1AP6A

Tyr34->phe mutant of human mitochondrial manganese superoxide dismutase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal structure of Y34F mutant human mitochondrial manganese superoxide dismutase and the functional role of tyrosine 34.
pubmed doi rcsb
total genus 74
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ap6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ap6A02
2CDYA 1N0JA 1B06A 4FFKA 1GN4A 1Y67A 3EVKA 3TJTA 4F6EA 1XREA 1AR4A 2GDSA 1IDSA 3C3SA 1MNGA 1LUVA 1BT8A 1IXBA 1QNMA 3DC6A 1JR9A 3LSUA 2ADQB 4JYYA 2ADPA 1EN5A 2P4KA 4GUNA 3AK3A 1MA1A 1XDCA 1VEWA 4YIPA 1XILA 4C7UA 5A9GA 1D5NA 2QKCA 4E4EA 1VARA 1ZTEA 3AK2A 1I0HA 1LUWA 1MSDA 1MMMA 4JZGA 1IX9A 1PL4A 4X9QA 3QVNA 1AP5A 3OT7A 3AK1A 1GN2A 1AR5A 1XUQA 2AW9A 3KKYA 1EN4A 2QKAA 1N0NA 1BS3A 4YIOA 1ZSPA 1P7GA 1AP6A 1ZUQA 1PM9A 3DC5A 3BFRA 1EM1A 1GN6A 1ZLZA 3K9SA 1WB8A 1SZXA 1WB7A 4BR6A 3IC9A 3C3TA 1EN6A 2RCVA 3MDSA 4JZ2A 5AG2A 1JA8A 2CE4A 3CEIA 1BSMA 1I08A 1GN3A 1AVMA 1KKCA 3RN4A
chains in the Genus database with same CATH superfamily
5JH7B 1SESA 2OIEA 2HR3A 4G27B 1GN4A 4JI2O 5KAFZ 2PTMA 2UUBO 2QM7A 4FZ1A 1U97A 4D7TA 2AZ2A 2QR4A 3ABLB 2W0FC 3TGUH 4FLTA 4XDLA 3JAKA 4YJ3B 5EBMC 2OCHA 3ZIAG 3N27A 3SYQA 2F93B 4PDRA 3E2EA 1Q7YW 2X6BA 4JYYA 3ZMVA 2DW4A 3ZHSA 5HFMA 3OTOO 1QLEB 1OCZC 5EIBD 3L70H 4H0LB 1I94O 1M56B 1R6TA 1S5JA 2BCCH 1PPJH 1KQSU 1VQNV 5GTHZ 1I0HA 4TWKA 5IYZB 2KKWA 4QPKA 1NVPD 1SS3A 1PNLA 2HVJC 4UVCA 1JPXA 4JI8O 4K8XA 4J9YB 3SPGA 3H1HH 4LFCB 4ICGA 4K8ZA 1JVMA 2F66C 1H5WA 5KX5A 2R70A 3T1YO 2ZKOA 3CCJV 1FD9A 5LGNA 3VQXA 5LHHA 3I5DA 4L8JA 4UB8Z 4ZOLA 4K3AA 2ZXWB 1NZ6A 5JJNB 3K08A 5H5NA 4J10A 1QLEC 4X1KA 4P9PA 4Z1VA 1SRYA 4QGPA 4I55B 3FYEB 2WA4A 1V54C 2IU0A 3JD3A 2Y69B 4CS3A 1SZTA 1IBKB 1VF6A 5B66Z 3LNMB 3CSXA 1JA8A 4I0XB 3ABKC 1HNZB 2JEXA 3GWOA 1NKDA 4OXSA 4DV1O 3F5TA 4CBCA 2CAZC 1FYJA 4FLWA 1BHAA 5LHGA 1I94B 4FM1A 5CA0A 3RVYA 2AZ0A 2JGDB 5KA6A 4DXWA 4EFBA 3JASA 4LFCO 3C3SA 1MNGA 1QR9A 4JASA 3ZS8C 1MG1A 3DC6A 1K4DC 1GH6A 2HEPA 5IJ9A 4YHHB 2JK5C 1EN5A 3SYAA 4LFAO 1CP9A 3SPCA 4X62O 1YITV 4JI7O 1XNQB 1AJQA 2VS0A 3OE7G 4P2ZA 3HB3B 2UUBB 2EINC 1S77D 4UUJC 3E8BA 1JFFB 1WPXA 2Z0AA 4MW3A 4HYOA 5IYDO 5LMNB 4B3SB 4LFBO 3AK1A 4O4HA 3KDRA 2EIKB 1XMOB 3CRQA 1FS0G 1VQMV 1RM1B 4ZBMA 4JI2B 3KZIZ 3E83A 3LSSA 2R9RB 2CH7A 3FB8C 4JI4O 4GX1A 5GW7A 5E79Z 5B1AC 4LF8O 2XNDG 1KP3A 4O2BB 2BTOA 4BR6A 3AG4C 4U7OA 5CA3A 1IURA 2A3QA 3BY6A 1JFFA 2EJRA 5B1BB 5EZYA 2UXNA 1T5EA 1SKVA 1SQGA 1VQ9V 2CDYA 1W0JG 2EIMC 1BE3H 2EILB 1WNSA 3BPZA 5LXTA 1FKAO 3WG7C 4DUZB 1V9PA 2G38A 2HJFC 2Q68A 3E8GA 3D3QA 2ATKC 4H44B 2AHZA 4B7EA 4J9ZB 2GV9A 1WAZA 4CZZA 3ASOB 1XNQO 1U96A 4TT3G 1MA1A 4FLXA 1Q5OA 3OGCC 1NTZH 4PA6A 2VWKA 2ARHA 3CS5A 4DR2B 4TOIA 3APQA 4YHHO 1ZTEA 1IBMB 5FPRA 1OCRB 3CB2A 1B6QA 3JAWB 3ZHUA 1PL4A 3APOA 4DW1A 1YVWA 4JI7B 4I4TB 2YDEA 1K9MW 2M7WA 2BSKA 1Q6IA 1UPGA 2CTRA 2CTPA 1K97A 3RYFB 3VOUA 4IHJA 3N2GA 4LF9O 3ZHQA 4GKKB 2YIAA 4MVUA 1H2KA 4X20A 3G6BA 4PA9A 1ENVA 2PI5A 4ZOLB 2Q73A 1R3JC 1CXZB 3CC7V 2PY5A 3K9AA 2UXCB 2RN9A 5K1XA 2KQXA 3VQVA 5CA1B 2DYRB 1Q90D 5CBGA 1YJ9V 1SA0B 1NVPB 4B3TB 4MTFA 5AG2A 2EULA 4JI6B 5KHJA 3LSQA 1E79G 2WLLB 2HKOA 4NXMO 4ABMA 1KKCA 5LA6B 1XHZA 5KUMA 4O2AB 2WLLA 1P4RA 4DR5O 1SQPH 1UFIA 4JI0B 4KP4A 1PD3A 4F6EA 2ZM6B 1R6NA 4CC5A 3SJCC 3B09A 1X59A 1KUQA 3QO8A 1NH2D 1AJNA 1IXBA 2WLJA 4N21A 4WFHA 4QE9A 3VQWA 4BWAA 2XT9A 3ZBHA 4NTWA 1Q82W 2B1GA 2WLKA 3FKSG 1VQOV 2N05A 1KP2A 1VMGA 3DXRA 4DV7B 1N8RW 2E74B 2IH3C 3ICXA 3OEEG 1BZKA 3RWRD 2UXCO 4DUYO 4FPPA 1Z5VA 2W6JG 1JQ0A 5J2TA 1GN2A 3BEHA 4YY3O 1IBLO 1AR1B 3N2KB 3O9OA 5DN6G 2ZR3A 3RW0A 4NR1A 4X8AA 1PM9A 4B3SO 3DC5A 2MW2B 2E76B 1GM9A 4WFEA 2F23A 1SQBH 2UUCO 3IFXA 1Z2GA 2GTAA 3F7VC 3P32A 3FB5C 1YEWA 2QJ1A 4LWSB 1S3JA 4DR3B 1RFYA 2WSSG 2HVKC 4R7CA 3CMAV 1M57B 4DR4O 3G4SV 3CCVV 3JSNA 5LHIA 2QWOB 2W0XA 1K8AW 2P4VA 2WAMA 2F4VB 1TGOA 1BL8A 2CGNA 3AG1C 1I5XA 1PKXA 3OMAB 4MTGA 1VQ5V 1QVFU 4WFAV 4DR6B 3OUSA 4YJ2A 1ZL8A 5D5QA 3RYIA 1XNRO 5EBLC 2LGWA 2E75B 3CD6V 4KL1A 2ADQB 1FAFA 3HPLC 3SJQC 2YXLA 4XDKA 1TA8A 4YIPA 3BRCA 2YUAA 2ZE8A 4O4HB 4E4EA 1VARA 3UCSC 4JAVA 4P9OA 5KMGB 4B3MO 1SQFA 5J2UB 4MVZA 1OCZB 2QWRB 1OHHG 2QM8A 3RYHB 5B1BC 3CYOA 3FFQA 4QIWF 1DGSA 2Q8VA 1PV0A 1P7BA 4RUEA 1TAEA 2ODMA 4AQYB 4O4LA 4NYKA 3D3IA 2N04A 3B77A 4JI1O 5JJEB 3H1KH 4PELA 2X7RB 3BFRA 4FLYA 1TUBA 1XMOO 2E3CA 5KMGA 2WA3A 3OM3B 2DE0X 3RFRA 5IYCO 1ZX3A 4PHZA 4QE7A 1P84F 3FYIB 4U3JA 4IL6Z 3AG3C 1FXHA 4NTXA 2CE4A 4DV0O 3OUFA 4GYCB 4KFMA 1JMKC 3W7XA 3QTCA 1H38A 1WP8A 3CRRA 2P90A 1M4UA 2HHHO 3IC7A 2BOBC 2GUZB 2WWWA 2EJ7A 3TXQA 2Y0IA 1F51A 2ZIMA 3FB6C 1B04A 5LA6A 1ZWIC 1AROP 1RM1C 2KG7A 2H3OA 4X1KB 4O4IA 2Z5UA 4TQDA 4MTOA 1YF2A 4H37A 1KC8W 1MZEA 1Y66A 1OZ0A 1XDCA 5L3DA 1XILA 4DV2B 1VQ6V 4LWSA 4NTYA 2ZIOA 5IDJA 1GAXA 3AG4B 1M9NA 1GM7A 1LUWA 4JI1B 1QLNA 4UVBA 1Q3EA 1R3LC 5IE9A 5DEDA 3N2GB 3OR6C 4IHJB 2YC0A 4WF9V 3HKCB 3N2KA 4UB6Z 3UKMA 3CCUV 3B4SA 2BSKB 4DV7O 4J7JA 1N0NA 4RAIA 1YDXA 3OFNG 3S3WA 2ZM6O 2P6JA 3JAWA 1R3IC 5LYJB 4R50A 1KYOF 2UXBB 5KHIA 4F6RA 4JGSA 3JAKB 3RYCB 3EHBB 5FL7G 1R6KA 3T1HO 2Q7HA 3HKEB 3KCYA 3C90A 1R1BA 4GLXA 3EFFK 1FJGB 3HKDB 1BSMA 3SJAC 4DRXB 4PD4F 5ITZB 2YI9A 5B3SC 1BQ0A 2Q7GA 3I55V 3Q4HA 2OCCB 3ZCCA 3E22A 2Q7EA 3H9VA 2XAGA 2F4VO 4E2LA 4DRXA 2QE7G 5KLVH 3ZMTA 1E1RG 5FPOA 2IW5A 1YI2V 5CN0A 4G2KA 2P4KA 2QWQB 5K1PA 3AEIA 2LP7A 1SQVH 5GONA 2ETNA 3VBBA 1VQPV 2VWJA 3CPWU 1WLEA 1NS1A 1X4TA 2YXYA 4J7KA 1JJ2U 5CA1A 5GTIZ 2VRZA 1O9GA 3UO3A 4LR3A 4GX5A 4DUZO 1MZFA 5FNVA 2ITDC 4JV5B 2CH7B 2XAFA 4JZGA 5EC1C 4JF3A 3QVNA 1OCRC 4X20B 4NKGB 5B1NA 1Y4MA 2FB5A 5JCOA 2JS3A 3JARB 1AR5A 2WLMA 5HFLA 1XUQA 3TETA 4K0KO 1K5QA 3RBZA 1PL0A 3G71V 5KUKA 3RYFA 2EIJC 4B08A 3UQ8A 3HKBA 4MTXA 4PDMA 2ZQMA 1AI6A 1CEZA 3FAVA 3K5MA 3ZRWA 1AI5A 4X88A 3J81N 5EYPA 4EEQA 1YSCA 1US6A 1V55B 5DECA 3E86A 3K57A 3CRCA 2UXDB 4JTAB 5CB4A 2RQ6A 1EN6A 4UCVA 3ZMUA 1G1XB 3BHPA 1IBKO 2YEVB 4Q20A 2DN9A 4X66O 4UCSA 1OV9A 2KG7B 4UCOA 1M56C 2WLHA 4DV2O 2XTAA 3JCUZ 1QHTA 2XASA 1HNXO 1M90W 1IVSA 1GN3A 2L35A 2HLDG 3OTFA 1XOUA 2EBOA 3JALA 4Q6GA 1L0NH 1F23A 3JSLA 1N36O 2IM9A 4FFKA 3CCLV 5EIBC 1KU9A 2HFEC 2HJDA 5LBQA 4FJCC 3B2EE 5LXTB 3K04A 2L6LA 3JYCA 3K59A 4OPAA 3WG7B 1DTOA 3P30A 3ZEDA 4OX9B 5ITZA 3H1LH 4X62B 2PZSA 3L74H 4BAYA 4X1YB 2CGOA 4PA3A 3ETQA 1J95A 4DV6O 3SPIA 4OPHA 2GTSA 1IXMA 3H01A 2OT5A 1YTFD 2BE3A 1S72V 5H6RA 3RYCA 2JDIG 4WBNA 3QG5A 2Z3YA 3CWBH 4RQFA 2NNUA 1MMMA 4FZ0A 1XEQA 5LYJA 3W7WA 2ITCC 2KB1A 4DW0A 4LNUB 3T2MA 5BZBA 2A79B 2Q69A 2P67A 4ZI7B 4RQEA 1BGYH 4LF6O 1KBHA 1XMQB 3ASNC 2ZE7A 1ROPA 3ABKB 3CXHF 1N32O 1I7FA 2ZE6A 3M8AA 4IGGA 2WLIB 4GCZA 4PV1B 4TV8B 5CBHA 2QA4V 2A06H 3H1JH 4NXNO 2YICA 2F1MA 5IJ0A 2BOCC 2JRIA 1FJGO 2Q5ZA 2QWPB 3GVMA 3P3NA 2YIBA 4GKJO 2DQ0A 1NH2B 2LFSA 4EFEA 1LNQA 3ABMB 3JD1A 4ZI7A 1KECA 4JPRA 4RUFA 4MVMA 4LF5O 4LNUA 3MDSA 1K7DA 3B8MA 3SR2C 4AHCA 3M7MX 2UXDO 2UXBO 1WN7A 1I08A 1THZA 3ETDA 3AG7A 5B1AB 4LF7B 2IJIA 5BMVB 1H2SB 1FXKC 1OCCC 5L3GA 1P49A 4IYHA 1QR8A 3ABTA 1JX9A 2WLNA 1F4NA 1Y67A 3THOA 4JTCB 2QTSA 4XDJA 2B1IA 1Q86W 2AXTZ 2B5UA 2YIDA 4CH4A 4MS2A 4H13B 3K5NA 1WA8A 4EKWA 1Y6XA 2K9PA 3ZN0A 3CX5F 2XAQA 4DR7B 2DWDC 3OTOB 2IU3A 3JAMN 5IT9N 5LMUO 3CCMV 1FFTB 2R9AA 1KB9F 4U7NA 3ZMZA 4PA7A 4UCUA 4H33A 5L3EA 1ZAUA 3KG2A 5EC2C 1JNBA 4FLVA 1S76D 4X64B 1HW7A 5KHKA 1OCOB 5CB4B 3ZMSA 4O4LB 5LGTA 5J2TB 4J41A 3G67A 3SDLA 5KX5B 4LF4B 2PYJA 1TUEB 1P7GA 3ZRWB 3BCCH 5CBFA 4UCRA 2YSUB 1HDJA 1E1QG 1FFXB 2ZNIA 2VQFO 4PI2A 3JARA 3QF7A 1SETA 2QKSA 1K5SA 3QO7A 4QJFB 3SYPA 2CTQA 1H8EG 2CUGA 4DR1B 4U3FH 2Q9LA 5FNVB 2QWNB 2ZR2A 2D3OW 4WCEV 4MVSA 2R72A 4JI5B 1LR1A 4CH6A 1L1FA 3ZHTA 1BQZA 2NR5A 2YXHA 3EVKA 2Q67A 2VQEO 5TISZ 1AR4A 1FOUA 4O2AA 4DO2A 1FFXA 3K3WA 1M5IA 3DGEA 3CC4V 2OYQA 2R9IA 1KD1W 2A0LA 1XI1A 2A9HA 2IJHA 1YIJV 3VQYA 1N33B 5LMUB 1VEWA 4JI8B 3K5LA 3ML0A 2WPDG 2HG5C 3ASNB 3UM7A 1NTKH 1Q6UA 4ZHQB 1O9HA 3M99B 3A8TA 3A2FA 4B3TO 4J7ZA 4DV5B 3E8HA 1MSDA 3R65A 1IX9A 1NR7A 2JEUA 3IGAC 1NU1H 4WFFA 1KMIZ 3HKEA 2DYRC 1VQ7V 2Y69C 3KKYA 5F2VO 1V54B 4IT5A 4I4TA 2QKAA 5IY5B 4F6RB 3AG3B 4LF5B 5H2FZ 1NBMG 4YIOA 2RMKB 4PI0A 4LF9B 1RSOB 4HZ3A 1HWYA 2DQ3A 4PDLA 1RSOA 3UO2A 1FXKB 1GMGA 2PI4A 1WA8B 2PGGA 2Q6AA 3K0GA 4DV3O 4FK5C 3K9SA 4LF6B 1GRJA 5KA5A 1SZXA 3CRAA 3T1CA 5C8YA 4B7KA 1TVKA 3OMNB 4F4LA 4UV8A 2YIBD 2OTLV 1PP9H 2V4DA 3CRMA 3L73H 4TQFA 2H8PC 2D2CB 2AGAA 1SC5B 4UCTA 4DV4O 3B40A 5EK0A 1B06A 1JJOA 3F7YC 3RVZA 4DR4B 1XMQO 3FB7C 1YJNV 2F95B 5IY5C 3GWKC 4X1IA 1M93A 4R6ZA 1LUVA 2Q4PA 1NJIW 3CCSV 2QDOA 4CS2A 1QNMA 2EINB 4P30A 3LSUA 4FIPC 5FLXN 3SYOA 3SPJA 2XUMA 5IJ0B 2OIGA 1HNXB 4OX9O 4UFZA 3K0DA 4TV8A 1QU7A 4DK1A 3J80N 1GTOA 1QVGU 4DV0B 2IJKA 2QEXV 4TSFG 4KHPO 4HNAB 4FM0A 2GSMB 4AI8A 1MSWD 1XL4A 4LCUC 1G8MA 3BABA 4GX2A 3U11A 1OCOC 1SQXH 3AK2A 5B1OA 1G4YB 4KXRA 3CCEV 4DV5O 2XAJA 1DK1A 2PUSA 3FX7A 3CCQV 4FLUA 3W7TA 3ETEA 4JYAB 3OAAG 1D5AA 1EN4A 1K34A 3L75H 4WFBV 4BW5A 4K0KB 3WB2A 1N33O 1TUBB 1XL6A 4JI3B 4CH5A 1ZUQA 1HP8A 2FYUH 2AHYA 1GN6A 4B3MB 3AG2B 2EIMB 3STLC 2JJ2G 1URFA 2UXXA 5JJJB 5JQGA 2RJZA 4I9QA 4JYCA 3RYHA 3IC9A 1QCEA 2KSDA 2VQFB 3A0BZ 4JAUA 4NXNB 4MVOA 1DF5A 5IJ9B 4D6TH 5BR8B 1N32B 4DR6O 2IBZH 2ZXWC 3BAAA 1A32A 2QSAA 5IWAO 2UUCB 1AILA 2JGDA 2VQEB 3WB0A 5H6QA 5LMNO 4L87A 4A5UB 1DF4A 2P5OA 4KUMA 5JQGB 1IDSA 1K92A 4JI5O 2QM4A 1HR0B 2EX3A 2V1DA 3D8CA 2EZPA 3E8FA 3JCZA 3W7UA 3A0HZ 3FAVB 2ADPA 3D36A 4W4LA 4X64O 2Y48A 5LP6B 4K35A 2A7WA 2Q0AA 4C7UA 4IIJA 5BMVA 1ORQC 4DV3B 3ABLC 5BXZA 4LBEC 2DWEC 4X9QA 2ZDIA 4MVQA 4JYAO 3FD9A 3E35A 3JD4A 1H2MA 1V55C 1XBLA 1AI4A 1PNMA 2V7QG 3CJHB 1YZBA 3SYCA 3E89A 1IBLB 1IJGA 1EZJA 4RO2A 4NB5A 1AP6A 3CP1A 1H2LA 3K06A 4CC6A 3R66A 1J5EO 1SQQH 4DR5B 2WLIA 1N36B 4CS4A 4AILC 1ZLZA 4I5SA 3ETGA 1VQ4V 1S5LZ 2JGUA 1WB8A 4LC1A 1H8HG 1WJZA 1MOFA 2ZNJA 3IJ4A 4QNHB 1DLBA 5LP6C 3CHXA 4RWUA 3SPHA 3ABMC 1JOYA 1AVMA 4JI4B 3T4DA 4W4KA 2XHBA 3OMIB 5D5PA 1Q6HA 4X89A 1OCCB 1YHQV 3OEHG 4GKJB 3TJTA 4X1YA 2W6IG 2OTJV 5JH7A 3JATB 2X0LA 3OGIB 5CA0B 3SGIA 4R8CA 4QPJA 3MHSC 4FVMA 3F5WC 1JR9A 4UVAA 4OGQB 4DYLA 1IZ3A 1N4CA 4GZRB 3BA9A 3ZHVA 2QGNA 3LUTB 4DV4B 1L8DA 2Y4TA 5H9CA 4DR1O 2ILMA 1AJPA 2F43G 3QO5A 1D5NA 3H1IH 3HKCA 2QKCA 1HNWB 1XHXA 1Z5WA 1VP7A 2UUAB 5EBWC 3TK1A 3ABUA 5BR8O 5KHGA 3ZRXA 2FL4A 2JJ1G 3CJHA 3ASOC 1H2GA 4YY3B 2NN4A 5LOVB 2BTQB 4EB6B 4GKKO 4ZHQA 2H94A 3U0ZA 4HAMA 3OD4A 4GT1A 2JVDA 3PN1A 4EB6A 2CTWA 2BTQA 1YCIA 5LOVA 2UU9B 1EBOA 2ZDIC 2ZD9A 1ZSPA 4PDVA 3HR0A 3CMEV 3HKBB 1M1KW 1EM1A 1YXBA 3T1HB 2DJVA 3ZHRA 5LP6A 1MABG 3J7AU 2C2AA 5JVDB 4X65O 4DR2O 3C3TA 4JZ2A 2LW1A 4I50B 1J5EB 2GUZA 3CEIA 2JIZG 3LNNA 1VIBA 5KHHA 2LW7A 1I5YA 2RNBA 2GBOA 2EZOA 2LJ2A 3OW2U 5L3CA 3JATA 4U3JB 2NLJC 1YTFB 4Z2WA 2XAHA 1B3QA 2X6AA 1BT8A 3ZRSA 2O57A 3RT3C 4LFBB 4GX0A 4FM2A 1EZVH 1VQLV 3NXSA 2LO1A 3DSQA 4GUNA 1GK9A 1SERA 4HBNA 2P22C 3L9DA 3IAYA 4TV9B 3Q4HB 4FFBA 2FKXA 1Y76A 4MW8A 2EIJB 4MSWC 1F4MA 4B3RO 3K03A 4CH3A 3HKDA 4IYIA 5J2UA 2ZE5A 3U10A 1EFRG 1D2DA 1S5HC 2B9ZA 3CCRV 4DR3O 2MK3A 1XQ8A 3LDEA 4O2BA 1S0VA 3GB7C 4J11A 3TXSA 5E1AC 2Q0OC 4TUYB 1UJWB 2GHYA 3T4ZA 4DUYB 4J42A 3LDDA 1HNWO 3BVOA 1R3KC 2ZINA 4HNAA 5L3FA 5IWAB 3G80A 4IIJB 4YJ2B 4PA4A 2DOSA 4DR7O 3RGBA 1WP7A 1HR0O 4BIUA 3K5OA 3UT5B 4JAAA 3PJSK 1W0KG 1L0LH 3JD2A 4LFAB 5LGUA 3ZJZA 1GM8A 1K4CC 3RN4A 2OCCC 1F7YA 1VF7A 4DK0A 4D7SA 1COWG 2PF4E 3O65A 5A2QN 4JI3O 3QNEA 1XREA 2GDSA 1VF6C 2DMXA 4O4IB 2CK3G 2ZT9B 3G6EV 3JD0A 3MAQA 1AI7A 1WPBA 3UT5A 2X6CA 3MHHC 4NXMB 3JASB 2OWOA 1TVKB 4DV1B 5C8YB 3AK3A 4Z1MG 4ZIBA 4X66B 1QBZA 1Y74A 5IYBO 5A9GA 3D36C 3TCUA 4KHPB 4NVPA 1FXKA 2QTOA 3EXAA 3T1YB 1NI8A 4WFGA 5KAIZ 2EILC 4JI6O 4UXNA 1BHBA 4I0XA 4LH6A 4MT8A 3SJBC 4O4JB 4BIOA 1AP5A 4WBNB 3OT7A 2LFRA 3ZX6A 2FMLA 3WU2Z 5L3BA 2YS8A 2HP8A 3WFVA 5J9PC 4JI0O 3B8NA 1BS3A 4I9WA 4I55A 4X65B 3K58A 4O4JA 2YI8A 4I7ZB 4ASUG 1R73A 2UUAO 1IBMO 1NT2B 4FFBB 1K33A 4PJ0Z 3KCXA 1YJWV 5DM6V 1N34B 1RPRA 1WB7A 3AG2C 5B3SB 1Y74B 3MD0A 2N74A 1JCHA 3WB1A 2K1EA 2RCVA 4B3RB 2P7TC 4ZKIA 5IYZA 1NQTA 3JALB 4LP8A 4BW9A 3AG1B 5JCOC 2EIKC 2M6YA 4DV6B 5BY1A 1G6UA 2LGQA 1Q8IA 2Y0PA 1N0JA 2DYSB 4XBFA 3A0RA 3LDCA 2YEVA 4X1IB 1RPOA 4FLZA 3CXCU 1Q43A 3DTUB 1SA0A 2HHHB 1SF9A 1N34O 1Q81W 3BA8A 1GKFA 2JS5A 2E5LO 4JTDB 1BMFG 4J80A 1HNZO 5EYPB 3RYIB 4YJ3A 3X2QB 2IJJA 4G28B 4LH7A 1ZL8B 4YXWG 1QQCA 3CC2V 4I50A 1FPOA 3I56V 5C93A 1FXVA 5JVDA 4BIZA 4FMTA 3ZRVA 2FTKA 1PNKA 5LL6Y 2IH1C 4LF7O 1K3EA 1NTMH 1W59A 2DYSC 1K73W 1CPYA 4AQYO 3ZN1A 1BCCH 1VF5B 5CMUA 4TUYA 3P3PA 2AW9A 2E5LB 1OJHA 2ZCEA 3X2QC 4LF8B 2RDCA 3S3XA 5GONB 3K79A 4JV5O 2Y4UA 4MVRA 3CE2A 3STZC 1VQKV 1KKDA 4N23A 1M57C 1RP3B 1GO3F 1XNRB 2LQTA 2PYLA 1VQ8V 3OR7C 4JYBA 1Y76B 4UV9A 3E22B 3L71H 3W7SA 5JWPA 1H2NA 4TV9A 1NR1A 4LF4O 1AB3A 3NR7A 2UU9O 5B5EZ 2P06A 3DXRB 2XOKG 3L72H 5EZYB 1W2BU
chains in the Genus database with same CATH topology
2CDYA 1N0JA 1B06A 4FFKA 1GN4A 1Y67A 3EVKA 3TJTA 4F6EA 1XREA 1AR4A 2GDSA 1IDSA 3C3SA 1MNGA 1LUVA 1BT8A 1IXBA 1QNMA 3DC6A 1JR9A 3LSUA 2ADQB 4JYYA 2ADPA 1EN5A 2P4KA 4GUNA 3AK3A 1MA1A 1XDCA 1VEWA 4YIPA 1XILA 4C7UA 5A9GA 1D5NA 2QKCA 4E4EA 1VARA 1ZTEA 3AK2A 1I0HA 1LUWA 1MSDA 1MMMA 4JZGA 1IX9A 1PL4A 4X9QA 3QVNA 1AP5A 3OT7A 3AK1A 3KDRA 1GN2A 1AR5A 1XUQA 2AW9A 3KKYA 1EN4A 2QKAA 1N0NA 1BS3A 4YIOA 1ZSPA 1P7GA 1AP6A 1ZUQA 1PM9A 3DC5A 3BFRA 1EM1A 1GN6A 1ZLZA 3K9SA 1WB8A 1SZXA 1WB7A 4BR6A 3IC9A 3C3TA 1EN6A 2RCVA 3MDSA 4JZ2A 5AG2A 1JA8A 2CE4A 3CEIA 1BSMA 1I08A 1GN3A 1AVMA 1KKCA 3RN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CDY A;  1N0J A;  1B06 A;  4FFK A;  1GN4 A;  1Y67 A;  3EVK A;  3TJT A;  4F6E A;  1XRE A;  1AR4 A;  2GDS A;  1IDS A;  3C3S A;  1MNG A;  1LUV A;  1BT8 A;  1IXB A;  1QNM A;  3DC6 A;  1JR9 A;  3LSU A;  2ADQ B;  4JYY A;  2ADP A;  1EN5 A;  2P4K A;  4GUN A;  3AK3 A;  1MA1 A;  1XDC A;  1VEW A;  4YIP A;  1XIL A;  4C7U A;  5A9G A;  1D5N A;  2QKC A;  4E4E A;  1VAR A;  1ZTE A;  3AK2 A;  1I0H A;  1LUW A;  1MSD A;  1MMM A;  4JZG A;  1IX9 A;  1PL4 A;  4X9Q A;  3QVN A;  1AP5 A;  3OT7 A;  3AK1 A;  1GN2 A;  1AR5 A;  1XUQ A;  2AW9 A;  3KKY A;  1EN4 A;  2QKA A;  1N0N A;  1BS3 A;  4YIO A;  1ZSP A;  1P7G A;  1AP6 A;  1ZUQ A;  1PM9 A;  3DC5 A;  3BFR A;  1EM1 A;  1GN6 A;  1ZLZ A;  3K9S A;  1WB8 A;  1SZX A;  1WB7 A;  4BR6 A;  3IC9 A;  3C3T A;  1EN6 A;  2RCV A;  3MDS A;  4JZ2 A;  5AG2 A;  1JA8 A;  2CE4 A;  3CEI A;  1BSM A;  1I08 A;  1GN3 A;  1AVM A;  1KKC A;  3RN4 A; 
#chains in the Genus database with same CATH topology
 5JH7 B;  1SES A;  2OIE A;  2HR3 A;  4G27 B;  1GN4 A;  4JI2 O;  5KAF Z;  2PTM A;  2UUB O;  2QM7 A;  4FZ1 A;  1U97 A;  4D7T A;  2AZ2 A;  2QR4 A;  3ABL B;  2W0F C;  3TGU H;  4FLT A;  4XDL A;  3JAK A;  4YJ3 B;  5EBM C;  2OCH A;  3ZIA G;  3N27 A;  3SYQ A;  2F93 B;  4PDR A;  3E2E A;  1Q7Y W;  2X6B A;  4JYY A;  3ZMV A;  2DW4 A;  3ZHS A;  5HFM A;  3OTO O;  1QLE B;  1OCZ C;  5EIB D;  3L70 H;  4H0L B;  1I94 O;  1M56 B;  1R6T A;  1S5J A;  2BCC H;  1PPJ H;  1KQS U;  1VQN V;  5GTH Z;  1I0H A;  4TWK A;  5IYZ B;  2KKW A;  4QPK A;  1NVP D;  1SS3 A;  1PNL A;  2HVJ C;  4UVC A;  1JPX A;  4JI8 O;  4K8X A;  4J9Y B;  3SPG A;  3H1H H;  4LFC B;  4ICG A;  4K8Z A;  1JVM A;  2F66 C;  1H5W A;  5KX5 A;  2R70 A;  3T1Y O;  2ZKO A;  3CCJ V;  1FD9 A;  5LGN A;  3VQX A;  5LHH A;  3I5D A;  4L8J A;  4UB8 Z;  4ZOL A;  4K3A A;  2ZXW B;  1NZ6 A;  5JJN B;  3K08 A;  5H5N A;  4J10 A;  1QLE C;  4X1K A;  4P9P A;  4Z1V A;  1SRY A;  4QGP A;  4I55 B;  3FYE B;  2WA4 A;  1V54 C;  2IU0 A;  3JD3 A;  2Y69 B;  4CS3 A;  1SZT A;  1IBK B;  1VF6 A;  5B66 Z;  3LNM B;  3CSX A;  1JA8 A;  4I0X B;  3ABK C;  1HNZ B;  2JEX A;  3GWO A;  1NKD A;  4OXS A;  4DV1 O;  3F5T A;  4CBC A;  2CAZ C;  1FYJ A;  4FLW A;  1BHA A;  5LHG A;  1I94 B;  4FM1 A;  5CA0 A;  3RVY A;  2AZ0 A;  2JGD B;  5KA6 A;  4DXW A;  4EFB A;  3JAS A;  4LFC O;  3C3S A;  1MNG A;  1QR9 A;  4JAS A;  3ZS8 C;  1MG1 A;  3DC6 A;  1K4D C;  1GH6 A;  2HEP A;  5IJ9 A;  4YHH B;  2JK5 C;  1EN5 A;  3SYA A;  4LFA O;  1CP9 A;  3SPC A;  4X62 O;  1YIT V;  4JI7 O;  1XNQ B;  1AJQ A;  2VS0 A;  3OE7 G;  4P2Z A;  3HB3 B;  2UUB B;  2EIN C;  1S77 D;  4UUJ C;  3E8B A;  1JFF B;  1WPX A;  2Z0A A;  4MW3 A;  4HYO A;  5IYD O;  5LMN B;  4B3S B;  4LFB O;  3AK1 A;  4O4H A;  3KDR A;  2EIK B;  1XMO B;  3CRQ A;  1FS0 G;  1VQM V;  1RM1 B;  4ZBM A;  4JI2 B;  3KZI Z;  3E83 A;  3LSS A;  2R9R B;  2CH7 A;  3FB8 C;  4JI4 O;  4GX1 A;  5GW7 A;  5E79 Z;  5B1A C;  4LF8 O;  2XND G;  1KP3 A;  4O2B B;  2BTO A;  4BR6 A;  3AG4 C;  4U7O A;  5CA3 A;  1IUR A;  2A3Q A;  3BY6 A;  1JFF A;  2EJR A;  5B1B B;  5EZY A;  2UXN A;  1T5E A;  1SKV A;  1SQG A;  1VQ9 V;  2CDY A;  1W0J G;  2EIM C;  1BE3 H;  2EIL B;  1WNS A;  3BPZ A;  5LXT A;  1FKA O;  3WG7 C;  4DUZ B;  1V9P A;  2G38 A;  2HJF C;  2Q68 A;  3E8G A;  3D3Q A;  2ATK C;  4H44 B;  2AHZ A;  4B7E A;  4J9Z B;  2GV9 A;  1WAZ A;  4CZZ A;  3ASO B;  1XNQ O;  1U96 A;  4TT3 G;  1MA1 A;  4FLX A;  1Q5O A;  3OGC C;  1NTZ H;  4PA6 A;  2VWK A;  2ARH A;  3CS5 A;  4DR2 B;  4TOI A;  3APQ A;  4YHH O;  1ZTE A;  1IBM B;  5FPR A;  1OCR B;  3CB2 A;  1B6Q A;  3JAW B;  3ZHU A;  1PL4 A;  3APO A;  4DW1 A;  1YVW A;  4JI7 B;  4I4T B;  2YDE A;  1K9M W;  2M7W A;  2BSK A;  1Q6I A;  1UPG A;  2CTR A;  2CTP A;  1K97 A;  3RYF B;  3VOU A;  4IHJ A;  3N2G A;  4LF9 O;  3ZHQ A;  4GKK B;  2YIA A;  4MVU A;  1H2K A;  4X20 A;  3G6B A;  4PA9 A;  1ENV A;  2PI5 A;  4ZOL B;  2Q73 A;  1R3J C;  1CXZ B;  3CC7 V;  2PY5 A;  3K9A A;  2UXC B;  2RN9 A;  5K1X A;  2KQX A;  3VQV A;  5CA1 B;  2DYR B;  1Q90 D;  5CBG A;  1YJ9 V;  1SA0 B;  1NVP B;  4B3T B;  4MTF A;  5AG2 A;  2EUL A;  4JI6 B;  5KHJ A;  3LSQ A;  1E79 G;  2WLL B;  2HKO A;  4NXM O;  4ABM A;  1KKC A;  5LA6 B;  1XHZ A;  5KUM A;  4O2A B;  2WLL A;  1P4R A;  4DR5 O;  1SQP H;  1UFI A;  4JI0 B;  4KP4 A;  1PD3 A;  4F6E A;  2ZM6 B;  1R6N A;  4CC5 A;  3SJC C;  3B09 A;  1X59 A;  1KUQ A;  3QO8 A;  1NH2 D;  1AJN A;  1IXB A;  2WLJ A;  4N21 A;  4WFH A;  4QE9 A;  3VQW A;  4BWA A;  2XT9 A;  3ZBH A;  4NTW A;  1Q82 W;  2B1G A;  2WLK A;  3FKS G;  1VQO V;  2N05 A;  1KP2 A;  1VMG A;  3DXR A;  4DV7 B;  1N8R W;  2E74 B;  2IH3 C;  3ICX A;  3OEE G;  1BZK A;  3RWR D;  2UXC O;  4DUY O;  4FPP A;  1Z5V A;  2W6J G;  1JQ0 A;  5J2T A;  1GN2 A;  3BEH A;  4YY3 O;  1IBL O;  1AR1 B;  3N2K B;  3O9O A;  5DN6 G;  2ZR3 A;  3RW0 A;  4NR1 A;  4X8A A;  1PM9 A;  4B3S O;  3DC5 A;  2MW2 B;  2E76 B;  1GM9 A;  4WFE A;  2F23 A;  1SQB H;  2UUC O;  3IFX A;  1Z2G A;  2GTA A;  3F7V C;  3P32 A;  3FB5 C;  1YEW A;  2QJ1 A;  4LWS B;  1S3J A;  4DR3 B;  1RFY A;  2WSS G;  2HVK C;  4R7C A;  3CMA V;  1M57 B;  4DR4 O;  3G4S V;  3CCV V;  3JSN A;  5LHI A;  2QWO B;  2W0X A;  1K8A W;  2P4V A;  2WAM A;  2F4V B;  1TGO A;  1BL8 A;  2CGN A;  3AG1 C;  1I5X A;  1PKX A;  3OMA B;  4MTG A;  1VQ5 V;  1QVF U;  4WFA V;  4DR6 B;  3OUS A;  4YJ2 A;  1ZL8 A;  5D5Q A;  3RYI A;  1XNR O;  5EBL C;  2LGW A;  2E75 B;  3CD6 V;  4KL1 A;  2ADQ B;  1FAF A;  3HPL C;  3SJQ C;  2YXL A;  4XDK A;  1TA8 A;  4YIP A;  3BRC A;  2YUA A;  2ZE8 A;  4O4H B;  4E4E A;  1VAR A;  3UCS C;  4JAV A;  4P9O A;  5KMG B;  4B3M O;  1SQF A;  5J2U B;  4MVZ A;  1OCZ B;  2QWR B;  1OHH G;  2QM8 A;  3RYH B;  5B1B C;  3CYO A;  3FFQ A;  4QIW F;  1DGS A;  2Q8V A;  1PV0 A;  1P7B A;  4RUE A;  1TAE A;  2ODM A;  4AQY B;  4O4L A;  4NYK A;  3D3I A;  2N04 A;  3B77 A;  4JI1 O;  5JJE B;  3H1K H;  4PEL A;  2X7R B;  3BFR A;  4FLY A;  1TUB A;  1XMO O;  2E3C A;  5KMG A;  2WA3 A;  3OM3 B;  2DE0 X;  3RFR A;  5IYC O;  1ZX3 A;  4PHZ A;  4QE7 A;  1P84 F;  3FYI B;  4U3J A;  4IL6 Z;  3AG3 C;  1FXH A;  4NTX A;  2CE4 A;  4DV0 O;  3OUF A;  4GYC B;  4KFM A;  1JMK C;  3W7X A;  3QTC A;  1H38 A;  1WP8 A;  3CRR A;  2P90 A;  1M4U A;  2HHH O;  3IC7 A;  2BOB C;  2GUZ B;  2WWW A;  2EJ7 A;  3TXQ A;  2Y0I A;  1F51 A;  2ZIM A;  3FB6 C;  1B04 A;  5LA6 A;  1ZWI C;  1ARO P;  1RM1 C;  2KG7 A;  2H3O A;  4X1K B;  4O4I A;  2Z5U A;  4TQD A;  4MTO A;  1YF2 A;  4H37 A;  1KC8 W;  1MZE A;  1Y66 A;  1OZ0 A;  1XDC A;  5L3D A;  1XIL A;  4DV2 B;  1VQ6 V;  4LWS A;  4NTY A;  2ZIO A;  5IDJ A;  1GAX A;  3AG4 B;  1M9N A;  1GM7 A;  1LUW A;  4JI1 B;  1QLN A;  4UVB A;  1Q3E A;  1R3L C;  5IE9 A;  5DED A;  3N2G B;  3OR6 C;  4IHJ B;  2YC0 A;  4WF9 V;  3HKC B;  3N2K A;  4UB6 Z;  3UKM A;  3CCU V;  3B4S A;  2BSK B;  4DV7 O;  4J7J A;  1N0N A;  4RAI A;  1YDX A;  3OFN G;  3S3W A;  2ZM6 O;  2P6J A;  3JAW A;  1R3I C;  5LYJ B;  4R50 A;  1KYO F;  2UXB B;  5KHI A;  4F6R A;  4JGS A;  3JAK B;  3RYC B;  3EHB B;  5FL7 G;  1R6K A;  3T1H O;  2Q7H A;  3HKE B;  3KCY A;  3C90 A;  1R1B A;  4GLX A;  3EFF K;  1FJG B;  3HKD B;  1BSM A;  3SJA C;  4DRX B;  4PD4 F;  5ITZ B;  2YI9 A;  5B3S C;  1BQ0 A;  2Q7G A;  3I55 V;  3Q4H A;  2OCC B;  3ZCC A;  3E22 A;  2Q7E A;  3H9V A;  2XAG A;  2F4V O;  4E2L A;  4DRX A;  2QE7 G;  5KLV H;  3ZMT A;  1E1R G;  5FPO A;  2IW5 A;  1YI2 V;  5CN0 A;  4G2K A;  2P4K A;  2QWQ B;  5K1P A;  3AEI A;  2LP7 A;  1SQV H;  5GON A;  2ETN A;  3VBB A;  1VQP V;  2VWJ A;  3CPW U;  1WLE A;  1NS1 A;  1X4T A;  2YXY A;  4J7K A;  1JJ2 U;  5CA1 A;  5GTI Z;  2VRZ A;  1O9G A;  3UO3 A;  4LR3 A;  4GX5 A;  4DUZ O;  1MZF A;  5FNV A;  2ITD C;  4JV5 B;  2CH7 B;  2XAF A;  4JZG A;  5EC1 C;  4JF3 A;  3QVN A;  1OCR C;  4X20 B;  4NKG B;  5B1N A;  1Y4M A;  2FB5 A;  5JCO A;  2JS3 A;  3JAR B;  1AR5 A;  2WLM A;  5HFL A;  1XUQ A;  3TET A;  4K0K O;  1K5Q A;  3RBZ A;  1PL0 A;  3G71 V;  5KUK A;  3RYF A;  2EIJ C;  4B08 A;  3UQ8 A;  3HKB A;  4MTX A;  4PDM A;  2ZQM A;  1AI6 A;  1CEZ A;  3FAV A;  3K5M A;  3ZRW A;  1AI5 A;  4X88 A;  3J81 N;  5EYP A;  4EEQ A;  1YSC A;  1US6 A;  1V55 B;  5DEC A;  3E86 A;  3K57 A;  3CRC A;  2UXD B;  4JTA B;  5CB4 A;  2RQ6 A;  1EN6 A;  4UCV A;  3ZMU A;  1G1X B;  3BHP A;  1IBK O;  2YEV B;  4Q20 A;  2DN9 A;  4X66 O;  4UCS A;  1OV9 A;  2KG7 B;  4UCO A;  1M56 C;  2WLH A;  4DV2 O;  2XTA A;  3JCU Z;  1QHT A;  2XAS A;  1HNX O;  1M90 W;  1IVS A;  1GN3 A;  2L35 A;  2HLD G;  3OTF A;  1XOU A;  2EBO A;  3JAL A;  4Q6G A;  1L0N H;  1F23 A;  3JSL A;  1N36 O;  2IM9 A;  4FFK A;  3CCL V;  5EIB C;  1KU9 A;  2HFE C;  2HJD A;  5LBQ A;  4FJC C;  3B2E E;  5LXT B;  3K04 A;  2L6L A;  3JYC A;  3K59 A;  4OPA A;  3WG7 B;  1DTO A;  3P30 A;  3ZED A;  4OX9 B;  5ITZ A;  3H1L H;  4X62 B;  2PZS A;  3L74 H;  4BAY A;  4X1Y B;  2CGO A;  4PA3 A;  3ETQ A;  1J95 A;  4DV6 O;  3SPI A;  4OPH A;  2GTS A;  1IXM A;  3H01 A;  2OT5 A;  1YTF D;  2BE3 A;  1S72 V;  5H6R A;  3RYC A;  2JDI G;  4WBN A;  3QG5 A;  2Z3Y A;  3CWB H;  4RQF A;  2NNU A;  1MMM A;  4FZ0 A;  1XEQ A;  5LYJ A;  3W7W A;  2ITC C;  2KB1 A;  4DW0 A;  4LNU B;  3T2M A;  5BZB A;  2A79 B;  2Q69 A;  2P67 A;  4ZI7 B;  4RQE A;  1BGY H;  4LF6 O;  1KBH A;  1XMQ B;  3ASN C;  2ZE7 A;  1ROP A;  3ABK B;  3CXH F;  1N32 O;  1I7F A;  2ZE6 A;  3M8A A;  4IGG A;  2WLI B;  4GCZ A;  4PV1 B;  4TV8 B;  5CBH A;  2QA4 V;  2A06 H;  3H1J H;  4NXN O;  2YIC A;  2F1M A;  5IJ0 A;  2BOC C;  2JRI A;  1FJG O;  2Q5Z A;  2QWP B;  3GVM A;  3P3N A;  2YIB A;  4GKJ O;  2DQ0 A;  1NH2 B;  2LFS A;  4EFE A;  1LNQ A;  3ABM B;  3JD1 A;  4ZI7 A;  1KEC A;  4JPR A;  4RUF A;  4MVM A;  4LF5 O;  4LNU A;  3MDS A;  1K7D A;  3B8M A;  3SR2 C;  4AHC A;  3M7M X;  2UXD O;  2UXB O;  1WN7 A;  1I08 A;  1THZ A;  3ETD A;  3AG7 A;  5B1A B;  4LF7 B;  2IJI A;  5BMV B;  1H2S B;  1FXK C;  1OCC C;  5L3G A;  1P49 A;  4IYH A;  1QR8 A;  3ABT A;  1JX9 A;  2WLN A;  1F4N A;  1Y67 A;  3THO A;  4JTC B;  2QTS A;  4XDJ A;  2B1I A;  1Q86 W;  2AXT Z;  2B5U A;  2YID A;  4CH4 A;  4MS2 A;  4H13 B;  3K5N A;  1WA8 A;  4EKW A;  1Y6X A;  2K9P A;  3ZN0 A;  3CX5 F;  2XAQ A;  4DR7 B;  2DWD C;  3OTO B;  2IU3 A;  3JAM N;  5IT9 N;  5LMU O;  3CCM V;  1FFT B;  2R9A A;  1KB9 F;  4U7N A;  3ZMZ A;  4PA7 A;  4UCU A;  4H33 A;  5L3E A;  1ZAU A;  3KG2 A;  5EC2 C;  1JNB A;  4FLV A;  1S76 D;  4X64 B;  1HW7 A;  5KHK A;  1OCO B;  5CB4 B;  3ZMS A;  4O4L B;  5LGT A;  5J2T B;  4J41 A;  3G67 A;  3SDL A;  5KX5 B;  4LF4 B;  2PYJ A;  1TUE B;  1P7G A;  3ZRW B;  3BCC H;  5CBF A;  4UCR A;  2YSU B;  1HDJ A;  1E1Q G;  1FFX B;  2ZNI A;  2VQF O;  4PI2 A;  3JAR A;  3QF7 A;  1SET A;  2QKS A;  1K5S A;  3QO7 A;  4QJF B;  3SYP A;  2CTQ A;  1H8E G;  2CUG A;  4DR1 B;  4U3F H;  2Q9L A;  5FNV B;  2QWN B;  2ZR2 A;  2D3O W;  4WCE V;  4MVS A;  2R72 A;  4JI5 B;  1LR1 A;  4CH6 A;  1L1F A;  3ZHT A;  1BQZ A;  2NR5 A;  2YXH A;  3EVK A;  2Q67 A;  2VQE O;  5TIS Z;  1AR4 A;  1FOU A;  4O2A A;  4DO2 A;  1FFX A;  3K3W A;  1M5I A;  3DGE A;  3CC4 V;  2OYQ A;  2R9I A;  1KD1 W;  2A0L A;  1XI1 A;  2A9H A;  2IJH A;  1YIJ V;  3VQY A;  1N33 B;  5LMU B;  1VEW A;  4JI8 B;  3K5L A;  3ML0 A;  2WPD G;  2HG5 C;  3ASN B;  3UM7 A;  1NTK H;  1Q6U A;  4ZHQ B;  1O9H A;  3M99 B;  3A8T A;  3A2F A;  4B3T O;  4J7Z A;  4DV5 B;  3E8H A;  1MSD A;  3R65 A;  1IX9 A;  1NR7 A;  2JEU A;  3IGA C;  1NU1 H;  4WFF A;  1KMI Z;  3HKE A;  2DYR C;  1VQ7 V;  2Y69 C;  3KKY A;  5F2V O;  1V54 B;  4IT5 A;  4I4T A;  2QKA A;  5IY5 B;  4F6R B;  3AG3 B;  4LF5 B;  5H2F Z;  1NBM G;  4YIO A;  2RMK B;  4PI0 A;  4LF9 B;  1RSO B;  4HZ3 A;  1HWY A;  2DQ3 A;  4PDL A;  1RSO A;  3UO2 A;  1FXK B;  1GMG A;  2PI4 A;  1WA8 B;  2PGG A;  2Q6A A;  3K0G A;  4DV3 O;  4FK5 C;  3K9S A;  4LF6 B;  1GRJ A;  5KA5 A;  1SZX A;  3CRA A;  3T1C A;  5C8Y A;  4B7K A;  1TVK A;  3OMN B;  4F4L A;  4UV8 A;  2YIB D;  2OTL V;  1PP9 H;  2V4D A;  3CRM A;  3L73 H;  4TQF A;  2H8P C;  2D2C B;  2AGA A;  1SC5 B;  4UCT A;  4DV4 O;  3B40 A;  5EK0 A;  1B06 A;  1JJO A;  3F7Y C;  3RVZ A;  4DR4 B;  1XMQ O;  3FB7 C;  1YJN V;  2F95 B;  5IY5 C;  3GWK C;  4X1I A;  1M93 A;  4R6Z A;  1LUV A;  2Q4P A;  1NJI W;  3CCS V;  2QDO A;  4CS2 A;  1QNM A;  2EIN B;  4P30 A;  3LSU A;  4FIP C;  5FLX N;  3SYO A;  3SPJ A;  2XUM A;  5IJ0 B;  2OIG A;  1HNX B;  4OX9 O;  4UFZ A;  3K0D A;  4TV8 A;  1QU7 A;  4DK1 A;  3J80 N;  1GTO A;  1QVG U;  4DV0 B;  2IJK A;  2QEX V;  4TSF G;  4KHP O;  4HNA B;  4FM0 A;  2GSM B;  4AI8 A;  1MSW D;  1XL4 A;  4LCU C;  1G8M A;  3BAB A;  4GX2 A;  3U11 A;  1OCO C;  1SQX H;  3AK2 A;  5B1O A;  1G4Y B;  4KXR A;  3CCE V;  4DV5 O;  2XAJ A;  1DK1 A;  2PUS A;  3FX7 A;  3CCQ V;  4FLU A;  3W7T A;  3ETE A;  4JYA B;  3OAA G;  1D5A A;  1EN4 A;  1K34 A;  3L75 H;  4WFB V;  4BW5 A;  4K0K B;  3WB2 A;  1N33 O;  1TUB B;  1XL6 A;  4JI3 B;  4CH5 A;  1ZUQ A;  1HP8 A;  2FYU H;  2AHY A;  1GN6 A;  4B3M B;  3AG2 B;  2EIM B;  3STL C;  2JJ2 G;  1URF A;  2UXX A;  5JJJ B;  5JQG A;  2RJZ A;  4I9Q A;  4JYC A;  3RYH A;  3IC9 A;  1QCE A;  2KSD A;  2VQF B;  3A0B Z;  4JAU A;  4NXN B;  4MVO A;  1DF5 A;  5IJ9 B;  4D6T H;  5BR8 B;  1N32 B;  4DR6 O;  2IBZ H;  2ZXW C;  3BAA A;  1A32 A;  2QSA A;  5IWA O;  2UUC B;  1AIL A;  2JGD A;  2VQE B;  3WB0 A;  5H6Q A;  5LMN O;  4L87 A;  4A5U B;  1DF4 A;  2P5O A;  4KUM A;  5JQG B;  1IDS A;  1K92 A;  4JI5 O;  2QM4 A;  1HR0 B;  2EX3 A;  2V1D A;  3D8C A;  2EZP A;  3E8F A;  3JCZ A;  3W7U A;  3A0H Z;  3FAV B;  2ADP A;  3D36 A;  4W4L A;  4X64 O;  2Y48 A;  5LP6 B;  4K35 A;  2A7W A;  2Q0A A;  4C7U A;  4IIJ A;  5BMV A;  1ORQ C;  4DV3 B;  3ABL C;  5BXZ A;  4LBE C;  2DWE C;  4X9Q A;  2ZDI A;  4MVQ A;  4JYA O;  3FD9 A;  3E35 A;  3JD4 A;  1H2M A;  1V55 C;  1XBL A;  1AI4 A;  1PNM A;  2V7Q G;  3CJH B;  1YZB A;  3SYC A;  3E89 A;  1IBL B;  1IJG A;  1EZJ A;  4RO2 A;  4NB5 A;  1AP6 A;  3CP1 A;  1H2L A;  3K06 A;  4CC6 A;  3R66 A;  1J5E O;  1SQQ H;  4DR5 B;  2WLI A;  1N36 B;  4CS4 A;  4AIL C;  1ZLZ A;  4I5S A;  3ETG A;  1VQ4 V;  1S5L Z;  2JGU A;  1WB8 A;  4LC1 A;  1H8H G;  1WJZ A;  1MOF A;  2ZNJ A;  3IJ4 A;  4QNH B;  1DLB A;  5LP6 C;  3CHX A;  4RWU A;  3SPH A;  3ABM C;  1JOY A;  1AVM A;  4JI4 B;  3T4D A;  4W4K A;  2XHB A;  3OMI B;  5D5P A;  1Q6H A;  4X89 A;  1OCC B;  1YHQ V;  3OEH G;  4GKJ B;  3TJT A;  4X1Y A;  2W6I G;  2OTJ V;  5JH7 A;  3JAT B;  2X0L A;  3OGI B;  5CA0 B;  3SGI A;  4R8C A;  4QPJ A;  3MHS C;  4FVM A;  3F5W C;  1JR9 A;  4UVA A;  4OGQ B;  4DYL A;  1IZ3 A;  1N4C A;  4GZR B;  3BA9 A;  3ZHV A;  2QGN A;  3LUT B;  4DV4 B;  1L8D A;  2Y4T A;  5H9C A;  4DR1 O;  2ILM A;  1AJP A;  2F43 G;  3QO5 A;  1D5N A;  3H1I H;  3HKC A;  2QKC A;  1HNW B;  1XHX A;  1Z5W A;  1VP7 A;  2UUA B;  5EBW C;  3TK1 A;  3ABU A;  5BR8 O;  5KHG A;  3ZRX A;  2FL4 A;  2JJ1 G;  3CJH A;  3ASO C;  1H2G A;  4YY3 B;  2NN4 A;  5LOV B;  2BTQ B;  4EB6 B;  4GKK O;  4ZHQ A;  2H94 A;  3U0Z A;  4HAM A;  3OD4 A;  4GT1 A;  2JVD A;  3PN1 A;  4EB6 A;  2CTW A;  2BTQ A;  1YCI A;  5LOV A;  2UU9 B;  1EBO A;  2ZDI C;  2ZD9 A;  1ZSP A;  4PDV A;  3HR0 A;  3CME V;  3HKB B;  1M1K W;  1EM1 A;  1YXB A;  3T1H B;  2DJV A;  3ZHR A;  5LP6 A;  1MAB G;  3J7A U;  2C2A A;  5JVD B;  4X65 O;  4DR2 O;  3C3T A;  4JZ2 A;  2LW1 A;  4I50 B;  1J5E B;  2GUZ A;  3CEI A;  2JIZ G;  3LNN A;  1VIB A;  5KHH A;  2LW7 A;  1I5Y A;  2RNB A;  2GBO A;  2EZO A;  2LJ2 A;  3OW2 U;  5L3C A;  3JAT A;  4U3J B;  2NLJ C;  1YTF B;  4Z2W A;  2XAH A;  1B3Q A;  2X6A A;  1BT8 A;  3ZRS A;  2O57 A;  3RT3 C;  4LFB B;  4GX0 A;  4FM2 A;  1EZV H;  1VQL V;  3NXS A;  2LO1 A;  3DSQ A;  4GUN A;  1GK9 A;  1SER A;  4HBN A;  2P22 C;  3L9D A;  3IAY A;  4TV9 B;  3Q4H B;  4FFB A;  2FKX A;  1Y76 A;  4MW8 A;  2EIJ B;  4MSW C;  1F4M A;  4B3R O;  3K03 A;  4CH3 A;  3HKD A;  4IYI A;  5J2U A;  2ZE5 A;  3U10 A;  1EFR G;  1D2D A;  1S5H C;  2B9Z A;  3CCR V;  4DR3 O;  2MK3 A;  1XQ8 A;  3LDE A;  4O2B A;  1S0V A;  3GB7 C;  4J11 A;  3TXS A;  5E1A C;  2Q0O C;  4TUY B;  1UJW B;  2GHY A;  3T4Z A;  4DUY B;  4J42 A;  3LDD A;  1HNW O;  3BVO A;  1R3K C;  2ZIN A;  4HNA A;  5L3F A;  5IWA B;  3G80 A;  4IIJ B;  4YJ2 B;  4PA4 A;  2DOS A;  4DR7 O;  3RGB A;  1WP7 A;  1HR0 O;  4BIU A;  3K5O A;  3UT5 B;  4JAA A;  3PJS K;  1W0K G;  1L0L H;  3JD2 A;  4LFA B;  5LGU A;  3ZJZ A;  1GM8 A;  1K4C C;  3RN4 A;  2OCC C;  1F7Y A;  1VF7 A;  4DK0 A;  4D7S A;  1COW G;  2PF4 E;  3O65 A;  5A2Q N;  4JI3 O;  3QNE A;  1XRE A;  2GDS A;  1VF6 C;  2DMX A;  4O4I B;  2CK3 G;  2ZT9 B;  3G6E V;  3JD0 A;  3MAQ A;  1AI7 A;  1WPB A;  3UT5 A;  2X6C A;  3MHH C;  4NXM B;  3JAS B;  2OWO A;  1TVK B;  4DV1 B;  5C8Y B;  3AK3 A;  4Z1M G;  4ZIB A;  4X66 B;  1QBZ A;  1Y74 A;  5IYB O;  5A9G A;  3D36 C;  3TCU A;  4KHP B;  4NVP A;  1FXK A;  2QTO A;  3EXA A;  3T1Y B;  1NI8 A;  4WFG A;  5KAI Z;  2EIL C;  4JI6 O;  4UXN A;  1BHB A;  4I0X A;  4LH6 A;  4MT8 A;  3SJB C;  4O4J B;  4BIO A;  1AP5 A;  4WBN B;  3OT7 A;  2LFR A;  3ZX6 A;  2FML A;  3WU2 Z;  5L3B A;  2YS8 A;  2HP8 A;  3WFV A;  5J9P C;  4JI0 O;  3B8N A;  1BS3 A;  4I9W A;  4I55 A;  4X65 B;  3K58 A;  4O4J A;  2YI8 A;  4I7Z B;  4ASU G;  1R73 A;  2UUA O;  1IBM O;  1NT2 B;  4FFB B;  1K33 A;  4PJ0 Z;  3KCX A;  1YJW V;  5DM6 V;  1N34 B;  1RPR A;  1WB7 A;  3AG2 C;  5B3S B;  1Y74 B;  3MD0 A;  2N74 A;  1JCH A;  3WB1 A;  2K1E A;  2RCV A;  4B3R B;  2P7T C;  4ZKI A;  5IYZ A;  1NQT A;  3JAL B;  4LP8 A;  4BW9 A;  3AG1 B;  5JCO C;  2EIK C;  2M6Y A;  4DV6 B;  5BY1 A;  1G6U A;  2LGQ A;  1Q8I A;  2Y0P A;  1N0J A;  2DYS B;  4XBF A;  3A0R A;  3LDC A;  2YEV A;  4X1I B;  1RPO A;  4FLZ A;  3CXC U;  1Q43 A;  3DTU B;  1SA0 A;  2HHH B;  1SF9 A;  1N34 O;  1Q81 W;  3BA8 A;  1GKF A;  2JS5 A;  2E5L O;  4JTD B;  1BMF G;  4J80 A;  1HNZ O;  5EYP B;  3RYI B;  4YJ3 A;  3X2Q B;  2IJJ A;  4G28 B;  4LH7 A;  1ZL8 B;  4YXW G;  1QQC A;  3CC2 V;  4I50 A;  1FPO A;  3I56 V;  5C93 A;  1FXV A;  5JVD A;  4BIZ A;  4FMT A;  3ZRV A;  2FTK A;  1PNK A;  5LL6 Y;  2IH1 C;  4LF7 O;  1K3E A;  1NTM H;  1W59 A;  2DYS C;  1K73 W;  1CPY A;  4AQY O;  3ZN1 A;  1BCC H;  1VF5 B;  5CMU A;  4TUY A;  3P3P A;  2AW9 A;  2E5L B;  1OJH A;  2ZCE A;  3X2Q C;  4LF8 B;  2RDC A;  3S3X A;  5GON B;  3K79 A;  4JV5 O;  2Y4U A;  4MVR A;  3CE2 A;  3STZ C;  1VQK V;  1KKD A;  4N23 A;  1M57 C;  1RP3 B;  1GO3 F;  1XNR B;  2LQT A;  2PYL A;  1VQ8 V;  3OR7 C;  4JYB A;  1Y76 B;  4UV9 A;  3E22 B;  3L71 H;  3W7S A;  5JWP A;  1H2N A;  4TV9 A;  1NR1 A;  4LF4 O;  1AB3 A;  3NR7 A;  2UU9 O;  5B5E Z;  2P06 A;  3DXR B;  2XOK G;  3L72 H;  5EZY B;  1W2B U; 
#chains in the Genus database with same CATH homology
 2CDY A;  1N0J A;  1B06 A;  4FFK A;  1GN4 A;  1Y67 A;  3EVK A;  3TJT A;  4F6E A;  1XRE A;  1AR4 A;  2GDS A;  1IDS A;  3C3S A;  1MNG A;  1LUV A;  1BT8 A;  1IXB A;  1QNM A;  3DC6 A;  1JR9 A;  3LSU A;  2ADQ B;  4JYY A;  2ADP A;  1EN5 A;  2P4K A;  4GUN A;  3AK3 A;  1MA1 A;  1XDC A;  1VEW A;  4YIP A;  1XIL A;  4C7U A;  5A9G A;  1D5N A;  2QKC A;  4E4E A;  1VAR A;  1ZTE A;  3AK2 A;  1I0H A;  1LUW A;  1MSD A;  1MMM A;  4JZG A;  1IX9 A;  1PL4 A;  4X9Q A;  3QVN A;  1AP5 A;  3OT7 A;  3AK1 A;  3KDR A;  1GN2 A;  1AR5 A;  1XUQ A;  2AW9 A;  3KKY A;  1EN4 A;  2QKA A;  1N0N A;  1BS3 A;  4YIO A;  1ZSP A;  1P7G A;  1AP6 A;  1ZUQ A;  1PM9 A;  3DC5 A;  3BFR A;  1EM1 A;  1GN6 A;  1ZLZ A;  3K9S A;  1WB8 A;  1SZX A;  1WB7 A;  4BR6 A;  3IC9 A;  3C3T A;  1EN6 A;  2RCV A;  3MDS A;  4JZ2 A;  5AG2 A;  1JA8 A;  2CE4 A;  3CEI A;  1BSM A;  1I08 A;  1GN3 A;  1AVM A;  1KKC A;  3RN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...