZM6 B;  3CCS V;  3IC7 A;  1VQM V;  2X6B A;  1Q3E A;  2Q6A A;  4QE9 A;  3CMA V;  2YEV A;  3K9S A;  1BCC H;  3R66 A;  2N74 A;  4PA9 A;  2CGO A;  5KHG A;  4JAA A;  5B1N A;  3DC6 A;  3TK1 A;  5ITZ B;  1Y74 B;  3L71 H;  1OCR B;  1SZT A;  3CS5 A;  2OIG A;  3A0H Z;  4Z2W A;  2HJD A;  4I0X A;  3CD6 V;  2XAJ A;  3H9V A;  4JI5 O;  2DN9 A;  2G38 A;  1H2S B;  4YJ3 A;  1V55 C;  2Z0A A;  5LL6 Y;  4JI6 B;  3ZHV A;  4AQY O;  3NR7 A;  3ETE A;  4CC5 A;  1KP3 A;  3AK3 A;  1SES A;  2CGN A;  2WLN A;  3ZN0 A;  3CC4 V;  4QJF B;  4XBF A;  4X65 B;  3K5O A;  4NR1 A;  2K9P A;  2NLJ C;  3OD4 A;  4JTD B;  1D5N A;  1PV0 A;  5B5E Z;  3JSL A;  1FXV A;  4FPP A;  3DXR B;  4JAV A;  4YXW G;  4I55 B;  1PP9 H;  3L70 H;  3OTF A;  1VQN V;  5JJE B;  4LF9 B;  3T4D A;  1JJ2 U;  3ABM B;  1VQ6 V;  4P30 A;  3B40 A;  1Z5W A;  1FS0 G;  1Q6I A;  4JAS A;  4JV5 B;  2Q4P A;  4BIZ A;  5FLX N;  2IU0 A;  2DJV A;  4K0K O;  2RNB A;  3F5W C;  1P7B A;  4JYA O;  3P3N A;  1BT8 A;  3SPJ A;  1HNX B;  2F66 C;  2QR4 A;  2GDS A;  2P7T C;  1VQ8 V;  2JGU A;  3WB1 A;  2WLL A;  4I9W A;  5JVD A;  2PUS A;  4PA4 A;  4WFE A;  2Q0O C;  4DV2 O;  1HNW B;  1KMI Z;  3QO8 A;  5E79 Z;  1OCZ B;  3JYC A;  1VMG A;  3O9O A;  4NYK A;  4TQF A;  3OAA G;  4DV4 B;  1KEC A;  4P9O A;  3APO A;  4IYI A;  4K3A A;  1YHQ V;  2VWJ A;  1Y6X A;  4EFB A;  2ARH A;  3BCC H;  4WFF A;  5LP6 C;  2BCC H;  4WCE V;  2GSM B;  2QWP B;  3RYF A;  5C8Y B;  1VQ5 V;  5CMU A;  1NU1 H;  3CHX A;  4K35 A;  4UCV A;  1NH2 B;  2EIJ C;  3FB8 C;  1QBZ A;  2ZR3 A;  3FYI B;  4EB6 B;  2ZIO A;  3B09 A;  4O2A B;  5H2F Z;  1K7D A;  4TV9 A;  3H01 A;  1JQ0 A;  3IC9 A;  2M6Y A;  5LHG A;  3QG5 A;  3JD2 A;  3K59 A;  2OCC C;  3RT3 C;  2DYR B;  1M93 A;  2EIM B;  3J81 N;  4B3M B;  3A2F A;  1KYO F;  4RQF A;  3OM3 B;  4YIO A;  4DR3 B;  3LSQ A;  2LFS A;  1BMF G;  1RSO A;  1NH2 D;  4NXM O;  1ZL8 B;  3E8B A;  2IH3 C;  4ICG A;  4LF7 B;  4FLY A;  3RW0 A;  4FLV A;  3KDR A;  2ZIM A;  3ZHR A;  3LNN A;  3UT5 B;  4X1I A;  5J2T B;  4I50 A;  4AIL C;  1MAB G;  1KKC A;  3RYH A;  4B7K A;  2QTO A;  4EFE A;  4ZKI A;  2NR5 A;  1GAX A;  1G1X B;  1ZAU A;  1VQ4 V;  1SQF A;  4UCT A;  4DR4 B;  2YXH A;  3K79 A;  4DV3 O;  5B1A B;  3CRQ A;  3MDS A;  4EKW A;  5IYB O;  2JGD B;  3BFR A;  1YTF B;  1ORQ C;  1QLE C;  1S76 D;  4NXN B;  2MW2 B;  1N36 B;  3CJH B;  3ZRS A;  2OYQ A;  1QVF U;  2EIL C;  4HAM A;  4UV9 A;  3C3S A;  4O4J A;  3JD4 A;  2EIN B;  5TIS Z;  4AHC A;  4GX0 A;  4FLU A;  1WB7 A;  3CXC U;  2H3O A;  1QVG U;  2ZM6 O;  1O9G A;  3K0D A;  3B8N A;  3RFR A;  4R50 A;  3CME V;  1U97 A;  1YXB A;  4FLZ A;  2P6J A;  2BSK A;  1AR1 B;  2Q5Z A;  4FM1 A;  2HG5 C;  2HJF C;  3L9D A;  4B7E A;  4RAI A;  5BY1 A;  3CSX A;  2Q7E A;  4H13 B;  5IJ0 B;  1FKA O;  1E1Q G;  1BHB A;  1I5X A;  4CS4 A;  3G80 A;  4TUY B;  5LXT A;  3I56 V;  2ZNI A;  5HFM A;  2RMK B;  3N2G B;  5FL7 G;  5BXZ A;  1XNR O;  2GHY A;  2F1M A;  4FFB B;  2A9H A;  1QCE A;  3AG2 B;  4I9Q A;  1NR7 A;  1JPX A;  3L74 H;  2QWR B;  3K5L A;  4E2L A;  4BW9 A;  2GTS A;  3B77 A;  4JI6 O;  5CB4 B;  1S3J A;  4R6Z A;  4K8Z A;  2Q8V A;  5FPR A;  3QVN A;  1NJI W;  3CX5 F;  2ZNJ A;  4ZI7 B;  2PI5 A;  4X65 O;  2QM4 A;  2BTQ A;  2R72 A;  2HKO A;  3A0R A;  3ABK C;  3OT7 A;  3HKE B;  2YDE A;  1K8A W;  2P06 A;  2R9R B;  4NVP A;  1VQ9 V;  4JGS A;  2JS5 A;  3AK2 A;  3APQ A;  4PD4 F;  4YY3 B;  4GT1 A;  2R9A A;  3LDC A;  4GLX A;  4LF9 O;  4IL6 Z;  3KCX A;  1BZK A;  4RQE A;  4X62 B;  2EX3 A;  4IIJ B;  1R6N A;  1KQS U;  5KUK A;  1W0K G;  4JV5 O;  4DK0 A;  1R6K A;  2VRZ A;  4LF4 B;  2FYU H;  3ZMT A;  5KLV H;  5J9P C;  4BIO A;  1YDX A;  3HB3 B;  2X6A A;  3UCS C;  4QPK A;  4ABM A;  5EZY B;  1HNX O;  1GTO A;  4U7N A;  2KG7 A;  4FZ1 A;  1F4M A;  5B1B C;  3OMI B;  5CA1 A;  4RUF A;  3ZX6 A;  1ZLZ A;  2QSA A;  2V7Q G;  4DO2 A;  4G2K A;  3A0B Z;  4X64 B;  3ZMS A;  2CE4 A;  2WLI A;  1S0V A;  2RDC A;  1HNW O;  5BMV B;  1JA8 A;  3CXH F;  5GTI Z;  2DQ3 A;  1YF2 A;  4F6R A;  1WNS A;  1OCC B;  4JI4 B;  4DV4 O;  4BIU A;  3HKB A;  1JMK C;  1FJG O;  5J2U A;  2UXC O;  3E22 A;  1PPJ H;  1O9H A;  4NB5 A;  1YJW V;  4TV8 B;  3X2Q C;  1YJN V;  4DV7 B;  4B3T B;  1TAE A;  5KMG A;  1W2B U;  1ZX3 A;  1M9N A;  5DEC A;  4BR6 A;  4O2B A;  4I5S A;  1N4C A;  1N0N A;  1GM9 A;  4X88 A;  4J7Z A;  1WB8 A;  4U3F H;  4OPH A;  3UQ8 A;  3ETG A;  4R7C A;  1PKX A;  2DYS C;  4UUJ C;  5K1X A;  2ZDI C;  2HHH O;  1GM7 A;  2EBO A;  3KCY A;  1HP8 A;  1Y76 A;  3HKC B;  1EZJ A;  2FL4 A;  5A9G A;  1FPO A;  1XMQ B;  4HZ3 A;  4D7T A;  2X0L A;  1VQL V;  4DYL A;  3N2K B;  4LFA B;  3OGC C;  1NTK H;  4D6T H;  5GW7 A;  2UUC B;  4FVM A;  2DW4 A;  1TUE B;  3SDL A;  4R8C A;  4OXS A;  1FXK C;  3JCU Z;  4B3M O;  2EIK C;  4PDR A;  1K9M W;  4J80 A;  1SA0 B;  2ITD C;  5LOV B;  5JH7 B;  4DR3 O;  4BW5 A;  3FKS G;  5KHH A;  1Q81 W;  1AI4 A;  1BHA A;  1GKF A;  3CCV V;  4LF7 O;  5EK0 A;  3RVZ A;  3ML0 A;  3G6E V;  4IHJ B;  1JOY A;  3ZRX A;  1AJN A;  5JQG A;  3ZN1 A;  2R9I A;  5LHI A;  5CA0 A;  2YUA A;  4FZ0 A;  2Q68 A;  1Q8I A;  1OZ0 A;  1IDS A;  3QO5 A;  5L3D A;  1J5E B;  1DF4 A;  4KFM A;  1NVP B;  4NTW A;  4I4T B;  4Z1V A;  1OHH G;  5C93 A;  1N34 B;  4DR4 O;  5EC1 C;  5KHK A;  1TGO A;  1AJQ A;  2PGG A;  5LBQ A;  1V9P A;  1MZF A;  3BHP A;  3FAV A;  1XOU A;  4K8X A;  4JAU A;  4NXN O;  1N36 O;  2IBZ H;  3G6B A;  3I5D A;  1EBO A;  4JI1 B;  1KC8 W;  4TOI A;  1RP3 B;  1VQO V;  1SKV A;  1XHX A;  2F43 G;  2ZDI A;  3OR7 C;  1B04 A;  5IJ9 B;  5KUM A;  2QWO B;  1R3L C;  1CXZ B;  1QLN A;  1KD1 W;  4E4E A;  3ZS8 C;  5GTH Z;  4LF6 B;  3E89 A;  3ZBH A;  1XEQ A;  5EBW C;  5F2V O;  2PYL A;  4MSW C;  4HNA B;  3QNE A;  4ASU G;  1XI1 A;  4RWU A;  1FXK A;  1V54 B;  5GON A;  4X89 A;  1QR8 A;  4JZG A;  3CCU V;  5CN0 A;  2YID A;  3JD1 A;  5EIB D;  5KX5 A;  3JCZ A;  3RYC A;  4W4K A;  3J7A U;  4P2Z A;  4LBE C;  5CA3 A;  1S5J A;  1G6U A;  3JAS B;  4MVR A;  4WBN A;  4LNU B;  1RM1 B;  3JAT B;  1FFX B;  4LWS B;  1EFR G;  2YIA A;  4GX5 A;  1XNR B;  3A8T A;  2ZKO A;  2JEX A;  1EZV H;  3IFX A;  1LR1 A;  2ZE5 A;  1AR4 A;  1BQZ A;  4DK1 A;  2ZQM A;  4MVM A;  1GRJ A;  2K1E A;  4TT3 G;  3CRM A;  3CCL V;  1QHT A;  5H6R A;  4YY3 O;  2Y0I A;  3OGI B;  2L6L A;  1ZTE A;  2Z3Y A;  3W7T A;  4X1K B;  3AG4 B;  2M7W A;  4X62 O;  4LCU C;  5LOV A;  1XL6 A;  4G28 B;  2LGQ A;  2Q9L A;  3E8H A;  4G27 B;  1J95 A;  3D8C A;  4LF4 O;  1OCR C;  1Q7Y W;  3H1I H;  5LA6 A;  3OEH G;  3JAL A;  1ARO P;  4J9Y B;  5EYP A;  1PL0 A;  4OGQ B;  3UM7 A;  4ZHQ B;  2KKW A;  3TXQ A;  2ODM A;  2QM7 A;  2Y0P A;  4MW8 A;  4X66 B;  2LQT A;  1AI7 A;  2CTR A;  4O4H A;  3VQX A;  3SR2 C;  2FKX A;  4X64 O;  5KHJ A;  3S3X A;  5BZB A;  3THO A;  2Q69 A;  4GZR B;  3GB7 C;  4XDL A;  3RYI A;  5B3S B;  1IBL B;  4JI4 O;  3ZRW B;  3EXA A;  4B3S B;  4DR1 B;  3W7U A;  2OCH A;  4LF5 O;  4H37 A;  5LP6 B;  3JAK A;  2JS3 A;  2O57 A;  5L3E A;  3K03 A;  3HR0 A;  3AG3 B;  4X20 B;  3ZMZ A;  4DV7 O;  3K3W A;  4B3T O;  4PDL A;  2CTW A;  3HKD A;  1NBM G;  1K33 A;  1TVK B;  1K73 W;  1EM1 A;  4JI3 B;  2FML A;  1WA8 B;  3ABM C;  1FJG B;  2UXC B;  3VQV A;  3SJQ C;  4YJ2 A;  2ZE6 A;  3ZMU A;  5K1P A;  1GM8 A;  1QNM A;  3DC5 A;  5IYZ A;  1VF5 B;  1PL4 A;  1BSM A;  3Q4H A;  2ZIN A;  1XMQ O;  1IJG A;  3RN4 A;  4LFB B;  4LFA O;  1H2N A;  3FB6 C;  4QIW F;  4FLX A;  4DUZ B;  2UUC O;  4FLT A;  3L72 H;  2UXB B;  1AJP A;  4H33 A;  1Y67 A;  1YZB A;  2HHH B;  3IGA C;  1M4U A;  4PA7 A;  2Q0A A;  3CRC A;  1OCZ C;  3UKM A;  4B08 A;  5ITZ A;  1Y74 A;  2F95 B;  1N33 B;  3CCJ V;  2P22 C;  4NTY A;  1SZX A;  4MVZ A;  3T1Y B;  3T4Z A;  1ZSP A;  3U11 A;  2OTL V;  1IXM A;  1Y66 A;  2CK3 G;  4CZZ A;  5LYJ B;  2CUG A;  2F4V B;  1MZE A;  4PDM A;  1Y4M A;  4EEQ A;  4ZIB A;  3UO2 A;  3M99 B;  1J5E O;  2ZD9 A;  5JJN B;  4PHZ A;  1FD9 A;  3CB2 A;  3SYA A;  1COW G;  3ABL B;  4CS2 A;  4JTC B;  1N34 O;  2HVJ C;  3BAB A;  3DXR A;  1ZWI C;  2H8P C;  4KHP B;  4I55 A;  3B2E E;  1RPR A;  3WB2 A;  4LR3 A;  3B4S A;  1IXB A;  1F23 A;  2DWD C;  3JSN A;  2DYR C;  2EIM C;  2ZE8 A;  2RN9 A;  5FNV B;  4JI1 O;  3CCE V;  1G4Y B;  3ZMV A;  1WN7 A;  2WSS G;  3DSQ A;  1KBH A;  1NI8 A;  5EBM C;  2MK3 A;  5KHI A;  3DTU B;  4UCS A;  1JFF B;  2ATK C;  3MAQ A;  4QPJ A;  4TWK A;  3KZI Z;  3FB5 C;  1YI2 V;  4LF6 O;  1GN4 A;  2IJK A;  3W7X A;  3GWK C;  2Q7H A;  4DR5 B;  2JVD A;  4O4L B;  5DM6 V;  1PNM A;  3F5T A;  4DXW A;  3TGU H;  2QJ1 A;  4PI2 A;  3ZJZ A;  4CH4 A;  4O4I B;  4DR2 B;  3E2E A;  1TUB B;  2A3Q A;  3AG1 B;  4A5U B;  3M7M X;  2WLM A;  3BPZ A;  2EZO A;  3JAR B;  1S5L Z;  5L3F A;  5B1O A;  1AB3 A;  4J9Z B;  1M56 B;  1M5I A;  4U7O A;  5B1A C;  2XHB A;  1GK9 A;  2CAZ C;  3E8F A;  1SET A;  3FB7 C;  3STZ C;  5C8Y A;  5IWA O;  2P4K A;  1RFY A;  2UU9 B;  4FIP C;  4WF9 V;  3T2M A;  1ENV A;  3SJC C;  3SPH A;  1SQP H;  4NTX A;  1UJW B;  2QEX V;  2QM8 A;  2EIN C;  1IX9 A;  4EB6 A;  1KB9 F;  3CEI A;  1U96 A;  4O2A A;  1WLE A;  3ASN C;  3P3P A;  4UFZ A;  2GUZ B;  2N04 A;  4JYY A;  2NN4 A;  3WU2 Z;  2WA3 A;  1SQG A;  3U0Z A;  2IJH A;  3T1H B;  2AXT Z;  1AIL A;  2P67 A;  4CC6 A;  4X1Y B;  5IE9 A;  1IVS A;  2XAF A;  2R70 A;  1UFI A;  1GN6 A;  3WG7 C;  3JD3 A;  2XAH A;  1YCI A;  2OTJ V;  2WLH A;  1US6 A;  5B1B B;  1L1F A;  3H1J H;  3FD9 A;  4X66 O;  1ZL8 A;  2BOB C;  2GTA A;  1YJ9 V;  2HVK C;  1LUW A;  4DRX B;  1YIT V;  1AI6 A;  2AHY A;  3W7W A;  1NZ6 A;  3E83 A;  4LF8 B;  4FM2 A;  1VQK V;  4GYC B;  1I94 B;  5HFL A;  3JAW B;  1Q82 W;  5JWP A;  2XAS A;  3UT5 A;  2KQX A;  5J2T A;  2YIB A;  1IBL O;  5BR8 B;  5H6Q A;  4B3S O;  3E35 A;  4DR1 O;  1OCO C;  2W0F C;  2IJJ A;  1S77 D;  2QKA A;  3G4S V;  3CCM V;  1XDC A;  1GH6 A;  2ZT9 B;  1SQX H;  1FOU A;  3RVY A;  1SQB H;  1VQP V;  2Y4U A;  4ZOL B;  2Q67 A;  3QTC A;  5L3B A;  4JYC A;  1H2K A;  5LMN B;  4JI3 O;  2JRI A;  2JGD A;  2AZ0 A;  1QQC A;  4LF5 B;  4JI8 B;  2CH7 B;  4DV1 B;  1WPB A;  4CH5 A;  1PNK A;  2V1D A;  1Q90 D;  3CJH A;  3E86 A;  1H2G A;  2DOS A;  1AP6 A;  4MVO A;  4YHH B;  1OJH A;  1EN6 A;  3BAA A;  3CYO A;  2UXX A;  2ITC C;  1MA1 A;  1FAF A;  1SQQ H;  2W0X A;  2EJR A;  3CC2 V;  4PJ0 Z;  5IY5 B;  4LFB O;  5CBH A;  5JCO A;  4J7J A;  4UCO A;  1XQ8 A;  4DUZ O;  2XTA A;  4J42 A;  1VF7 A;  2UXB O;  4MT8 A;  2RQ6 A;  2KSD A;  1H38 A;  4MVS A;  3IJ4 A;  2AZ2 A;  2ADP A;  4UB6 Z;  5IJ0 A;  2QWQ B;  3MHS C;  3SPG A;  1R73 A;  1JNB A;  4U3J B;  1I0H A;  1EN4 A;  2X6C A;  3H1L H;  4LH6 A;  4TUY A;  4RO2 A;  3N2G A;  3AK1 A;  3BA9 A;  4YIP A;  2YEV B;  1N33 O;  5IYC O;  1H2L A;  1H5W A;  4MS2 A;  4FFB A;  2LW7 A;  4X8A A;  4D7S A;  1PM9 A;  1M90 W;  3FFQ A;  5FPO A;  3T1Y O;  4LP8 A;  5H9C A;  1F51 A;  1IBM B;  1W59 A;  1M57 C;  2LP7 A;  4I0X B;  3P32 A;  5CB4 A;  1P4R A;  2EUL A;  4WFH A;  2F4V O;  3B8M A;  1CEZ A;  4YJ3 B;  1HNZ B;  2OT5 A;  5IDJ A;  1NTZ H;  1THZ A;  3SPI A;  4ZI7 A;  3WB0 A;  3IAY A;  1FYJ A;  5IT9 N;  4UVB A;  5IYD O;  2E75 B;  1KUQ A;  1S5H C;  1XRE A;  1XNQ B;  2XOK G;  5KAF Z;  3HKE A;  4FM0 A;  4KHP O;  2QA4 V;  1YEW A;  2AW9 A;  3OTO B;  4XDJ A;  2AGA A;  2Y69 B;  3ASO B;  4IT5 A;  1NTM H;  3BVO A;  1N32 B;  1JR9 A;  4IIJ A;  3QF7 A;  1EN5 A;  3D3I A;  1L0N H;  4NKG B;  4W4L A;  2B1I A;  1R3K C;  1X4T A;  4DV6 B;  2FTK A;  4FJC C;  4H0L B;  1XBL A;  1H2M A;  5EZY A;  1JCH A;  2P90 A;  2YI8 A;  4DR5 O;  3F7Y C;  1W0J G;  2WAM A;  3KG2 A;  1YVW A;  2ZXW C;  3K5M A;  3PJS K;  1BS3 A;  2WLL B;  5JVD B;  5BMV A;  3K5N A;  4DR2 O;  2JDI G;  5DN6 G;  3WFV A;  3ZRV A;  1SS3 A;  2AHZ A;  3W7S A;  4QNH B;  3LNM B;  3SYP A;  4TV8 A;  4DW1 A;  2YXL A;  1K5Q A;  2XAQ A;  5L3C A;  2VQE B;  4P9P A;  4N21 A;  2WWW A;  4F4L A;  3K04 A;  3TJT A;  2UU9 O;  4GUN A;  1KKD A;  4QGP A;  2QKS A;  1V55 B;  3ABU A;  1B3Q A;  3RYF B;  1XHZ A;  4UB8 Z;  3FYE B;  3LDD A;  2H94 A;  3HKC A;  3ZHT A;  1G8M A;  1K3E A;  4U3J A;  3EVK A;  5IWA B;  4TQD A;  2W6J G;  4LH7 A;  3T1H O;  1LNQ A;  4KUM A;  1HR0 B;  4BWA A;  4PEL A;  4JI0 O;  3N2K A;  2DE0 X;  4TV9 B;  2UXN A;  1X59 A;  4Q6G A;  2ZE7 A;  5E1A C;  2W6I G;  3SYQ A;  4OPA A;  1NS1 A;  1V54 C;  3MD0 A;  4FK5 C;  2QDO A;  1IBK B;  3BEH A;  1MG1 A;  1SA0 A;  3CWB H;  3D3Q A;  1GMG A;  3H1H H;  5JH7 A;  1I7F A;  1FXH A;  2YXY A;  2D2C B;  3ZHU A;  4XDK A;  2ETN A;  4KL1 A;  1RM1 C;  1ZUQ A;  4LF8 O;  3K58 A;  3K06 A;  3SYO A;  4IHJ A;  1RSO B;  4JF3 A;  1I94 O;  1VF6 C;  3CRA A;  5BR8 O;  1QU7 A;  2JJ1 G;  1A32 A;  4UCU A;  1Z2G A;  3F7V C;  3SPC A;  1XIL A;  2LO1 A;  4X1I B;  3RGB A;  4QE7 A;  4I50 B;  4I4T A;  3K9A A;  3SJA C;  4DR6 B;  2HP8 A;  3RYH B;  3ABT A;  3OEE G;  5LMN O;  4JI2 B;  2UUB B;  3AG4 C;  4JI7 B;  1E79 G;  4MTG A;  4GX2 A;  4JI8 O;  3STL C;  5EBL C;  4DV1 O;  1URF A;  3ETD A;  4GKJ B;  3K57 A;  2JJ2 G;  1WPX A;  2XND G;  3D36 C;  1Q43 A;  4LFC B;  3DGE A;  4Q20 A;  4YHH O;  3SGI A;  4DUY B;  4MVU A;  1NQT A;  4B3R B;  2RCV A;  3L73 H;  4IGG A;  5B66 Z;  4OX9 B;  5IJ9 A;  4UXN A;  4FLW A;  2A0L A;  5JJJ B;  2EIJ B;  4JPR A;  3ZCC A;  1K97 A;  4O4J B;  3M8A A;  3E8G A;  2B9Z A;  3LUT B;  1VIB A;  4FFK A;  1GN2 A;  5B3S C;  3H1K H;  1WJZ A;  2BSK B;  4J41 A;  4HNA A;  2PZS A;  2E74 B;  4DV0 O;  2DQ0 A;  4WFA V;  2OCC B;  2PI4 A;  5LXT B;  3AG3 C;  1DF5 A;  1YSC A;  1FFT B;  4JZ2 A;  3EFF K;  1IBM O;  4GKK B;  3JAS A;  1VP7 A;  3PN1 A;  4LNU A;  3JAT A;  1FFX A;  4LWS A;  4PV1 B;  1H8E G;  2GBO A;  2FB5 A;  2ILM A;  1HNZ O;  1BGY H;  3QO7 A;  4ZBM A;  2NNU A;  3R65 A;  1VF6 A;  3AEI A;  2C2A A;  2QKC A;  4UV8 A;  1DLB A;  1BE3 H;  5LHH A;  1XNQ O;  1NR1 A;  1Q6H A;  2BTQ B;  2Y4T A;  3J80 N;  2F23 A;  4FMT A;  4JTA B;  3OTO O;  1K4C C;  2VQF B;  1P84 F;  3U10 A;  4X1K A;  1DTO A;  5KAI Z;  1N32 O;  3CC7 V;  1MNG A;  3OUF A;  4UVC A;  2UUA B;  2A79 B;  1I5Y A;  1MMM A;  3D36 A;  1HWY A;  3G71 V;  4WFG A;  1BL8 A;  4DV6 O;  2WLK A;  2QTS A;  2IU3 A;  1K34 A;  1K5S A;  3K08 A;  1QLE B;  1NT2 B;  4DW0 A;  1VQ7 V;  1R3I C;  3O65 A;  4ZHQ A;  1ROP A;  2DMX A;  2EIL B;  1PNL A;  2OIE A;  1XUQ A;  2YSU B;  1DGS A;  2KG7 B;  1Z5V A;  5CA1 B;  4DV5 B;  1HDJ A;  3BY6 A;  3ZIA G;  1R3J C;  3ZRW A;  3CCQ V;  2V4D A;  2WLI B;  3HPL C;  3ABL C;  2WA4 A;  4UVA A;  3GWO A;  3RWR D;  3TXS A;  5LP6 A;  4F6R B;  3AG7 A;  2N05 A;  1MSD A;  4X20 A;  4PDV A;  2E5L B;  3HKB B;  1GO3 F;  4AI8 A;  2VQE O;  5J2U B;  2PYJ A;  3E22 B;  3ZHS A;  1TVK A;  4DR7 O;  1WAZ A;  1SER A;  1WA8 A;  2YI9 A;  4J7K A;  5KA5 A;  5KMG B;  4HYO A;  1L0L H;  1JVM A;  1Q6U A;  4O2B B;  4CBC A;  2L35 A;  1B6Q A;  2YIB D;  5KA6 A;  1XMO O;  4Z1M G;  1WP8 A;  3ASN B;  3SJB C;  2RJZ A;  3ETQ A;  2Z5U A;  2UXD B;  1R6T A;  5LMU B;  2QE7 G;  1HR0 O;  1Y76 B;  2PY5 A;  2HLD G;  1SRY A;  2XUM A;  2QWN B;  3ABK B;  3LSS A;  3VOU A;  4F6E A;  4X9Q A;  3WG7 B;  3TCU A;  5JCO C;  1YTF D;  1IUR A;  2EZP A;  2P5O A;  3AG1 C;  3CCR V;  2IJI A;  1IBK O;  3C3T A;  3ICX A;  5L3G A;  4JI0 B;  1L8D A;  3P30 A;  1M56 C;  2YIC A;  5DED A;  1R1B A;  1XL4 A;  1F7Y A;  3KKY A;  3AG2 C;  5LYJ A;  1YIJ V;  4JI5 B;  3OW2 U;  2VS0 A;  2ZR2 A;  3VQY A;  1OCO B;  2Q73 A;  2HEP A;  5JQG B;  4AQY B;  5CA0 B;  2ZCE A;  2JIZ G;  4PI0 A;  4DR6 O;  2PF4 E;  1K92 A;  3L75 H;  3JD0 A;  4JI2 O;  2HFE C;  2UUB O;  3OMA B;  1JX9 A;  4JI7 O;  2A7W A;  1TA8 A;  1VAR A;  1D2D A;  2IM9 A;  1N0J A;  2IW5 A;  2E3C A;  1SQV H;  3X2Q B;  4GKJ O;  3VQW A;  1SC5 B;  4LFC O;  3K0G A;  4GCZ A;  1KP2 A;  3FAV B;  5FNV A;  4CS3 A;  4DUY O;  1T5E A;  2BE3 A;  4B3R O;  2QGN A;  1BQ0 A;  1GN3 A;  4OX9 O;  4WFB V;  1JFF A;  4CH3 A;  2DYS B;  2KB1 A;  1AVM A;  1M1K W;  1P49 A;  4N23 A;  4K0K B;  3CE2 A;  4JYA B;  3CRR A;  3NXS A;  4O4L A;  3MHH C;  2JEU A;  3LDE A;  1NKD A;  4KP4 A;  3TET A;  4O4I A;  1TUB A;  1OV9 A; 
#chains in the Genus database with same CATH homology
 1D5N A;  1VEW A;  1MNG A;  1ZLZ A;  3C3T A;  1MMM A;  1QNM A;  2CE4 A;  3TJT A;  3DC5 A;  1AR4 A;  4GUN A;  1LUW A;  1IDS A;  3IC9 A;  1PL4 A;  4C7U A;  1B06 A;  1BSM A;  1JA8 A;  1AP5 A;  1GN4 A;  3RN4 A;  2RCV A;  1AR5 A;  3KKY A;  1ZTE A;  1Y67 A;  1XUQ A;  1XRE A;  1I08 A;  2CDY A;  3EVK A;  2QKA A;  1P7G A;  1XDC A;  4FFK A;  4YIO A;  2AW9 A;  1GN2 A;  4BR6 A;  1N0N A;  3LSU A;  1BT8 A;  1WB8 A;  3KDR A;  1SZX A;  1JR9 A;  3QVN A;  2GDS A;  1EN5 A;  1MSD A;  1ZSP A;  1VAR A;  1N0J A;  2P4K A;  4JZ2 A;  1KKC A;  1AP6 A;  3K9S A;  5A9G A;  1EN6 A;  3OT7 A;  4E4E A;  2ADQ B;  1ZUQ A;  1MA1 A;  5AG2 A;  3DC6 A;  1IX9 A;  3AK2 A;  3CEI A;  1GN3 A;  2QKC A;  4JYY A;  3MDS A;  4JZG A;  3BFR A;  1BS3 A;  1AVM A;  1XIL A;  2ADP A;  1LUV A;  1I0H A;  1EN4 A;  3AK1 A;  1IXB A;  1EM1 A;  3AK3 A;  4YIP A;  1GN6 A;  3C3S A;  4F6E A;  1PM9 A;  4X9Q A;  1WB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...