1AP6A

Tyr34->phe mutant of human mitochondrial manganese superoxide dismutase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Y34F mutant human mitochondrial manganese superoxide dismutase and the functional role of tyrosine 34.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
total genus 74
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ap6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ap6A02
1SZXA 1I0HA 1XUQA 1VARA 3EVKA 4E4EA 3TJTA 2QKCA 1JR9A 3CEIA 1MSDA 3K9SA 1ZTEA 1QNMA 2ADQB 1EN6A 2ADPA 4C7UA 1KKCA 1GN4A 2CE4A 1WB8A 1AP5A 1LUVA 1EM1A 1AR5A 1MNGA 1GN6A 3C3SA 2GDSA 3OT7A 4F6EA 4YIPA 4FFKA 4JYYA 1N0NA 1Y67A 1BSMA 4BR6A 1IX9A 1LUWA 1N0JA 1EN4A 1EN5A 3KKYA 1GN3A 3AK3A 3BFRA 4YIOA 1ZSPA 1XDCA 1PL4A 2P4KA 2CDYA 1JA8A 3AK2A 1MMMA 1BS3A 2AW9A 3MDSA 3C3TA 1XREA 3LSUA 1D5NA 1IDSA 4X9QA 1B06A 3DC5A 3IC9A 2QKAA 1AP6A 2RCVA 1VEWA 1ZUQA 1AVMA 1I08A 4JZGA 1XILA 1AR4A 1ZLZA 1BT8A 3AK1A 1PM9A 3DC6A 1MA1A 3QVNA 1GN2A 5A9GA 3RN4A 5AG2A 1WB7A 4JZ2A 1P7GA 1IXBA 4GUNA
chains in the Genus database with same CATH superfamily
4L87A 4HBNA 2JIZG 3FB5C 5HFLA 3SJBC 2QJ1A 2QTSA 3ZRVA 2EZOA 2KKWA 3I5DA 1K4DC 3E89A 1SESA 1NU1H 1EN6A 4EFEA 2P22C 4DK1A 1IJGA 2IJIA 3RYIB 3BPZA 1IBKB 1XNRB 1UPGA 2EIJC 4KHPO 4PDLA 4DR3O 3ASOB 1YVWA 4NXMO 4GKJO 2QWNB 3GB7C 5EIBC 2M7WA 5CBFA 2BTQA 2LGWA 1BHBA 2Q0AA 4JI7O 2ITDC 1E1QG 4ZOLB 1R3KC 4BR6A 1B6QA 1Q82W 2FTKA 4YXWG 1JNBA 4I0XA 1JJ2U 3VBBA 4GLXA 4B3MB 2QM8A 4X66O 4MTFA 1XMQO 4BW5A 3CRRA 1VQNV 1SA0B 3HKCB 4DK0A 3JATB 1XMOB 2CDYA 4AQYO 1QR8A 2R70A 3ABKC 1H2LA 3CCUV 1XMQB 2UXNA 1F51A 1AI5A 1NVPB 5DECA 2IBZH 1FKAO 3STLC 2EIKC 1BHAA 4LFAO 3HB3B 2XAFA 5BXZA 1B06A 2XNDG 2OTJV 4QE7A 4AI8A 2UUAB 1EBOA 1ZUQA 4QGPA 1KKDA 1K5QA 4KUMA 4LCUC 4R6ZA 2UXBB 3LNMB 2PYLA 1FS0G 1QU7A 2JJ1G 2QDOA 3L9DA 4L8JA 4NTXA 3ABTA 1GK9A 3K57A 3SPGA 1K73W 2K9PA 2DN9A 2L35A 2JVDA 4I7ZB 4JI1O 1M4UA 3QNEA 4PDRA 1ZWIC 4X1KB 3T2MA 4EKWA 4MVMA 4JI2B 1YF2A 5B5EZ 2ZNIA 2P6JA 3G80A 4RWUA 1AP5A 1E1RG 4H44B 4Z1VA 1OJHA 4DXWA 2E5LO 1Q43A 1L0LH 4RQEA 2EILB 3ZMVA 5J2TB 5EK0A 5BMVA 3T4DA 1M57C 2H94A 4LF6B 3CCQV 3I56V 1JCHA 1JFFA 3CRAA 1YTFD 3QO8A 3L71H 4DR5O 4DR6B 3WG7B 1S77D 5FLXN 1SETA 1KUQA 2BOBC 3AK3A 4ZIBA 3AG2B 1ZSPA 1WJZA 3OMAB 2WLIB 4WCEV 2N05A 2NLJC 4UCVA 1MSWD 1NTKH 2IJJA 2DWEC 3K3WA 4I5SA 4JI5B 1RPOA 3M7MX 4YHHB 3MDSA 1H8EG 4X64O 2VWJA 3LUTB 3ZRWA 4MTOA 1WP8A 2QR4A 2UXXA 1XOUA 3SGIA 2VS0A 1Q6HA 3IFXA 2HJFC 4X9QA 4CH6A 3RBZA 1F4MA 4TWKA 5KA5A 2AHZA 3P32A 4BIUA 1AP6A 4Z2WA 1AVMA 1YI2V 4PA3A 3L74H 1PL0A 4UCRA 2ZIOA 4LH7A 4FZ0A 5B3SC 1RM1B 1TVKB 4ZHQA 3P30A 1Z2GA 2W0XA 4X1YA 3MAQA 4JYAB 4LFBB 3JASA 4FLWA 2HJDA 4B3SB 4E4EA 2YI8A 2R9IA 2F4VB 3K5OA 1B04A 2UU9B 4JI3B 4RUEA 4UV8A 1N32B 1KKCA 5IYZB 1OHHG 1XHXA 2DMXA 1FYJA 2JEXA 3K59A 3ZRXA 4LFBO 4PD4F 4WFHA 5CB4B 2XUMA 2ZD9A 4JTAB 5CA0B 1AJPA 4BWAA 2CUGA 1O9HA 4JYCA 2PYJA 1G6UA 4RAIA 5LYJA 1R3IC 1WPBA 1I5YA 3AG4B 4JYYA 4NB5A 3FAVB 3E2EA 4F6RB 1SRYA 3N27A 1AB3A 1Z5VA 4D7TA 4PA9A 4UCSA 4XDLA 4AQYB 4GX5A 4PELA 4H0LB 3ZHQA 1NTZH 3BFRA 3SYPA 1GAXA 1YJ9V 2VQFO 4YY3B 2P4KA 4JI0B 1IBLO 2YEVB 2YIDA 4PDVA 4JYBA 5TISZ 3RW0A 1XREA 1AJQA 4MTXA 4DUZB 3EXAA 1D5NA 2Q0OC 3E35A 3P3NA 4R50A 2QWRB 3PN1A 1Q7YW 4DR5B 4OXSA 4O2AB 4DR2B 3ZEDA 3TXSA 2D3OW 4DV5O 1OCOC 1I08A 3E8BA 2DE0X 1H8HG 5LXTB 2R9RB 1M93A 4G27B 1JX9A 2UUCO 1QLEC 5FL7G 1XNRO 4EFBA 5AG2A 1NQTA 5EYPB 4I9WA 4D6TH 4B7KA 1I7FA 5FNVB 1I94O 4DW0A 3FYEB 2KG7A 3RVYA 5C8YB 2V1DA 4JI7B 5JCOA 3UQ8A 1NTMH 2ZQMA 4JTDB 1ZTEA 3JD0A 3AG4C 1KP3A 2YXLA 2HEPA 3CX5F 4BW9A 3TXQA 2CTPA 3A2FA 4MTGA 1EM1A 3T1HB 2QGNA 4JI1B 4ABMA 4NTYA 5JJEB 3VQVA 1VQ9V 5KHIA 3APOA 3DGEA 4LNUB 2IW5A 1N36O 1PPJH 5LMNO 3NXSA 4NKGB 3W7SA 1QQCA 2OCCB 1J95A 2ZE5A 4B3RB 4FVMA 3GWKC 3OEEG 3K5MA 5K1XA 1FXKB 1BCCH 1VQ6V 2OCCC 1FJGO 2ZDIA 1Y74A 4JASA 5LBQA 1XNQO 4RUFA 2CAZC 4H33A 2QKAA 1ZAUA 2B5UA 4JI2O 2GUZA 2EIKB 1QVGU 5B66Z 4CC6A 3VOUA 3WG7C 3F7VC 3D3QA 1KYOF 3CD6V 1P7BA 4GX1A 4LF9B 3K06A 3J80N 5L3CA 4NTWA 5EC1C 4XBFA 3RYCA 2RMKB 3OW2U 2P06A 1Z5WA 4I55B 1IBKO 4LF4O 2IH1C 4DV0O 4DV2B 2WLIA 3BABA 2ARHA 3EVKA 4LWSA 1L1FA 4W4KA 1H2MA 2ADQB 5IYDO 3G67A 2YXYA 1VQLV 3T4ZA 2Q7HA 2JRIA 1FPOA 2RNBA 3RFRA 4JV5O 3RYIA 1B3QA 3JCUZ 2ZXWC 1I94B 1GM8A 2QE7G 3K0DA 2Y69C 4FLZA 3ABMC 3UO3A 1N0JA 1ZL8A 4IHJB 5L3DA 3SR2C 4QNHB 2CGOA 3UO2A 2MW2B 1EFRG 1W0JG 4CH3A 4YIOA 4KFMA 3JD3A 2CTRA 4ZBMA 4Z1MG 4WF9V 4O4LA 1HR0O 1THZA 3DTUB 1Y76B 4KHPB 3D36C 2UXBO 5L3FA 3AG7A 1YDXA 2YICA 1GMGA 2E75B 2P4VA 2Y48A 2RDCA 5D5QA 3CCVV 3OTOB 4X65B 3CP1A 2E3CA 2E76B 4MSWC 5LHHA 3CMEV 3H1IH 4F4LA 2XAGA 1M56C 1ZLZA 2QKSA 5IJ9A 3DC6A 1F4NA 1SQPH 1OV9A 4TV9A 3RN4A 3QO5A 1MG1A 3JALB 2GV9A 3JAWB 3ZS8C 2XAHA 1P7GA 2CH7B 1R3LC 2F66C 2EJ7A 2Q67A 4LNUA 1R6TA 2ATKC 3D3IA 4XDJA 1I0HA 5GONB 2AGAA 4G28B 3TJTA 4DW1A 3ZHSA 1N34O 3K9SA 3C90A 5CN0A 3DXRB 1OCOB 3E86A 1K5SA 4PA4A 3W7WA 5IYBO 1OCZC 5JJNB 1XHZA 1F23A 2Y69B 2LW1A 1W2BU 2Q7EA 3C3SA 1R3JC 5L3GA 3ZHRA 3G71V 1IXMA 3RWRD 4EEQA 1OZ0A 1YEWA 1Y67A 4O4IA 4N23A 2GTSA 4TQFA 1BMFG 2XAJA 1WNSA 1EN5A 4LF5B 2QSAA 2QM4A 2XASA 5JQGA 2B9ZA 1Y74B 3HKEB 1I5XA 4TV8A 1TUBA 1GN3A 2Z3YA 4HYOA 3B77A 4J10A 4FFBA 4UFZA 1RP3B 3MHHC 3BCCH 3KZIZ 2GBOA 4E2LA 4X62B 1BGYH 1AROP 2K1EA 5H2FZ 1X59A 3ETEA 5F2VO 2IJKA 2Q4PA 4FJCC 4FLUA 3FKSG 1K33A 2ZE8A 2GHYA 1YHQV 4JYAO 3CCEV 1WA8B 2GSMB 2BE3A 3AK1A 4FPPA 2WA4A 1NVPD 1PKXA 5KX5A 3ETDA 2LGQA 1IXBA 2OWOA 1D5AA 4GX0A 2YDEA 1K34A 5ITZA 2WAMA 2Y0PA 2HG5C 4TV9B 1KQSU 3RYHA 4UCTA 1GM9A 5IJ9B 5C93A 3FB8C 3OTOO 1N33B 5D5PA 3B2EE 5LGTA 4DV3O 5H9CA 2EX3A 3AG3C 1AR1B 3ASNC 1MSDA 4YHHO 3CHXA 1VF6C 3IAYA 4DV7O 1XNQB 3JASB 2UXCO 1VF7A 1J5EB 4MT8A 1R73A 4ZHQB 3BRCA 1TA8A 5B1AB 4YJ2A 3RVZA 1P4RA 3CJHB 2Q9LA 4OX9O 3SJAC 4LWSB 2DQ3A 2OT5A 1WA8A 2V7QG 4X8AA 1L8DA 1SA0A 3HKCA 4DV2O 2DYSC 2JJ2G 3D8CA 4GT1A 3U0ZA 1FFXB 1GRJA 1SZTA 4PDMA 3L75H 4CZZA 4QJFB 2QM7A 1KC8W 2FB5A 3OUFA 3TK1A 3WFVA 1F7YA 5FPRA 4MS2A 2PUSA 5LYJB 4MVUA 2KG7B 3HR0A 1YJWV 2GUZB 1JA8A 1K7DA 2HHHO 2ZINA 4ZI7A 3VQXA 4DV6B 4J9YB 2AZ2A 4K0KB 1PD3A 4WFFA 1NBMG 4IIJB 1FXHA 1Q81W 1TGOA 3CCLV 3KG2A 1VEWA 4O4JA 1R6NA 4B7EA 1HNZO 1G1XB 5HFMA 4LF7O 1SKVA 5GTIZ 3L73H 1BT8A 4X66B 3HKDB 5B1AC 1N36B 4B3SO 5IT9N 1VQPV 1VQ8V 2AHYA 3GWOA 4JI3O 1N32O 4QPKA 4K3AA 2ZM6B 2P7TC 3KCYA 1DF4A 2ILMA 4J42A 4DR1O 1JOYA 4LF8B 1Q86W 2WSSG 5IYCO 3ZMZA 2DWDC 3CB2A 2Q73A 3SYOA 3MD0A 3JARB 1SQGA 4FLVA 1VQ4V 1VQKV 3ZIAG 4DRXA 1N33O 4FLTA 3JSLA 3ABUA 1J5EO 3G6EV 1YITV 1IX9A 4P30A 3Q4HA 5LA6A 1XQ8A 2H8PC 1YZBA 3E22B 3KKYA 1FOUA 4HAMA 4O4HA 2VRZA 2CGNA 4LF4B 2KB1A 4DR7O 1H2SB 5H5NA 3MHSC 2EIJB 5KLVH 2DQ0A 1H2NA 1IBMO 4ZKIA 2XAQA 2EIMB 1NKDA 1HW7A 1NH2D 4X1YB 4LF9O 3NR7A 1OCCC 2WLMA 2X6CA 2KSDA 4U3FH 4BAYA 3JSNA 3T1HO 3BHPA 4LBEC 3IC9A 1S0VA 2OIEA 2WA3A 4AILC 3S3WA 3ZX6A 1URFA 1JQ0A 4DV7B 2ITCC 1SS3A 5IY5B 5LMUO 5BR8O 4JZ2A 2CH7A 4WFEA 1M57B 3K9AA 3SPHA 4EB6A 1SQVH 1X4TA 3B4SA 4JV5B 1ZL8B 2F23A 4IHJA 2LFRA 1MABG 2QTOA 5KHKA 2GTAA 2IU3A 3DSQA 1QHTA 4D7SA 4DR2O 5CA0A 1XL6A 2B1GA 1S76D 1GM7A 1PP9H 3OTFA 4WBNB 4U3JA 1BQ0A 1JFFB 3LSQA 4NXNO 4ZI7B 1FD9A 2GDSA 4HNAB 3QF7A 1HDJA 4OGQB 2UUAO 2Z5UA 4OPHA 1N0NA 3ZN0A 1JJOA 4J11A 3PJSK 1EN4A 1IBMB 5CMUA 3ETGA 4UB6Z 3CC2V 1A32A 1DK1A 1GTOA 5IWAB 1OCRB 4JI0O 1RFYA 1ROPA 1FXKA 5KAFZ 5EZYB 5IE9A 4P9OA 4DV6O 3CRQA 5LGUA 1DLBA 1OCRC 2ZE6A 1MMMA 5GW7A 4JPRA 1S72V 3BAAA 4X65O 2AW9A 1XMOO 5E1AC 3KCXA 3BY6A 2OCHA 4NVPA 4YJ2B 3OD4A 4J9ZB 2JGUA 3W7TA 1KB9F 2WLLB 3VQWA 4LFCO 5LMNB 4ZOLA 2LO1A 2EULA 1AR4A 4JAVA 4LF6O 1COWG 3CCMV 1MA1A 3QVNA 4QPJA 1N34B 2FL4A 1QR9A 1Q6UA 2B1IA 1R1BA 2WPDG 1IBLB 1DGSA 3SPIA 3LDEA 1FXVA 2F93B 4O2BA 4JI4B 5KHHA 1GO3F 3OAAG 4K0KO 4DV4B 4FM2A 1TAEA 4UVBA 5LHGA 2WLHA 3JD4A 4DYLA 3ZHUA 1WLEA 4R8CA 5LMUB 2VWKA 4X64B 4JGSA 3ASNB 1FFXA 3CRCA 2IM9A 1NH2B 4JI6B 1MNGA 1NR1A 3B40A 1GH6A 4JI4O 3M8AA 4QE9A 4I9QA 5JJJB 1XL4A 2QWQB 2P5OA 2ZKOA 3LSSA 3K5NA 4X1KA 5KUKA 1AI4A 5EBLC 4B3MO 2JGDB 4LP8A 4KP4A 4MVQA 1M5IA 1HNXO 4UCUA 3BVOA 4DUYB 1QLNA 4GKKB 4W4LA 2MK3A 3U11A 5L3BA 1Q8IA 4BIZA 1BZKA 1W0KG 4FM0A 3IGAC 4FK5C 1VF5B 4PI2A 3X2QC 4NXNB 1WP7A 4LF7B 1Q90D 1SQBH 2EBOA 3T1YB 1U97A 1P84F 3A8TA 4OX9B 1H2KA 1ORQC 3OMNB 4IT5A 5LGNA 1AI6A 2KQXA 4KL1A 2PI4A 2WLNA 3U10A 5IWAO 3CJHA 5KHGA 2UUBB 2HKOA 1V55C 3J81N 2A7WA 3UT5B 1WB7A 2W6IG 2ETNA 4MVOA 4U7OA 1CP9A 4MVSA 4P9PA 2F4VO 1V55B 4FMTA 3N2GA 2BTQB 2C2AA 5EC2C 5C8YA 4FM1A 3S3XA 5K1PA 2DYRB 2Q6AA 2R9AA 1NS1A 1Q5OA 5FNVA 5B1NA 2IJHA 4U3JB 1GN4A 2CE4A 1VF6A 5LP6B 1YJNV 3CCSV 2UU9O 3R65A 5JCOC 2QWPB 1QLEB 2F43G 5JWPA 2P90A 3OM3B 1K97A 1XBLA 1R6KA 2LP7A 3A0HZ 2ZCEA 4F6EA 3B8NA 2BTOA 4WFAV 5BR8B 5BZBA 1QBZA 5DM6V 1AILA 4P2ZA 1G4YB 4LFAB 4O4JB 1U96A 3A0BZ 3JAKA 3N2KA 1KECA 1M9NA 4CS2A 4K35A 1XI1A 2JS5A 2PI5A 1RSOB 2V4DA 3H01A 3K03A 3CYOA 4WFGA 1SQXH 3WB2A 1XDCA 2ZR2A 2YS8A 1HR0B 4JI8B 3OR7C 1WPXA 5IJ0A 1K3EA 2R72A 2Q7GA 1T5EA 5J2UA 1RPRA 4Q6GA 2BSKA 2Q68A 2EILC 1M90W 3CC4V 4WBNA 5LP6A 3G4SV 2M6YA 3F5WC 3AEIA 1KU9A 3M99B 3STZC 5DEDA 4DUZO 2DYRC 2NNUA 3O65A 5LL6Y 2G38A 4GKKO 5BMVB 4FLYA 5LP6C 2E5LB 1D2DA 1MZFA 2HVJC 4DR3B 4O2AA 1GN2A 4CH4A 3AG1B 3HKEA 3UCSC 5CB4A 2YIAA 5KMGB 1AI7A 4X1IA 3ABLB 5B1BB 3UT5A 4GUNA 1NR7A 3Q4HB 4DV4O 3DXRA 3CXCU 3JYCA 4O4LB 1S5LZ 3K5LA 1VARA 1VP7A 3W7XA 4TUYA 4AHCA 1YXBA 5A2QN 3JATA 3ZJZA 3CCJV 1JVMA 2ADPA 4DV1B 3H1LH 4UVAA 3J7AU 1EZJA 1H5WA 1LNQA 2FMLA 2YI9A 5DN6G 4X20B 2WLJA 3JAWA 4JI5O 3RYFB 3N2KB 1H2GA 3ZMTA 2LJ2A 2N04A 4YJ3B 5FPOA 4DV5B 3E83A 5GONA 3RT3C 2W6JG 4R7CA 1BSMA 1BE3H 3OE7G 1VQ7V 2ZM6O 2YC0A 5BY1A 1CXZB 4JI6O 4K8ZA 2YSUB 1Y4MA 3OEHG 4RO2A 2F95B 3AG1C 3CMAV 2ZT9B 3H1HH 5L3EA 2HHHB 4GYCB 3TGUH 3CSXA 1HNZB 3THOA 3CPWU 3C3TA 1TUBB 4LR3A 4EB6B 4K8XA 4GX2A 2XHBA 2H3OA 4JZGA 2PTMA 3ABLC 5B1BC 1XILA 5KHJA 3FX7A 2Y0IA 1Y6XA 2X0LA 4H13B 3CCRV 1RSOA 3CWBH 4J7ZA 2P67A 4HZ3A 4JI8O 3E8HA 3WB1A 5JH7B 1LR1A 4G2KA 3H1JH 1V54C 2OTLV 1PNKA 3JAMN 5KMGA 2NN4A 5J9PC 1EZVH 2FKXA 5H6QA 3W7UA 2DW4A 2ZDIC 3H9VA 1DF5A 1PNLA 1SERA 2ZR3A 2AXTZ 3OGIB 3RYCB 5IDJA 4IL6Z 4C7UA 1KMIZ 2UXDO 3B09A 5JH7A 1XEQA 3CC7V 2A79B 1KP2A 3BEHA 3E22A 3E8GA 4TT3G 5B3SB 4CC5A 2ZE7A 2Z0AA 3UKMA 2DJVA 2YEVA 4PA7A 3VQYA 3TCUA 4X89A 2Y4TA 4YJ3A 4FZ1A 2LW7A 2UXDB 2EZPA 4DR1B 3EFFK 5CA1B 3HKBA 3BA9A 3QO7A 3RGBA 4X20A 3HKBB 1FXKC 4MVRA 1N8RW 3JAKB 3ETQA 4LFCB 2RQ6A 2VQEB 1S3JA 2XT9A 3SYQA 2X6AA 4O2BB 1V9PA 1IVSA 1IZ3A 4DO2A 4YY3O 4X62O 4O4HB 3WB0A 3X2QB 1M56B 2EJRA 1GKFA 5IYZA 4I4TB 2RCVA 2QEXV 4H37A 3T1CA 2ZNJA 4DRXB 1HWYA 4I50B 2PGGA 2A06H 1CPYA 3SDLA 3FFQA 4NR1A 2YXHA 2X7RB 3JD2A 3ZBHA 2RN9A 3RYFA 1P49A 2JS3A 2E74B 3F7YC 2NR5A 3WU2Z 1US6A 2HLDG 3APQA 4DR4B 2JEUA 1SQFA 3FB7C 2JDIG 5J2TA 1OCZB 2YIBA 2QKCA 2BOCC 3CEIA 1NI8A 3ZN1A 2PY5A 5LHIA 3K79A 1QNMA 3LDDA 3KDRA 3SJQC 3FD9A 2Q8VA 1WB8A 2D2CB 4X1IB 3ZHTA 2A9HA 3G6BA 3K04A 2VQFB 1Y66A 3E8FA 1H38A 2A0LA 1AR5A 3OUSA 4F6RA 4DUYO 3CE2A 1VMGA 1S5HC 5B1OA 3OT7A 2PF4E 1K8AW 4YIPA 1QCEA 1UFIA 3OGCC 4J80A 3K08A 4UB8Z 3F5TA 2EINB 1JMKC 2YUAA 4TSFG 3ZCCA 4CS3A 3ZMSA 1YTFB 1W59A 5J2UB 2JGDA 3LDCA 5IY5C 2WWWA 3O9OA 2LQTA 4JAUA 4OPAA 3T1YO 5LXTA 2O57A 2CK3G 4XDKA 1SC5B 2BCCH 2YIBD 4MW3A 4B3RO 4PA6A 1S5JA 3LSUA 3AG2C 1DTOA 2ZXWB 4LC1A 3K58A 1E79G 1IDSA 4DV0B 5KAIZ 4IYHA 2FYUH 3CS5A 3DC5A 4TOIA 3IJ4A 4B08A 5KX5B 1RM1C 3SYCA 1IURA 3TETA 1M1KW 1SF9A 3IC7A 3D36A 2VQEO 2HVKC 5A9GA 2OIGA 3SYAA 4KXRA 3HPLC 1VQMV 1MZEA 2QA4V 4JTCB 1VQ5V 1YSCA 3GVMA 4DV3B 2EINC 4GCZA 4IYIA 4LF5O 5KUMA 4JAAA 4B3TO 5GTHZ 3P3PA 1PNMA 4TUYB 1ZX3A 1PV0A 1JR9A 5H6RA 3H1KH 4I50A 5ITZB 1SQQH 4I4TA 5JVDA 2BSKB 5CBHA 1LUVA 4JF3A 1Y76A 1MOFA 4PV1B 1GN6A 4B3TB 3HKDA 1TUEB 4UXNA 1OCCB 4FFKA 1V54B 2L6LA 3N2GB 4FIPC 3L70H 4U7NA 4ASUG 4I55A 3RYHB 5EZYA 5E79Z 1LUWA 1BL8A 4CH5A 4UV9A 2WLKA 3R66A 1VIBA 5EBMC 3A0RA 1KBHA 1K92A 2DYSB 4WFBV 3OR6C 2HP8A 4NXMB 3FAVA 1JPXA 4MVZA 1CEZA 1G8MA 4J7JA 2LFSA 4N21A 2ODMA 2W0FC 2UXCB 3ASOC 1NJIW 1NZ6A 4CS4A 3JCZA 2JK5C 1Q6IA 1BQZA 1FJGB 2N74A 3SJCC 4MW8A 1L0NH 1K4CC 1K9MW 3ZRWB 1Q3EA 3ABMB 4O4IB 2A3QA 1FAFA 3ICXA 4PI0A 4J7KA 2HR3A 1NT2B 1PM9A 2RJZA 4FFBB 4ICGA 3UM7A 4QIWF 1QVFU 2WLLA 4TV8B 4IIJA 4UCOA 3CRMA 1TVKA 4FLXA 3JD1A 4GKJB 2UUCB 2EIMC 2Q69A 5LA6B 3B8MA 3SPCA 2Y4UA 3FYIB 3ABKB 4DR7B 1SZXA 3FB6C 5IJ0B 5KA6A 4CBCA 3ZMUA 1XUQA 4DR6O 1ENVA 3L72H 4DV1O 4UUJC 1FFTB 1HNWO 4RQFA 1O9GA 3ZHVA 1YCIA 2UUBO 3QG5A 1AJNA 4I0XB 2CTWA 3ML0A 4A5UB 1YIJV 1N4CA 2IH3C 2CTQA 2XOKG 3OFNG 5LOVB 4LH6A 1VQOV 1HNWB 3SPJA 2QWOB 4GZRB 5CA3A 5JVDB 4BIOA 2AZ0A 2Q5ZA 3LNNA 4NYKA 1HNXB 2F1MA 1UJWB 3BA8A 2OYQA 5LOVA 1PL4A 3AK2A 3K0GA 1BS3A 4X88A 2IU0A 4PHZA 4TQDA 3JARA 4LF8O 1KD1W 4Q20A 4UVCA 3AG3B 2PZSA 5JQGB 4IGGA 5CA1A 5EBWC 4J41A 4PJ0Z 3EHBB 4DR4O 1WN7A 3OMIB 2DOSA 2HFEC 5EIBD 2XTAA 4HNAA 3I55V 1WAZA 2X6BA 3ZRSA 3QTCA 3CXHF 5CBGA 5EYPA 3JALA 1HP8A 2ZIMA
chains in the Genus database with same CATH topology
1SZXA 1I0HA 1XUQA 1VARA 3EVKA 4E4EA 3TJTA 2QKCA 1JR9A 3CEIA 1MSDA 3K9SA 1ZTEA 1QNMA 3KDRA 2ADQB 1EN6A 2ADPA 4C7UA 1KKCA 1GN4A 2CE4A 1WB8A 1AP5A 1LUVA 1EM1A 1AR5A 1MNGA 1GN6A 3C3SA 2GDSA 3OT7A 4F6EA 4YIPA 4FFKA 4JYYA 1N0NA 1Y67A 1BSMA 4BR6A 1IX9A 1LUWA 1N0JA 1EN4A 1EN5A 3KKYA 1GN3A 3AK3A 3BFRA 4YIOA 1ZSPA 1XDCA 1PL4A 2P4KA 2CDYA 1JA8A 3AK2A 1MMMA 1BS3A 2AW9A 3MDSA 3C3TA 1XREA 3LSUA 1D5NA 1IDSA 4X9QA 1B06A 3DC5A 3IC9A 2QKAA 1AP6A 2RCVA 1VEWA 1ZUQA 1AVMA 1I08A 4JZGA 1XILA 1AR4A 1ZLZA 1BT8A 3AK1A 1PM9A 3DC6A 1MA1A 3QVNA 1GN2A 5A9GA 3RN4A 5AG2A 1WB7A 4JZ2A 1P7GA 1IXBA 4GUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZX A;  1I0H A;  1XUQ A;  1VAR A;  3EVK A;  4E4E A;  3TJT A;  2QKC A;  1JR9 A;  3CEI A;  1MSD A;  3K9S A;  1ZTE A;  1QNM A;  2ADQ B;  1EN6 A;  2ADP A;  4C7U A;  1KKC A;  1GN4 A;  2CE4 A;  1WB8 A;  1AP5 A;  1LUV A;  1EM1 A;  1AR5 A;  1MNG A;  1GN6 A;  3C3S A;  2GDS A;  3OT7 A;  4F6E A;  4YIP A;  4FFK A;  4JYY A;  1N0N A;  1Y67 A;  1BSM A;  4BR6 A;  1IX9 A;  1LUW A;  1N0J A;  1EN4 A;  1EN5 A;  3KKY A;  1GN3 A;  3AK3 A;  3BFR A;  4YIO A;  1ZSP A;  1XDC A;  1PL4 A;  2P4K A;  2CDY A;  1JA8 A;  3AK2 A;  1MMM A;  1BS3 A;  2AW9 A;  3MDS A;  3C3T A;  1XRE A;  3LSU A;  1D5N A;  1IDS A;  4X9Q A;  1B06 A;  3DC5 A;  3IC9 A;  2QKA A;  1AP6 A;  2RCV A;  1VEW A;  1ZUQ A;  1AVM A;  1I08 A;  4JZG A;  1XIL A;  1AR4 A;  1ZLZ A;  1BT8 A;  3AK1 A;  1PM9 A;  3DC6 A;  1MA1 A;  3QVN A;  1GN2 A;  5A9G A;  3RN4 A;  5AG2 A;  1WB7 A;  4JZ2 A;  1P7G A;  1IXB A;  4GUN A; 
#chains in the Genus database with same CATH topology
 4L87 A;  4HBN A;  2JIZ G;  3FB5 C;  5HFL A;  3SJB C;  2QJ1 A;  2QTS A;  3ZRV A;  2EZO A;  2KKW A;  3I5D A;  1K4D C;  3E89 A;  1SES A;  1NU1 H;  1EN6 A;  4EFE A;  2P22 C;  4DK1 A;  1IJG A;  2IJI A;  3RYI B;  3BPZ A;  1IBK B;  1XNR B;  1UPG A;  2EIJ C;  4KHP O;  4PDL A;  4DR3 O;  3ASO B;  1YVW A;  4NXM O;  4GKJ O;  2QWN B;  3GB7 C;  5EIB C;  2M7W A;  5CBF A;  2BTQ A;  2LGW A;  1BHB A;  2Q0A A;  4JI7 O;  2ITD C;  1E1Q G;  4ZOL B;  1R3K C;  4BR6 A;  1B6Q A;  1Q82 W;  2FTK A;  4YXW G;  1JNB A;  4I0X A;  1JJ2 U;  3VBB A;  4GLX A;  4B3M B;  2QM8 A;  4X66 O;  4MTF A;  1XMQ O;  4BW5 A;  3CRR A;  1VQN V;  1SA0 B;  3HKC B;  4DK0 A;  3JAT B;  1XMO B;  2CDY A;  4AQY O;  1QR8 A;  2R70 A;  3ABK C;  1H2L A;  3CCU V;  1XMQ B;  2UXN A;  1F51 A;  1AI5 A;  1NVP B;  5DEC A;  2IBZ H;  1FKA O;  3STL C;  2EIK C;  1BHA A;  4LFA O;  3HB3 B;  2XAF A;  5BXZ A;  1B06 A;  2XND G;  2OTJ V;  4QE7 A;  4AI8 A;  2UUA B;  1EBO A;  1ZUQ A;  4QGP A;  1KKD A;  1K5Q A;  4KUM A;  4LCU C;  4R6Z A;  2UXB B;  3LNM B;  2PYL A;  1FS0 G;  1QU7 A;  2JJ1 G;  2QDO A;  3L9D A;  4L8J A;  4NTX A;  3ABT A;  1GK9 A;  3K57 A;  3SPG A;  1K73 W;  2K9P A;  2DN9 A;  2L35 A;  2JVD A;  4I7Z B;  4JI1 O;  1M4U A;  3QNE A;  4PDR A;  1ZWI C;  4X1K B;  3T2M A;  4EKW A;  4MVM A;  4JI2 B;  1YF2 A;  5B5E Z;  2ZNI A;  2P6J A;  3G80 A;  4RWU A;  1AP5 A;  1E1R G;  4H44 B;  4Z1V A;  1OJH A;  4DXW A;  2E5L O;  1Q43 A;  1L0L H;  4RQE A;  2EIL B;  3ZMV A;  5J2T B;  5EK0 A;  5BMV A;  3T4D A;  1M57 C;  2H94 A;  4LF6 B;  3CCQ V;  3I56 V;  1JCH A;  1JFF A;  3CRA A;  1YTF D;  3QO8 A;  3L71 H;  4DR5 O;  4DR6 B;  3WG7 B;  1S77 D;  5FLX N;  1SET A;  1KUQ A;  2BOB C;  3AK3 A;  4ZIB A;  3AG2 B;  1ZSP A;  1WJZ A;  3OMA B;  2WLI B;  4WCE V;  2N05 A;  2NLJ C;  4UCV A;  1MSW D;  1NTK H;  2IJJ A;  2DWE C;  3K3W A;  4I5S A;  4JI5 B;  1RPO A;  3M7M X;  4YHH B;  3MDS A;  1H8E G;  4X64 O;  2VWJ A;  3LUT B;  3ZRW A;  4MTO A;  1WP8 A;  2QR4 A;  2UXX A;  1XOU A;  3SGI A;  2VS0 A;  1Q6H A;  3IFX A;  2HJF C;  4X9Q A;  4CH6 A;  3RBZ A;  1F4M A;  4TWK A;  5KA5 A;  2AHZ A;  3P32 A;  4BIU A;  1AP6 A;  4Z2W A;  1AVM A;  1YI2 V;  4PA3 A;  3L74 H;  1PL0 A;  4UCR A;  2ZIO A;  4LH7 A;  4FZ0 A;  5B3S C;  1RM1 B;  1TVK B;  4ZHQ A;  3P30 A;  1Z2G A;  2W0X A;  4X1Y A;  3MAQ A;  4JYA B;  4LFB B;  3JAS A;  4FLW A;  2HJD A;  4B3S B;  4E4E A;  2YI8 A;  2R9I A;  2F4V B;  3K5O A;  1B04 A;  2UU9 B;  4JI3 B;  4RUE A;  4UV8 A;  1N32 B;  1KKC A;  5IYZ B;  1OHH G;  1XHX A;  2DMX A;  1FYJ A;  2JEX A;  3K59 A;  3ZRX A;  4LFB O;  4PD4 F;  4WFH A;  5CB4 B;  2XUM A;  2ZD9 A;  4JTA B;  5CA0 B;  1AJP A;  4BWA A;  2CUG A;  1O9H A;  4JYC A;  2PYJ A;  1G6U A;  4RAI A;  5LYJ A;  1R3I C;  1WPB A;  1I5Y A;  3AG4 B;  4JYY A;  4NB5 A;  3FAV B;  3E2E A;  4F6R B;  1SRY A;  3N27 A;  1AB3 A;  1Z5V A;  4D7T A;  4PA9 A;  4UCS A;  4XDL A;  4AQY B;  4GX5 A;  4PEL A;  4H0L B;  3ZHQ A;  1NTZ H;  3BFR A;  3SYP A;  1GAX A;  1YJ9 V;  2VQF O;  4YY3 B;  2P4K A;  4JI0 B;  1IBL O;  2YEV B;  2YID A;  4PDV A;  4JYB A;  5TIS Z;  3RW0 A;  1XRE A;  1AJQ A;  4MTX A;  4DUZ B;  3EXA A;  1D5N A;  2Q0O C;  3E35 A;  3P3N A;  4R50 A;  2QWR B;  3PN1 A;  1Q7Y W;  4DR5 B;  4OXS A;  4O2A B;  4DR2 B;  3ZED A;  3TXS A;  2D3O W;  4DV5 O;  1OCO C;  1I08 A;  3E8B A;  2DE0 X;  1H8H G;  5LXT B;  2R9R B;  1M93 A;  4G27 B;  1JX9 A;  2UUC O;  1QLE C;  5FL7 G;  1XNR O;  4EFB A;  5AG2 A;  1NQT A;  5EYP B;  4I9W A;  4D6T H;  4B7K A;  1I7F A;  5FNV B;  1I94 O;  4DW0 A;  3FYE B;  2KG7 A;  3RVY A;  5C8Y B;  2V1D A;  4JI7 B;  5JCO A;  3UQ8 A;  1NTM H;  2ZQM A;  4JTD B;  1ZTE A;  3JD0 A;  3AG4 C;  1KP3 A;  2YXL A;  2HEP A;  3CX5 F;  4BW9 A;  3TXQ A;  2CTP A;  3A2F A;  4MTG A;  1EM1 A;  3T1H B;  2QGN A;  4JI1 B;  4ABM A;  4NTY A;  5JJE B;  3VQV A;  1VQ9 V;  5KHI A;  3APO A;  3DGE A;  4LNU B;  2IW5 A;  1N36 O;  1PPJ H;  5LMN O;  3NXS A;  4NKG B;  3W7S A;  1QQC A;  2OCC B;  1J95 A;  2ZE5 A;  4B3R B;  4FVM A;  3GWK C;  3OEE G;  3K5M A;  5K1X A;  1FXK B;  1BCC H;  1VQ6 V;  2OCC C;  1FJG O;  2ZDI A;  1Y74 A;  4JAS A;  5LBQ A;  1XNQ O;  4RUF A;  2CAZ C;  4H33 A;  2QKA A;  1ZAU A;  2B5U A;  4JI2 O;  2GUZ A;  2EIK B;  1QVG U;  5B66 Z;  4CC6 A;  3VOU A;  3WG7 C;  3F7V C;  3D3Q A;  1KYO F;  3CD6 V;  1P7B A;  4GX1 A;  4LF9 B;  3K06 A;  3J80 N;  5L3C A;  4NTW A;  5EC1 C;  4XBF A;  3RYC A;  2RMK B;  3OW2 U;  2P06 A;  1Z5W A;  4I55 B;  1IBK O;  4LF4 O;  2IH1 C;  4DV0 O;  4DV2 B;  2WLI A;  3BAB A;  2ARH A;  3EVK A;  4LWS A;  1L1F A;  4W4K A;  1H2M A;  2ADQ B;  5IYD O;  3G67 A;  2YXY A;  1VQL V;  3T4Z A;  2Q7H A;  2JRI A;  1FPO A;  2RNB A;  3RFR A;  4JV5 O;  3RYI A;  1B3Q A;  3JCU Z;  2ZXW C;  1I94 B;  1GM8 A;  2QE7 G;  3K0D A;  2Y69 C;  4FLZ A;  3ABM C;  3UO3 A;  1N0J A;  1ZL8 A;  4IHJ B;  5L3D A;  3SR2 C;  4QNH B;  2CGO A;  3UO2 A;  2MW2 B;  1EFR G;  1W0J G;  4CH3 A;  4YIO A;  4KFM A;  3JD3 A;  2CTR A;  4ZBM A;  4Z1M G;  4WF9 V;  4O4L A;  1HR0 O;  1THZ A;  3DTU B;  1Y76 B;  4KHP B;  3D36 C;  2UXB O;  5L3F A;  3AG7 A;  1YDX A;  2YIC A;  1GMG A;  2E75 B;  2P4V A;  2Y48 A;  2RDC A;  5D5Q A;  3CCV V;  3OTO B;  4X65 B;  3CP1 A;  2E3C A;  2E76 B;  4MSW C;  5LHH A;  3CME V;  3H1I H;  4F4L A;  2XAG A;  1M56 C;  1ZLZ A;  2QKS A;  5IJ9 A;  3DC6 A;  1F4N A;  1SQP H;  1OV9 A;  4TV9 A;  3RN4 A;  3QO5 A;  1MG1 A;  3JAL B;  2GV9 A;  3JAW B;  3ZS8 C;  2XAH A;  1P7G A;  2CH7 B;  1R3L C;  2F66 C;  2EJ7 A;  2Q67 A;  4LNU A;  1R6T A;  2ATK C;  3D3I A;  4XDJ A;  1I0H A;  5GON B;  2AGA A;  4G28 B;  3TJT A;  4DW1 A;  3ZHS A;  1N34 O;  3K9S A;  3C90 A;  5CN0 A;  3DXR B;  1OCO B;  3E86 A;  1K5S A;  4PA4 A;  3W7W A;  5IYB O;  1OCZ C;  5JJN B;  1XHZ A;  1F23 A;  2Y69 B;  2LW1 A;  1W2B U;  2Q7E A;  3C3S A;  1R3J C;  5L3G A;  3ZHR A;  3G71 V;  1IXM A;  3RWR D;  4EEQ A;  1OZ0 A;  1YEW A;  1Y67 A;  4O4I A;  4N23 A;  2GTS A;  4TQF A;  1BMF G;  2XAJ A;  1WNS A;  1EN5 A;  4LF5 B;  2QSA A;  2QM4 A;  2XAS A;  5JQG A;  2B9Z A;  1Y74 B;  3HKE B;  1I5X A;  4TV8 A;  1TUB A;  1GN3 A;  2Z3Y A;  4HYO A;  3B77 A;  4J10 A;  4FFB A;  4UFZ A;  1RP3 B;  3MHH C;  3BCC H;  3KZI Z;  2GBO A;  4E2L A;  4X62 B;  1BGY H;  1ARO P;  2K1E A;  5H2F Z;  1X59 A;  3ETE A;  5F2V O;  2IJK A;  2Q4P A;  4FJC C;  4FLU A;  3FKS G;  1K33 A;  2ZE8 A;  2GHY A;  1YHQ V;  4JYA O;  3CCE V;  1WA8 B;  2GSM B;  2BE3 A;  3AK1 A;  4FPP A;  2WA4 A;  1NVP D;  1PKX A;  5KX5 A;  3ETD A;  2LGQ A;  1IXB A;  2OWO A;  1D5A A;  4GX0 A;  2YDE A;  1K34 A;  5ITZ A;  2WAM A;  2Y0P A;  2HG5 C;  4TV9 B;  1KQS U;  3RYH A;  4UCT A;  1GM9 A;  5IJ9 B;  5C93 A;  3FB8 C;  3OTO O;  1N33 B;  5D5P A;  3B2E E;  5LGT A;  4DV3 O;  5H9C A;  2EX3 A;  3AG3 C;  1AR1 B;  3ASN C;  1MSD A;  4YHH O;  3CHX A;  1VF6 C;  3IAY A;  4DV7 O;  1XNQ B;  3JAS B;  2UXC O;  1VF7 A;  1J5E B;  4MT8 A;  1R73 A;  4ZHQ B;  3BRC A;  1TA8 A;  5B1A B;  4YJ2 A;  3RVZ A;  1P4R A;  3CJH B;  2Q9L A;  4OX9 O;  3SJA C;  4LWS B;  2DQ3 A;  2OT5 A;  1WA8 A;  2V7Q G;  4X8A A;  1L8D A;  1SA0 A;  3HKC A;  4DV2 O;  2DYS C;  2JJ2 G;  3D8C A;  4GT1 A;  3U0Z A;  1FFX B;  1GRJ A;  1SZT A;  4PDM A;  3L75 H;  4CZZ A;  4QJF B;  2QM7 A;  1KC8 W;  2FB5 A;  3OUF A;  3TK1 A;  3WFV A;  1F7Y A;  5FPR A;  4MS2 A;  2PUS A;  5LYJ B;  4MVU A;  2KG7 B;  3HR0 A;  1YJW V;  2GUZ B;  1JA8 A;  1K7D A;  2HHH O;  2ZIN A;  4ZI7 A;  3VQX A;  4DV6 B;  4J9Y B;  2AZ2 A;  4K0K B;  1PD3 A;  4WFF A;  1NBM G;  4IIJ B;  1FXH A;  1Q81 W;  1TGO A;  3CCL V;  3KG2 A;  1VEW A;  4O4J A;  1R6N A;  4B7E A;  1HNZ O;  1G1X B;  5HFM A;  4LF7 O;  1SKV A;  5GTI Z;  3L73 H;  1BT8 A;  4X66 B;  3HKD B;  5B1A C;  1N36 B;  4B3S O;  5IT9 N;  1VQP V;  1VQ8 V;  2AHY A;  3GWO A;  4JI3 O;  1N32 O;  4QPK A;  4K3A A;  2ZM6 B;  2P7T C;  3KCY A;  1DF4 A;  2ILM A;  4J42 A;  4DR1 O;  1JOY A;  4LF8 B;  1Q86 W;  2WSS G;  5IYC O;  3ZMZ A;  2DWD C;  3CB2 A;  2Q73 A;  3SYO A;  3MD0 A;  3JAR B;  1SQG A;  4FLV A;  1VQ4 V;  1VQK V;  3ZIA G;  4DRX A;  1N33 O;  4FLT A;  3JSL A;  3ABU A;  1J5E O;  3G6E V;  1YIT V;  1IX9 A;  4P30 A;  3Q4H A;  5LA6 A;  1XQ8 A;  2H8P C;  1YZB A;  3E22 B;  3KKY A;  1FOU A;  4HAM A;  4O4H A;  2VRZ A;  2CGN A;  4LF4 B;  2KB1 A;  4DR7 O;  1H2S B;  5H5N A;  3MHS C;  2EIJ B;  5KLV H;  2DQ0 A;  1H2N A;  1IBM O;  4ZKI A;  2XAQ A;  2EIM B;  1NKD A;  1HW7 A;  1NH2 D;  4X1Y B;  4LF9 O;  3NR7 A;  1OCC C;  2WLM A;  2X6C A;  2KSD A;  4U3F H;  4BAY A;  3JSN A;  3T1H O;  3BHP A;  4LBE C;  3IC9 A;  1S0V A;  2OIE A;  2WA3 A;  4AIL C;  3S3W A;  3ZX6 A;  1URF A;  1JQ0 A;  4DV7 B;  2ITC C;  1SS3 A;  5IY5 B;  5LMU O;  5BR8 O;  4JZ2 A;  2CH7 A;  4WFE A;  1M57 B;  3K9A A;  3SPH A;  4EB6 A;  1SQV H;  1X4T A;  3B4S A;  4JV5 B;  1ZL8 B;  2F23 A;  4IHJ A;  2LFR A;  1MAB G;  2QTO A;  5KHK A;  2GTA A;  2IU3 A;  3DSQ A;  1QHT A;  4D7S A;  4DR2 O;  5CA0 A;  1XL6 A;  2B1G A;  1S76 D;  1GM7 A;  1PP9 H;  3OTF A;  4WBN B;  4U3J A;  1BQ0 A;  1JFF B;  3LSQ A;  4NXN O;  4ZI7 B;  1FD9 A;  2GDS A;  4HNA B;  3QF7 A;  1HDJ A;  4OGQ B;  2UUA O;  2Z5U A;  4OPH A;  1N0N A;  3ZN0 A;  1JJO A;  4J11 A;  3PJS K;  1EN4 A;  1IBM B;  5CMU A;  3ETG A;  4UB6 Z;  3CC2 V;  1A32 A;  1DK1 A;  1GTO A;  5IWA B;  1OCR B;  4JI0 O;  1RFY A;  1ROP A;  1FXK A;  5KAF Z;  5EZY B;  5IE9 A;  4P9O A;  4DV6 O;  3CRQ A;  5LGU A;  1DLB A;  1OCR C;  2ZE6 A;  1MMM A;  5GW7 A;  4JPR A;  1S72 V;  3BAA A;  4X65 O;  2AW9 A;  1XMO O;  5E1A C;  3KCX A;  3BY6 A;  2OCH A;  4NVP A;  4YJ2 B;  3OD4 A;  4J9Z B;  2JGU A;  3W7T A;  1KB9 F;  2WLL B;  3VQW A;  4LFC O;  5LMN B;  4ZOL A;  2LO1 A;  2EUL A;  1AR4 A;  4JAV A;  4LF6 O;  1COW G;  3CCM V;  1MA1 A;  3QVN A;  4QPJ A;  1N34 B;  2FL4 A;  1QR9 A;  1Q6U A;  2B1I A;  1R1B A;  2WPD G;  1IBL B;  1DGS A;  3SPI A;  3LDE A;  1FXV A;  2F93 B;  4O2B A;  4JI4 B;  5KHH A;  1GO3 F;  3OAA G;  4K0K O;  4DV4 B;  4FM2 A;  1TAE A;  4UVB A;  5LHG A;  2WLH A;  3JD4 A;  4DYL A;  3ZHU A;  1WLE A;  4R8C A;  5LMU B;  2VWK A;  4X64 B;  4JGS A;  3ASN B;  1FFX A;  3CRC A;  2IM9 A;  1NH2 B;  4JI6 B;  1MNG A;  1NR1 A;  3B40 A;  1GH6 A;  4JI4 O;  3M8A A;  4QE9 A;  4I9Q A;  5JJJ B;  1XL4 A;  2QWQ B;  2P5O A;  2ZKO A;  3LSS A;  3K5N A;  4X1K A;  5KUK A;  1AI4 A;  5EBL C;  4B3M O;  2JGD B;  4LP8 A;  4KP4 A;  4MVQ A;  1M5I A;  1HNX O;  4UCU A;  3BVO A;  4DUY B;  1QLN A;  4GKK B;  4W4L A;  2MK3 A;  3U11 A;  5L3B A;  1Q8I A;  4BIZ A;  1BZK A;  1W0K G;  4FM0 A;  3IGA C;  4FK5 C;  1VF5 B;  4PI2 A;  3X2Q C;  4NXN B;  1WP7 A;  4LF7 B;  1Q90 D;  1SQB H;  2EBO A;  3T1Y B;  1U97 A;  1P84 F;  3A8T A;  4OX9 B;  1H2K A;  1ORQ C;  3OMN B;  4IT5 A;  5LGN A;  1AI6 A;  2KQX A;  4KL1 A;  2PI4 A;  2WLN A;  3U10 A;  5IWA O;  3CJH A;  5KHG A;  2UUB B;  2HKO A;  1V55 C;  3J81 N;  2A7W A;  3UT5 B;  1WB7 A;  2W6I G;  2ETN A;  4MVO A;  4U7O A;  1CP9 A;  4MVS A;  4P9P A;  2F4V O;  1V55 B;  4FMT A;  3N2G A;  2BTQ B;  2C2A A;  5EC2 C;  5C8Y A;  4FM1 A;  3S3X A;  5K1P A;  2DYR B;  2Q6A A;  2R9A A;  1NS1 A;  1Q5O A;  5FNV A;  5B1N A;  2IJH A;  4U3J B;  1GN4 A;  2CE4 A;  1VF6 A;  5LP6 B;  1YJN V;  3CCS V;  2UU9 O;  3R65 A;  5JCO C;  2QWP B;  1QLE B;  2F43 G;  5JWP A;  2P90 A;  3OM3 B;  1K97 A;  1XBL A;  1R6K A;  2LP7 A;  3A0H Z;  2ZCE A;  4F6E A;  3B8N A;  2BTO A;  4WFA V;  5BR8 B;  5BZB A;  1QBZ A;  5DM6 V;  1AIL A;  4P2Z A;  1G4Y B;  4LFA B;  4O4J B;  1U96 A;  3A0B Z;  3JAK A;  3N2K A;  1KEC A;  1M9N A;  4CS2 A;  4K35 A;  1XI1 A;  2JS5 A;  2PI5 A;  1RSO B;  2V4D A;  3H01 A;  3K03 A;  3CYO A;  4WFG A;  1SQX H;  3WB2 A;  1XDC A;  2ZR2 A;  2YS8 A;  1HR0 B;  4JI8 B;  3OR7 C;  1WPX A;  5IJ0 A;  1K3E A;  2R72 A;  2Q7G A;  1T5E A;  5J2U A;  1RPR A;  4Q6G A;  2BSK A;  2Q68 A;  2EIL C;  1M90 W;  3CC4 V;  4WBN A;  5LP6 A;  3G4S V;  2M6Y A;  3F5W C;  3AEI A;  1KU9 A;  3M99 B;  3STZ C;  5DED A;  4DUZ O;  2DYR C;  2NNU A;  3O65 A;  5LL6 Y;  2G38 A;  4GKK O;  5BMV B;  4FLY A;  5LP6 C;  2E5L B;  1D2D A;  1MZF A;  2HVJ C;  4DR3 B;  4O2A A;  1GN2 A;  4CH4 A;  3AG1 B;  3HKE A;  3UCS C;  5CB4 A;  2YIA A;  5KMG B;  1AI7 A;  4X1I A;  3ABL B;  5B1B B;  3UT5 A;  4GUN A;  1NR7 A;  3Q4H B;  4DV4 O;  3DXR A;  3CXC U;  3JYC A;  4O4L B;  1S5L Z;  3K5L A;  1VAR A;  1VP7 A;  3W7X A;  4TUY A;  4AHC A;  1YXB A;  5A2Q N;  3JAT A;  3ZJZ A;  3CCJ V;  1JVM A;  2ADP A;  4DV1 B;  3H1L H;  4UVA A;  3J7A U;  1EZJ A;  1H5W A;  1LNQ A;  2FML A;  2YI9 A;  5DN6 G;  4X20 B;  2WLJ A;  3JAW A;  4JI5 O;  3RYF B;  3N2K B;  1H2G A;  3ZMT A;  2LJ2 A;  2N04 A;  4YJ3 B;  5FPO A;  4DV5 B;  3E83 A;  5GON A;  3RT3 C;  2W6J G;  4R7C A;  1BSM A;  1BE3 H;  3OE7 G;  1VQ7 V;  2ZM6 O;  2YC0 A;  5BY1 A;  1CXZ B;  4JI6 O;  4K8Z A;  2YSU B;  1Y4M A;  3OEH G;  4RO2 A;  2F95 B;  3AG1 C;  3CMA V;  2ZT9 B;  3H1H H;  5L3E A;  2HHH B;  4GYC B;  3TGU H;  3CSX A;  1HNZ B;  3THO A;  3CPW U;  3C3T A;  1TUB B;  4LR3 A;  4EB6 B;  4K8X A;  4GX2 A;  2XHB A;  2H3O A;  4JZG A;  2PTM A;  3ABL C;  5B1B C;  1XIL A;  5KHJ A;  3FX7 A;  2Y0I A;  1Y6X A;  2X0L A;  4H13 B;  3CCR V;  1RSO A;  3CWB H;  4J7Z A;  2P67 A;  4HZ3 A;  4JI8 O;  3E8H A;  3WB1 A;  5JH7 B;  1LR1 A;  4G2K A;  3H1J H;  1V54 C;  2OTL V;  1PNK A;  3JAM N;  5KMG A;  2NN4 A;  5J9P C;  1EZV H;  2FKX A;  5H6Q A;  3W7U A;  2DW4 A;  2ZDI C;  3H9V A;  1DF5 A;  1PNL A;  1SER A;  2ZR3 A;  2AXT Z;  3OGI B;  3RYC B;  5IDJ A;  4IL6 Z;  4C7U A;  1KMI Z;  2UXD O;  3B09 A;  5JH7 A;  1XEQ A;  3CC7 V;  2A79 B;  1KP2 A;  3BEH A;  3E22 A;  3E8G A;  4TT3 G;  5B3S B;  4CC5 A;  2ZE7 A;  2Z0A A;  3UKM A;  2DJV A;  2YEV A;  4PA7 A;  3VQY A;  3TCU A;  4X89 A;  2Y4T A;  4YJ3 A;  4FZ1 A;  2LW7 A;  2UXD B;  2EZP A;  4DR1 B;  3EFF K;  5CA1 B;  3HKB A;  3BA9 A;  3QO7 A;  3RGB A;  4X20 A;  3HKB B;  1FXK C;  4MVR A;  1N8R W;  3JAK B;  3ETQ A;  4LFC B;  2RQ6 A;  2VQE B;  1S3J A;  2XT9 A;  3SYQ A;  2X6A A;  4O2B B;  1V9P A;  1IVS A;  1IZ3 A;  4DO2 A;  4YY3 O;  4X62 O;  4O4H B;  3WB0 A;  3X2Q B;  1M56 B;  2EJR A;  1GKF A;  5IYZ A;  4I4T B;  2RCV A;  2QEX V;  4H37 A;  3T1C A;  2ZNJ A;  4DRX B;  1HWY A;  4I50 B;  2PGG A;  2A06 H;  1CPY A;  3SDL A;  3FFQ A;  4NR1 A;  2YXH A;  2X7R B;  3JD2 A;  3ZBH A;  2RN9 A;  3RYF A;  1P49 A;  2JS3 A;  2E74 B;  3F7Y C;  2NR5 A;  3WU2 Z;  1US6 A;  2HLD G;  3APQ A;  4DR4 B;  2JEU A;  1SQF A;  3FB7 C;  2JDI G;  5J2T A;  1OCZ B;  2YIB A;  2QKC A;  2BOC C;  3CEI A;  1NI8 A;  3ZN1 A;  2PY5 A;  5LHI A;  3K79 A;  1QNM A;  3LDD A;  3KDR A;  3SJQ C;  3FD9 A;  2Q8V A;  1WB8 A;  2D2C B;  4X1I B;  3ZHT A;  2A9H A;  3G6B A;  3K04 A;  2VQF B;  1Y66 A;  3E8F A;  1H38 A;  2A0L A;  1AR5 A;  3OUS A;  4F6R A;  4DUY O;  3CE2 A;  1VMG A;  1S5H C;  5B1O A;  3OT7 A;  2PF4 E;  1K8A W;  4YIP A;  1QCE A;  1UFI A;  3OGC C;  4J80 A;  3K08 A;  4UB8 Z;  3F5T A;  2EIN B;  1JMK C;  2YUA A;  4TSF G;  3ZCC A;  4CS3 A;  3ZMS A;  1YTF B;  1W59 A;  5J2U B;  2JGD A;  3LDC A;  5IY5 C;  2WWW A;  3O9O A;  2LQT A;  4JAU A;  4OPA A;  3T1Y O;  5LXT A;  2O57 A;  2CK3 G;  4XDK A;  1SC5 B;  2BCC H;  2YIB D;  4MW3 A;  4B3R O;  4PA6 A;  1S5J A;  3LSU A;  3AG2 C;  1DTO A;  2ZXW B;  4LC1 A;  3K58 A;  1E79 G;  1IDS A;  4DV0 B;  5KAI Z;  4IYH A;  2FYU H;  3CS5 A;  3DC5 A;  4TOI A;  3IJ4 A;  4B08 A;  5KX5 B;  1RM1 C;  3SYC A;  1IUR A;  3TET A;  1M1K W;  1SF9 A;  3IC7 A;  3D36 A;  2VQE O;  2HVK C;  5A9G A;  2OIG A;  3SYA A;  4KXR A;  3HPL C;  1VQM V;  1MZE A;  2QA4 V;  4JTC B;  1VQ5 V;  1YSC A;  3GVM A;  4DV3 B;  2EIN C;  4GCZ A;  4IYI A;  4LF5 O;  5KUM A;  4JAA A;  4B3T O;  5GTH Z;  3P3P A;  1PNM A;  4TUY B;  1ZX3 A;  1PV0 A;  1JR9 A;  5H6R A;  3H1K H;  4I50 A;  5ITZ B;  1SQQ H;  4I4T A;  5JVD A;  2BSK B;  5CBH A;  1LUV A;  4JF3 A;  1Y76 A;  1MOF A;  4PV1 B;  1GN6 A;  4B3T B;  3HKD A;  1TUE B;  4UXN A;  1OCC B;  4FFK A;  1V54 B;  2L6L A;  3N2G B;  4FIP C;  3L70 H;  4U7N A;  4ASU G;  4I55 A;  3RYH B;  5EZY A;  5E79 Z;  1LUW A;  1BL8 A;  4CH5 A;  4UV9 A;  2WLK A;  3R66 A;  1VIB A;  5EBM C;  3A0R A;  1KBH A;  1K92 A;  2DYS B;  4WFB V;  3OR6 C;  2HP8 A;  4NXM B;  3FAV A;  1JPX A;  4MVZ A;  1CEZ A;  1G8M A;  4J7J A;  2LFS A;  4N21 A;  2ODM A;  2W0F C;  2UXC B;  3ASO C;  1NJI W;  1NZ6 A;  4CS4 A;  3JCZ A;  2JK5 C;  1Q6I A;  1BQZ A;  1FJG B;  2N74 A;  3SJC C;  4MW8 A;  1L0N H;  1K4C C;  1K9M W;  3ZRW B;  1Q3E A;  3ABM B;  4O4I B;  2A3Q A;  1FAF A;  3ICX A;  4PI0 A;  4J7K A;  2HR3 A;  1NT2 B;  1PM9 A;  2RJZ A;  4FFB B;  4ICG A;  3UM7 A;  4QIW F;  1QVF U;  2WLL A;  4TV8 B;  4IIJ A;  4UCO A;  3CRM A;  1TVK A;  4FLX A;  3JD1 A;  4GKJ B;  2UUC B;  2EIM C;  2Q69 A;  5LA6 B;  3B8M A;  3SPC A;  2Y4U A;  3FYI B;  3ABK B;  4DR7 B;  1SZX A;  3FB6 C;  5IJ0 B;  5KA6 A;  4CBC A;  3ZMU A;  1XUQ A;  4DR6 O;  1ENV A;  3L72 H;  4DV1 O;  4UUJ C;  1FFT B;  1HNW O;  4RQF A;  1O9G A;  3ZHV A;  1YCI A;  2UUB O;  3QG5 A;  1AJN A;  4I0X B;  2CTW A;  3ML0 A;  4A5U B;  1YIJ V;  1N4C A;  2IH3 C;  2CTQ A;  2XOK G;  3OFN G;  5LOV B;  4LH6 A;  1VQO V;  1HNW B;  3SPJ A;  2QWO B;  4GZR B;  5CA3 A;  5JVD B;  4BIO A;  2AZ0 A;  2Q5Z A;  3LNN A;  4NYK A;  1HNX B;  2F1M A;  1UJW B;  3BA8 A;  2OYQ A;  5LOV A;  1PL4 A;  3AK2 A;  3K0G A;  1BS3 A;  4X88 A;  2IU0 A;  4PHZ A;  4TQD A;  3JAR A;  4LF8 O;  1KD1 W;  4Q20 A;  4UVC A;  3AG3 B;  2PZS A;  5JQG B;  4IGG A;  5CA1 A;  5EBW C;  4J41 A;  4PJ0 Z;  3EHB B;  4DR4 O;  1WN7 A;  3OMI B;  2DOS A;  2HFE C;  5EIB D;  2XTA A;  4HNA A;  3I55 V;  1WAZ A;  2X6B A;  3ZRS A;  3QTC A;  3CXH F;  5CBG A;  5EYP A;  3JAL A;  1HP8 A;  2ZIM A; 
#chains in the Genus database with same CATH homology
 1SZX A;  1I0H A;  1XUQ A;  1VAR A;  3EVK A;  4E4E A;  3TJT A;  2QKC A;  1JR9 A;  3CEI A;  1MSD A;  3K9S A;  1ZTE A;  1QNM A;  3KDR A;  2ADQ B;  1EN6 A;  2ADP A;  4C7U A;  1KKC A;  1GN4 A;  2CE4 A;  1WB8 A;  1AP5 A;  1LUV A;  1EM1 A;  1AR5 A;  1MNG A;  1GN6 A;  3C3S A;  2GDS A;  3OT7 A;  4F6E A;  4YIP A;  4FFK A;  4JYY A;  1N0N A;  1Y67 A;  1BSM A;  4BR6 A;  1IX9 A;  1LUW A;  1N0J A;  1EN4 A;  1EN5 A;  3KKY A;  1GN3 A;  3AK3 A;  3BFR A;  4YIO A;  1ZSP A;  1XDC A;  1PL4 A;  2P4K A;  2CDY A;  1JA8 A;  3AK2 A;  1MMM A;  1BS3 A;  2AW9 A;  3MDS A;  3C3T A;  1XRE A;  3LSU A;  1D5N A;  1IDS A;  4X9Q A;  1B06 A;  3DC5 A;  3IC9 A;  2QKA A;  1AP6 A;  2RCV A;  1VEW A;  1ZUQ A;  1AVM A;  1I08 A;  4JZG A;  1XIL A;  1AR4 A;  1ZLZ A;  1BT8 A;  3AK1 A;  1PM9 A;  3DC6 A;  1MA1 A;  3QVN A;  1GN2 A;  5A9G A;  3RN4 A;  5AG2 A;  1WB7 A;  4JZ2 A;  1P7G A;  1IXB A;  4GUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...