1AP6A

Tyr34->phe mutant of human mitochondrial manganese superoxide dismutase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Crystal structure of Y34F mutant human mitochondrial manganese superoxide dismutase and the functional role of tyrosine 34.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 74
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ap6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ap6A02
4JZ2A 4JZGA 3IC9A 2CE4A 3TJTA 1QNMA 1I0HA 1GN2A 3LSUA 5AG2A 3CEIA 1EN6A 1XUQA 3KKYA 1XILA 1EN4A 2P4KA 1P7GA 1XDCA 4BR6A 3OT7A 3QVNA 1EM1A 1GN4A 1ZSPA 2QKAA 3MDSA 4X9QA 1D5NA 4GUNA 1ZLZA 1PL4A 2QKCA 2CDYA 1GN3A 2GDSA 1PM9A 1AR4A 1IX9A 1MSDA 4YIOA 1ZUQA 3RN4A 3K9SA 3AK1A 2ADQB 4FFKA 1AR5A 1LUVA 3DC6A 5A9GA 1JR9A 2ADPA 3EVKA 1XREA 1KKCA 1N0NA 1IXBA 1Y67A 1N0JA 1MA1A 3BFRA 4JYYA 3AK2A 1MMMA 4C7UA 3C3TA 1SZXA 1VEWA 1IDSA 1WB8A 1VARA 4YIPA 1I08A 1LUWA 3AK3A 3C3SA 1JA8A 1AP5A 1WB7A 1EN5A 1BS3A 1BT8A 1BSMA 2AW9A 2RCVA 3DC5A 1AP6A 4F6EA 1ZTEA 1B06A 4E4EA 1MNGA 1GN6A 1AVMA
chains in the Genus database with same CATH superfamily
5DN6G 1VF6C 4OX9B 2Q67A 4ASUG 3GWKC 2QM7A 2WLLB 3LSUA 4X1IB 4DR5B 4DUYB 1IURA 1Q6UA 4MVUA 5CMUA 3CEIA 1EN6A 1EZVH 3K0DA 4TSFG 3CCRV 4GLXA 1Y6XA 2ZXWB 3OD4A 3FB7C 1Q86W 1P7GA 2EIJC 2YEVB 3QVNA 4W4LA 1HP8A 1GN4A 2ETNA 1K7DA 1S0VA 1VQMV 1PNMA 3CCMV 4DV2B 1B3QA 4NVPA 5GONA 4UXNA 1GRJA 1IBKB 1K5QA 3RN4A 1X4TA 3LDCA 4CZZA 3D36C 3KCYA 1IZ3A 4I50A 2ZE6A 1FKAO 3TGUH 1E1QG 4PDMA 3E22A 3CRRA 4PDLA 1P7BA 2PY5A 4JI1B 5BMVB 3EVKA 2Q6AA 3B4SA 3QF7A 4LCUC 3TETA 4MVZA 2Z5UA 1NR1A 4X1KB 3A0RA 3TXSA 4LF7O 1SF9A 2RJZA 4I9QA 1NR7A 5H6RA 1URFA 2IJKA 4JI7B 2IU3A 5KX5A 3M8AA 3CB2A 4NR1A 4FLWA 1P49A 2UXBB 4DV6B 4FZ0A 1TUBB 1BSMA 2V7QG 3OEEG 5L3CA 1H38A 1Y66A 4QJFB 1ZTEA 3JATA 3K04A 1BMFG 1EFRG 2FTKA 5CBFA 4LFBO 1Q82W 3UCSC 3ZIAG 3RYIB 3T1CA 3T2MA 3JAKA 5JJEB 4CS3A 2QJ1A 4PA3A 2E3CA 3U0ZA 2Y69C 3TCUA 1WP8A 4UCOA 5EBWC 3JCZA 2ZT9B 2Y4UA 5IY5B 3CCLV 1WPBA 2EIKC 2EZPA 3FD9A 1DTOA 3BVOA 2CGNA 4X8AA 3SGIA 1SQVH 1N34B 1K8AW 2JS3A 3CP1A 3KG2A 4PA7A 4UUJC 1FXHA 1HNZO 2M6YA 3HPLC 4LH6A 2IM9A 3FKSG 2XNDG 4O2BA 2ZDIC 2DYSC 1QLEB 3NXSA 4O4IA 2W6JG 3EHBB 3LNMB 5LP6A 4DV1O 1NH2B 3ABLB 4OPHA 3L9DA 1E79G 1AR4A 3AG4C 4DV4O 2F4VO 4UCUA 3K9SA 5IJ9A 2JJ1G 2Q73A 1TAEA 1GM8A 1GKFA 3JAWA 3T1HO 1ZX3A 1HNWO 3G6EV 3VQYA 4H37A 3STZC 3HKEA 1FFTB 1XMOB 1E1RG 4MSWC 3WFVA 3CE2A 4R50A 5DM6V 5B5EZ 1NBMG 4UFZA 1IJGA 4X88A 2QR4A 1MMMA 3KZIZ 2A7WA 1Q6IA 2ZIOA 3JD1A 1YEWA 5LMNO 2CGOA 2WA3A 1OCZC 2VWKA 4ICGA 3ASNB 4FMTA 1SA0B 2AW9A 2V4DA 1A32A 2BOCC 4L87A 1VQNV 4G27B 2ZM6O 4QPJA 3UKMA 2IW5A 4LWSA 2KKWA 3ZHQA 1RPRA 3X2QC 4JF3A 3W7SA 3SDLA 2BSKB 4PA9A 1NI8A 1XUQA 2BTQA 4PD4F 5LMUB 3CRCA 4DV5O 3AG3C 2XASA 3R65A 4MT8A 4FM1A 4BIOA 4YY3O 2X6CA 1R73A 5EZYB 3GB7C 4JI0O 5EYPB 2JEUA 2ARHA 2YXYA 4N21A 2JJ2G 3T4ZA 1HWYA 4A5UB 1NQTA 4PDVA 5C8YB 4JI3B 2F23A 1PD3A 4FM0A 3T1YO 2ZD9A 3RYCA 1YF2A 3SYAA 5B66Z 1LR1A 5CA0A 4MVOA 4FFKA 4FLUA 2HLDG 4X20A 4J10A 1H8HG 2XAGA 4UV8A 5J2UB 4LF7B 5CB4A 1UPGA 2P5OA 1MG1A 1KMIZ 5L3EA 5B1AB 1W0KG 4U3JA 3JARA 2YXLA 1SQBH 1SERA 5J2TB 3ABTA 4I4TA 2OCHA 5KMGA 1SZXA 2DOSA 2DYRC 5JH7B 3MAQA 2EINC 1H2KA 3ABMC 3G71V 4D7SA 5LHIA 2Y48A 2ITDC 3UT5B 2Q0AA 4GX5A 4WFBV 3PN1A 3ZJZA 2RNBA 4DR4O 3UM7A 4JTCB 1K34A 3I55V 1HNZB 4P30A 1COWG 4LBEC 1OZ0A 2XTAA 5LYJA 1BGYH 1KBHA 3CYOA 4DRXB 1XILA 2UXNA 4MVSA 4TV8B 4DYLA 2WLLA 4JI2B 4X1IA 3CJHB 3IAYA 1IBLO 2WPDG 5D5QA 2Y0IA 4DV1B 1H5WA 4B3TO 3EFFK 3G6BA 1V54C 3J80N 1UJWB 3H1HH 3QO7A 5B1OA 4J9YB 1ZSPA 4DR6O 2YEVA 1M9NA 3ZCCA 1HW7A 5L3FA 4O2AB 3F7VC 2AZ2A 3T1HB 1ZLZA 3ETQA 5ITZA 4K35A 1WPXA 3RWRD 1HNWB 1H2NA 4KFMA 2FB5A 4RUEA 3K08A 4RO2A 4O2BB 5A2QN 5B1NA 4DR5O 4DUYO 1GM7A 1R6TA 1GAXA 3K9AA 2DE0X 4CS4A 4U7OA 2R9IA 2HJFC 2IJIA 2JDIG 1BE3H 1N0NA 2XAJA 1NTMH 1OCOB 4J41A 3JAWB 3AG2B 5BMVA 1ENVA 3ZN1A 2MW2B 4X1KA 4C7UA 5BR8O 4DV2O 4NXNB 2WLHA 1M4UA 3W7XA 1WB7A 5EIBD 1IBKO 4R8CA 4EB6B 3ML0A 3B2EE 4WFFA 4CC5A 3TXQA 1B06A 1TUBA 2ZR3A 1I5XA 1RP3B 4FLYA 2QEXV 3OGCC 4TOIA 4DV5B 1QLNA 5KHIA 4YY3B 2HEPA 3RYIA 1YJNV 3SPCA 4WFHA 1DF5A 3ABKC 4LF4B 1NU1H 2B1IA 3M7MX 2MK3A 1OJHA 1XL4A 4QE7A 4B3RO 1XOUA 2OYQA 3OTOB 1AJNA 4JV5B 3L72H 1K9MW 2LO1A 2UXBO 4LF8B 4PI0A 4WCEV 1WAZA 5B3SC 5KLVH 2UUCO 2KSDA 1S5LZ 2QWRB 2N05A 2HP8A 4I9WA 3J81N 2OWOA 4RUFA 4YXWG 1YHQV 1PL4A 2UUAB 3RVZA 5IJ0B 1S76D 1Y74B 2GDSA 2ILMA 1QBZA 4ZOLA 1US6A 5KUKA 1TA8A 5EC2C 1P84F 1JVMA 2A0LA 3Q4HA 5IDJA 2QWNB 1K33A 3ZRXA 4FJCC 4NTYA 3OM3B 4JPRA 1YTFD 1QCEA 2R70A 3ZRVA 3RYCB 1IVSA 3AG1B 1R3JC 3H1KH 1JR9A 1CP9A 5CBGA 5JCOC 4JYAB 1Y67A 4NYKA 4B3SB 1WA8B 1M93A 2XUMA 4KHPB 5EK0A 4K8XA 1V55B 4EEQA 1VF6A 2P7TC 3B40A 1YJ9V 3AK3A 1R3IC 1JA8A 1NVPB 4TUYA 1KD1W 4H13B 3SJQC 3N27A 1PPJH 4YJ2B 4O4JB 1V54B 1WLEA 5FPRA 2YI9A 3UO3A 4ZI7A 2OIGA 5KMGB 4NTWA 5E1AC 2LW1A 3E83A 2HJDA 2WWWA 4LF6B 2QDOA 1M57B 2WLIB 4UB6Z 3IC7A 1XMOO 3OW2U 2CE4A 3TJTA 2Q69A 4D6TH 5CN0A 1B04A 2DN9A 4LNUB 2W6IG 1K92A 1FXKC 1ZWIC 4B3MB 3UO2A 4JI6O 2JGDB 2QGNA 4DV0O 4DK0A 1KP2A 4EFEA 3ASOC 3D36A 4BR6A 5CA1B 3ETEA 3P30A 4MS2A 5E79Z 5LYJB 5EZYA 2FKXA 3JASB 5EYPA 4I55A 4DXWA 4J9ZB 3I5DA 4X9QA 2VRZA 4D7TA 3RYHA 1JFFB 3GWOA 3N2GB 5C8YA 3ICXA 5B1BC 4J42A 3OR6C 4TV9A 3CCEV 1AR5A 1BL8A 5FNVB 5LMUO 2HVKC 1BHAA 5ITZB 2ZE7A 5J2UA 5BR8B 3CD6V 3CMAV 3U11A 2FYUH 4R6ZA 1Z2GA 1XL6A 5LGTA 1L8DA 3ZMVA 1GM9A 1MA1A 3BFRA 2ZNJA 1YJWV 1PP9H 4UCSA 3LUTB 4JI3O 1VARA 5J2TA 4IHJB 3A0HZ 5D5PA 1BS3A 5JH7A 4JI5O 1NTKH 3WG7B 2EILB 3S3WA 1U96A 2KQXA 2W0FC 1F4MA 4GX2A 4IYHA 3OUFA 4QIWF 4U7NA 1KUQA 1MNGA 5DECA 2Z0AA 5B3SB 1GN6A 4WBNA 3UT5A 4B3RB 3IC9A 2ZDIA 2D3OW 4HAMA 4OPAA 1OCRB 1YSCA 2CTPA 2EIMB 1SRYA 3LNNA 2WSSG 2UUCB 2P22C 3E89A 1BQZA 2OTLV 3ETDA 1M1KW 4DRXA 1ZL8A 4TV8A 4TWKA 3OE7G 1NH2D 3CJHA 3F5WC 5BZBA 1K4DC 1VP7A 5IWAO 1KKDA 3CXCU 2NNUA 1D5NA 2H8PC 2N74A 4F6RB 4JYBA 1GN3A 4KL1A 4DR1O 4O2AA 4O4HA 4FFBB 2LJ2A 3E8BA 3CRAA 3JAMN 1JJOA 1LUVA 5H2FZ 2ZINA 5KAIZ 4JI2O 5LOVB 2XAQA 3K57A 1R6KA 4ZOLB 2DWEC 2JIZG 3Q4HB 1AILA 2XT9A 3ZMTA 4FIPC 5LGUA 1DF4A 4DV3O 2R9RB 4WFEA 1KP3A 3ZMZA 2Q7HA 2HVJC 4HYOA 4JTDB 4JYYA 1W59A 3LDEA 1QQCA 4FLXA 3AK2A 5L3BA 2IJHA 5EBLC 1AR1B 5L3DA 3C3SA 1G6UA 1K5SA 1NZ6A 1S72V 1O9HA 4E2LA 2EX3A 2E5LO 3D8CA 2RCVA 3VOUA 3LSQA 2Q5ZA 2IH3C 1VMGA 1W2BU 3B77A 1AROP 3ZHVA 2VQFB 4EB6A 1QU7A 1XQ8A 4JAVA 1AI6A 4TUYB 4JI6B 2QTSA 1ROPA 3RVYA 4X62B 1EZJA 4DV0B 2P67A 2D2CB 3OAAG 5GTHZ 4ZI7B 2JS5A 4NXMO 2Q7GA 4FLVA 2EIJB 4LFAB 1XNQO 3W7UA 2YC0A 4NXNO 4LP8A 2QSAA 2RN9A 3L73H 4Q6GA 2R72A 5KHGA 3VQXA 1S77D 2L35A 2QWQB 2LFSA 1J5EO 5GTIZ 1BQ0A 1NJIW 1FFXA 4PELA 4PA6A 5DEDA 5LP6C 1X59A 1JJ2U 3JCUZ 4GUNA 4UCTA 1SZTA 1AB3A 3FB8C 1BZKA 1IX9A 2OT5A 1RFYA 1CEZA 4FK5C 3ZN0A 2UXDB 1VQKV 1H2SB 3KDRA 2PI4A 5IJ0A 4I55B 1Y74A 4Z1VA 4MTFA 4LF4O 2E76B 4DR3B 3RYHB 2HR3A 3PJSK 2YIDA 3OTOO 2LW7A 4JV5O 1JCHA 2DQ0A 2Q7EA 3H01A 4GKKB 4TV9B 2QWOB 1VQ5V 4LF8O 1B6QA 4J80A 1GK9A 4K3AA 4JI5B 1SQQH 3HKCA 3OFNG 2XAHA 4DW1A 1WA8A 3CX5F 3HKBB 1F51A 3JD2A 1YVWA 2UUAO 1AP5A 1DGSA 5JJNB 1QR8A 1R1BA 4QE9A 2YICA 4HNAB 4X65B 1SETA 3G67A 2Y69B 2LGWA 5BY1A 4YJ2A 1HDJA 4O4JA 4YJ3B 3DGEA 1GH6A 4MTXA 2X7RB 2CUGA 2OCCC 1PKXA 2ZR2A 1MOFA 3ZBHA 2CK3G 5FLXN 3J7AU 3OR7C 3ZEDA 3THOA 5EIBC 2EIKB 4JYAO 2WLIA 4B3SO 2UU9B 1EBOA 3L74H 1H2MA 4KHPO 2FL4A 4ZHQA 1AI4A 3SR2C 5KHJA 3B09A 2GSMB 1M56C 2CH7A 4WBNB 5IWAB 4LNUA 4LR3A 3T4DA 1F23A 3BAAA 2PYLA 1U97A 2B9ZA 2DYSB 4G2KA 1SQFA 2JGDA 3G80A 3ZX6A 3HR0A 4DR1B 4ZKIA 3NR7A 5CA1A 1P4RA 1PL0A 3CCJV 3AG4B 4LF6O 2QA4V 3JASA 2WLNA 1ZL8B 1S5HC 1Q3EA 4GZRB 5KA5A 3N2KB 4YIOA 2YXHA 2P6JA 1J95A 1RM1C 1JFFA 2AXTZ 5LXTB 3N2GA 4FLTA 2Q68A 2GUZB 2H3OA 1D2DA 1SQGA 4DV3B 5C93A 2Q4PA 3QG5A 4B3MO 2DJVA 4IIJB 4BW9A 1ZAUA 4CH4A 2X0LA 5FNVA 2XHBA 3MHHC 4I0XB 4O4HB 1IBMO 5H5NA 4CS2A 1MABG 4X89A 2HFEC 3VBBA 1SKVA 2Q0OC 3CWBH 1SESA 3OMNB 5K1XA 2E5LB 1OCZB 1W0JG 5LHGA 1IDSA 1F4NA 5HFLA 2P06A 4ABMA 1XHZA 4GX1A 3SJAC 1EN5A 1YZBA 1I7FA 1S5JA 3IFXA 4NKGB 3LSSA 2JVDA 4IHJA 4KP4A 1V9PA 3IJ4A 4OXSA 1O9GA 3RYFB 2PZSA 4GT1A 4EFBA 3X2QB 3FYIB 1L0NH 2GHYA 3CC7V 4NXMB 4JZGA 1XNQB 5LBQA 3JSNA 3B8MA 1R3LC 1I0HA 3AG3B 4RQEA 1J5EB 1NKDA 1GMGA 1Z5VA 4AI8A 1TUEB 3SYCA 2ATKC 2NR5A 5IE9A 2BTOA 4MVRA 3C90A 1M5IA 2KG7B 3OT7A 1YCIA 1WJZA 4K0KB 3JALB 1XBLA 1VQ9V 2V1DA 2OIEA 5JQGB 2HKOA 5HFMA 1YXBA 4B7EA 3K58A 3O9OA 4F6RA 3SPJA 2ADQB 1FFXB 4DV7O 3JSLA 1ORQC 4UB8Z 3A8TA 2P4VA 2PF4E 2NLJC 4FFBA 4KXRA 1MSWD 2RMKB 5K1PA 4LH7A 3MHSC 3WU2Z 2VWJA 2ZE8A 5IYZB 3OUSA 5LOVA 3OGIB 3CXHF 4IGGA 1NVPD 2DYRB 4DUZB 1WN7A 2OTJV 2AHYA 4WFAV 1Q6HA 2EINB 3ABMB 2Q8VA 2EZOA 1PNLA 4XDJA 1Y76A 4JI8O 4XBFA 2YS8A 4CH3A 3HKCB 2YIAA 4RQFA 1XI1A 1XEQA 4N23A 3CC2V 5JVDB 1YDXA 4XDKA 3FB5C 2GTSA 4BAYA 3AEIA 3E2EA 3F5TA 3QO8A 4YHHO 1M90W 1KECA 2IJJA 4P9PA 3RT3C 4UVBA 1D5AA 4JGSA 3ZMSA 1VQLV 3KKYA 1EN4A 3TK1A 1HR0B 4AHCA 2ITCC 2WAMA 5J9PC 1EM1A 1L1FA 4IL6Z 4DR2B 4WF9V 3BEHA 4ZHQB 5TISZ 1PNKA 4UCRA 4JI4B 2VQFO 2CH7B 1QVFU 2UUBB 4AQYB 1VF5B 1FJGO 1G4YB 1WP7A 1SS3A 1QLEC 4J7JA 4ZBMA 4GCZA 1MSDA 4X62O 4O4LB 5LGNA 3ABLC 3CCSV 1IBMB 3FB6C 1VQPV 1FAFA 3ZRWB 4LFAO 2R9AA 4DO2A 4GKJO 2PUSA 1KKCA 1IXBA 3E8FA 4JAAA 3R66A 4CH5A 4P9OA 3RGBA 4Q20A 1WB8A 2LQTA 4YIPA 1VQOV 3HKBA 3CHXA 2Y0PA 5KHKA 2BE3A 4U3FH 3QO5A 2UXDO 1AP6A 4X64O 3ZHSA 3ASNC 1H2LA 2QWPB 1N36O 3LDDA 2CTWA 3H9VA 1BCCH 4PA4A 5H9CA 1K4CC 4DR3O 4HNAA 5LHHA 3CRQA 4XDLA 3ABKB 1BHBA 4IYIA 4GKKO 1CXZB 3E8HA 4YJ3A 2W0XA 3RBZA 4J11A 2X6BA 1FS0G 2GTAA 1YIJV 3OMIB 4LF5B 1XHXA 2P90A 2PI5A 2CTQA 5KA6A 1XDCA 1L0LH 2X6AA 1K3EA 2EBOA 5EBMC 3GVMA 2EJ7A 4X65O 3K59A 3CPWU 4DV7B 3JD4A 1Q7YW 2QKCA 2E75B 2CDYA 4FLZA 1PM9A 2DQ3A 1I94O 4FZ1A 3CRMA 2UU9O 2EULA 3N2KA 2WLJA 3DC6A 3SJCC 2XOKG 4JTAB 5A9GA 5F2VO 5LXTA 3HKDB 3OEHG 2GUZA 5IYBO 4LFCO 4IIJA 1S3JA 4AILC 3K79A 2CTRA 3FAVB 1GO3F 3O65A 4TQFA 3BRCA 1DK1A 4JI8B 4I0XA 2Q9LA 1H2GA 5B1AC 2AHZA 3D3QA 3CCUV 4HZ3A 1N32O 1XNRB 4MW8A 1RPOA 2PYJA 1VQ6V 5CA3A 3E35A 2IU0A 4RAIA 1Q8IA 1VIBA 2CAZC 3CCVV 2B5UA 3BPZA 3ZHUA 1VQ8V 4YHHB 3VQWA 4QPKA 3K5MA 2L6LA 2C2AA 4IT5A 1G1XB 2N04A 3SPIA 5IT9N 3FX7A 5FL7G 4UCVA 2F66C 2KB1A 4JZ2A 5IYCO 1Y76B 2ZCEA 3K03A 4FVMA 3RYFA 1XMQO 3H1IH 2A3QA 1FXKB 1GN2A 1AI5A 1UFIA 1JNBA 4Z1MG 5AG2A 1TGOA 1JX9A 3UQ8A 2EJRA 2PTMA 5FPOA 1R6NA 4X1YB 3ASOB 1KU9A 4I7ZB 3K5LA 2LP7A 1FJGB 3OMAB 3DSQA 5EC1C 4OGQB 2KG7A 4H0LB 1TVKB 1K73W 3JALA 1JMKC 5B1BB 2WA4A 1QVGU 3A0BZ 3K0GA 2ZKOA 2HHHB 5LA6B 5L3GA 4NB5A 3U10A 1IXMA 4DR7O 5JQGA 3RW0A 5JJJB 3L75H 3SYPA 3BCCH 1HNXO 2IBZH 4GKJB 2DMXA 4H44B 1DLBA 4CBCA 1NS1A 3DXRA 4K8ZA 1N33O 2YI8A 1AJQA 2YUAA 2QE7G 4FPPA 4W4KA 2GBOA 1K97A 3RFRA 4K0KO 1N0JA 4MW3A 3IGAC 2Z3YA 3H1LH 5IYZA 3M99B 3ZRSA 1JOYA 3WB0A 3BHPA 4L8JA 4BWAA 2K1EA 1OCOC 4X64B 3AG2C 1N36B 4X66O 3L71H 3ZHRA 3AG7A 3CCQV 2K9PA 1BT8A 1RSOB 1OV9A 4LC1A 4TT3G 2F43G 1NTZH 2QKSA 4E4EA 2VQEO 3VQVA 4NTXA 1AVMA 2GV9A 1N8RW 1MZEA 5GW7A 1NT2B 1KB9F 5KUMA 2RDCA 3SYQA 2JK5C 5JVDA 4DUZO 4QNHB 3SYOA 2YSUB 4MVMA 5BXZA 4J7KA 4JAUA 3CS5A 2F93B 1KQSU 3ZS8C 1Q81W 5GONB 1I94B 4KUMA 2UXCO 3MDSA 1R3KC 3OTFA 2VS0A 1FXVA 3CMEV 4R7CA 1JPXA 2BOBC 5LL6Y 5IYDO 2G38A 3QNEA 3HB3B 4I50B 2JGUA 1KYOF 3E22B 4LFCB 2Y4TA 1FOUA 1OHHG 4HBNA 1Y4MA 4LF9O 4O4LA 4LFBB 3BABA 1HR0O 4PDRA 3EXAA 4DK1A 1N32B 1G8MA 2ADPA 3ZRWA 4ZIBA 4DR2O 3AG1C 4UV9A 4PV1B 4B08A 5KX5B 3I56V 4JI4O 4RWUA 1N4CA 1VEWA 2UUBO 4AQYO 2AZ0A 1V55C 2A79B 1QR9A 5JWPA 2FMLA 3JATB 4MVQA 1MZFA 1LNQA 1Q90D 3DC5A 3BA9A 1XMQB 2WLKA 3JAKB 4B7KA 3B8NA 3P32A 4BIZA 1THZA 1I5YA 3W7WA 3P3NA 4MTGA 3STLC 4DV4B 1M57C 2F4VB 3H1JH 3BA8A 2YIBA 4TQDA 5CBHA 2A9HA 3P3PA 3SPHA 3FYEB 3E8GA 2A06H 4GYCB 4OX9O 1JQ0A 2P4KA 4MTOA 4O4IB 1OCCC 4P2ZA 3JD3A 5LP6B 4DR7B 4DW0A 3FFQA 2QKAA 3G4SV 1HNXB 2PGGA 1PV0A 5IJ9B 2QTOA 1AI7A 5LMNB 1N33B 1ZUQA 3AK1A 1VQ7V 1KC8W 3S3XA 1FPOA 2UXXA 3HKEB 2ZXWC 1VQ4V 1YITV 2QM8A 5KHHA 4BW5A 4GX0A 3K5NA 4LF5O 1FD9A 2IH1C 4I5SA 2ZM6B 1Q43A 1GTOA 1XREA 5JCOA 1Z5WA 3L70H 4X66B 3HKDA 3QTCA 2JEXA 3APOA 3DXRB 3C3TA 3FAVA 3JYCA 4JI1O 2DWDC 3APQA 1I08A 1LUWA 2VQEB 4JI0B 2BCCH 3A2FA 2H94A 1AJPA 4Z2WA 2O57A 2LGQA 2ODMA 3SJBC 2M7WA 4UVCA 1VF7A 3ZMUA 1QHTA 1YI2V 4JI7O 4J7ZA 4LWSB 2OCCB 3K06A 3WG7C 1SQXH 2EILC 1FYJA 3K5OA 1H8EG 3BY6A 1SQPH 4DV6O 3T1YB 3CSXA 4QGPA 3E86A 3ABUA 3F7YC 1QNMA 2BTQB 2ZNIA 1M56B 3WB2A 3DTUB 3W7TA 1FXKA 1OCRC 1WNSA 4F4LA 1XNRO 3MD0A 1CPYA 2UXCB 2EIMC 4UVAA 2WLMA 4X1YA 4CC6A 3WB1A 1T5EA 1N34O 3K3WA 3ETGA 4PI2A 2NN4A 3KCXA 2DW4A 4LF9B 2YDEA 1RM1B 5CA0B 2QM4A 1TVKA 4X20B 5IY5C 3D3IA 5CB4B 4JASA 5LA6A 2E74B 2HG5C 2F1MA 5KAFZ 4U3JB 4H33A 3ZHTA 4PHZA 4DR4B 3JARB 4EKWA 2RQ6A 1Q5OA 4I4TB 1SA0A 2XAFA 4FM2A 3SPGA 1YTFB 2ZIMA 1IBLB 2JRIA 2ZQMA 2HHHO 2LFRA 2ZE5A 4B3TB 4WFGA 4PJ0Z 2AGAA 2YIBD 4CH6A 2F95B 4DR6B 4F6EA 2B1GA 2BSKA 5H6QA 1OCCB 1SC5B 3JD0A 1RSOA 3CC4V 4JYCA 4BIUA 4G28B 1F7YA
chains in the Genus database with same CATH topology
4JZ2A 4JZGA 3IC9A 2CE4A 3TJTA 1QNMA 1I0HA 1GN2A 3LSUA 5AG2A 3CEIA 1EN6A 1XUQA 3KKYA 1XILA 1EN4A 2P4KA 1P7GA 1XDCA 4BR6A 3OT7A 3QVNA 1EM1A 1GN4A 1ZSPA 2QKAA 3MDSA 4X9QA 1D5NA 4GUNA 1ZLZA 1PL4A 2QKCA 2CDYA 1GN3A 2GDSA 1PM9A 1AR4A 1IX9A 1MSDA 4YIOA 1ZUQA 3RN4A 3K9SA 3AK1A 2ADQB 3KDRA 4FFKA 1AR5A 1LUVA 3DC6A 5A9GA 1JR9A 2ADPA 3EVKA 1XREA 1KKCA 1N0NA 1IXBA 1Y67A 1N0JA 1MA1A 3BFRA 4JYYA 3AK2A 1MMMA 4C7UA 3C3TA 1SZXA 1VEWA 1IDSA 1WB8A 1VARA 4YIPA 1I08A 1LUWA 3AK3A 3C3SA 1JA8A 1AP5A 1WB7A 1EN5A 1BS3A 1BT8A 1BSMA 2AW9A 2RCVA 3DC5A 1AP6A 4F6EA 1ZTEA 1B06A 4E4EA 1MNGA 1GN6A 1AVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ2 A;  4JZG A;  3IC9 A;  2CE4 A;  3TJT A;  1QNM A;  1I0H A;  1GN2 A;  3LSU A;  5AG2 A;  3CEI A;  1EN6 A;  1XUQ A;  3KKY A;  1XIL A;  1EN4 A;  2P4K A;  1P7G A;  1XDC A;  4BR6 A;  3OT7 A;  3QVN A;  1EM1 A;  1GN4 A;  1ZSP A;  2QKA A;  3MDS A;  4X9Q A;  1D5N A;  4GUN A;  1ZLZ A;  1PL4 A;  2QKC A;  2CDY A;  1GN3 A;  2GDS A;  1PM9 A;  1AR4 A;  1IX9 A;  1MSD A;  4YIO A;  1ZUQ A;  3RN4 A;  3K9S A;  3AK1 A;  2ADQ B;  4FFK A;  1AR5 A;  1LUV A;  3DC6 A;  5A9G A;  1JR9 A;  2ADP A;  3EVK A;  1XRE A;  1KKC A;  1N0N A;  1IXB A;  1Y67 A;  1N0J A;  1MA1 A;  3BFR A;  4JYY A;  3AK2 A;  1MMM A;  4C7U A;  3C3T A;  1SZX A;  1VEW A;  1IDS A;  1WB8 A;  1VAR A;  4YIP A;  1I08 A;  1LUW A;  3AK3 A;  3C3S A;  1JA8 A;  1AP5 A;  1WB7 A;  1EN5 A;  1BS3 A;  1BT8 A;  1BSM A;  2AW9 A;  2RCV A;  3DC5 A;  1AP6 A;  4F6E A;  1ZTE A;  1B06 A;  4E4E A;  1MNG A;  1GN6 A;  1AVM A; 
#chains in the Genus database with same CATH topology
 5DN6 G;  1VF6 C;  4OX9 B;  2Q67 A;  4ASU G;  3GWK C;  2QM7 A;  2WLL B;  3LSU A;  4X1I B;  4DR5 B;  4DUY B;  1IUR A;  1Q6U A;  4MVU A;  5CMU A;  3CEI A;  1EN6 A;  1EZV H;  3K0D A;  4TSF G;  3CCR V;  4GLX A;  1Y6X A;  2ZXW B;  3OD4 A;  3FB7 C;  1Q86 W;  1P7G A;  2EIJ C;  2YEV B;  3QVN A;  4W4L A;  1HP8 A;  1GN4 A;  2ETN A;  1K7D A;  1S0V A;  1VQM V;  1PNM A;  3CCM V;  4DV2 B;  1B3Q A;  4NVP A;  5GON A;  4UXN A;  1GRJ A;  1IBK B;  1K5Q A;  3RN4 A;  1X4T A;  3LDC A;  4CZZ A;  3D36 C;  3KCY A;  1IZ3 A;  4I50 A;  2ZE6 A;  1FKA O;  3TGU H;  1E1Q G;  4PDM A;  3E22 A;  3CRR A;  4PDL A;  1P7B A;  2PY5 A;  4JI1 B;  5BMV B;  3EVK A;  2Q6A A;  3B4S A;  3QF7 A;  4LCU C;  3TET A;  4MVZ A;  2Z5U A;  1NR1 A;  4X1K B;  3A0R A;  3TXS A;  4LF7 O;  1SF9 A;  2RJZ A;  4I9Q A;  1NR7 A;  5H6R A;  1URF A;  2IJK A;  4JI7 B;  2IU3 A;  5KX5 A;  3M8A A;  3CB2 A;  4NR1 A;  4FLW A;  1P49 A;  2UXB B;  4DV6 B;  4FZ0 A;  1TUB B;  1BSM A;  2V7Q G;  3OEE G;  5L3C A;  1H38 A;  1Y66 A;  4QJF B;  1ZTE A;  3JAT A;  3K04 A;  1BMF G;  1EFR G;  2FTK A;  5CBF A;  4LFB O;  1Q82 W;  3UCS C;  3ZIA G;  3RYI B;  3T1C A;  3T2M A;  3JAK A;  5JJE B;  4CS3 A;  2QJ1 A;  4PA3 A;  2E3C A;  3U0Z A;  2Y69 C;  3TCU A;  1WP8 A;  4UCO A;  5EBW C;  3JCZ A;  2ZT9 B;  2Y4U A;  5IY5 B;  3CCL V;  1WPB A;  2EIK C;  2EZP A;  3FD9 A;  1DTO A;  3BVO A;  2CGN A;  4X8A A;  3SGI A;  1SQV H;  1N34 B;  1K8A W;  2JS3 A;  3CP1 A;  3KG2 A;  4PA7 A;  4UUJ C;  1FXH A;  1HNZ O;  2M6Y A;  3HPL C;  4LH6 A;  2IM9 A;  3FKS G;  2XND G;  4O2B A;  2ZDI C;  2DYS C;  1QLE B;  3NXS A;  4O4I A;  2W6J G;  3EHB B;  3LNM B;  5LP6 A;  4DV1 O;  1NH2 B;  3ABL B;  4OPH A;  3L9D A;  1E79 G;  1AR4 A;  3AG4 C;  4DV4 O;  2F4V O;  4UCU A;  3K9S A;  5IJ9 A;  2JJ1 G;  2Q73 A;  1TAE A;  1GM8 A;  1GKF A;  3JAW A;  3T1H O;  1ZX3 A;  1HNW O;  3G6E V;  3VQY A;  4H37 A;  3STZ C;  3HKE A;  1FFT B;  1XMO B;  1E1R G;  4MSW C;  3WFV A;  3CE2 A;  4R50 A;  5DM6 V;  5B5E Z;  1NBM G;  4UFZ A;  1IJG A;  4X88 A;  2QR4 A;  1MMM A;  3KZI Z;  2A7W A;  1Q6I A;  2ZIO A;  3JD1 A;  1YEW A;  5LMN O;  2CGO A;  2WA3 A;  1OCZ C;  2VWK A;  4ICG A;  3ASN B;  4FMT A;  1SA0 B;  2AW9 A;  2V4D A;  1A32 A;  2BOC C;  4L87 A;  1VQN V;  4G27 B;  2ZM6 O;  4QPJ A;  3UKM A;  2IW5 A;  4LWS A;  2KKW A;  3ZHQ A;  1RPR A;  3X2Q C;  4JF3 A;  3W7S A;  3SDL A;  2BSK B;  4PA9 A;  1NI8 A;  1XUQ A;  2BTQ A;  4PD4 F;  5LMU B;  3CRC A;  4DV5 O;  3AG3 C;  2XAS A;  3R65 A;  4MT8 A;  4FM1 A;  4BIO A;  4YY3 O;  2X6C A;  1R73 A;  5EZY B;  3GB7 C;  4JI0 O;  5EYP B;  2JEU A;  2ARH A;  2YXY A;  4N21 A;  2JJ2 G;  3T4Z A;  1HWY A;  4A5U B;  1NQT A;  4PDV A;  5C8Y B;  4JI3 B;  2F23 A;  1PD3 A;  4FM0 A;  3T1Y O;  2ZD9 A;  3RYC A;  1YF2 A;  3SYA A;  5B66 Z;  1LR1 A;  5CA0 A;  4MVO A;  4FFK A;  4FLU A;  2HLD G;  4X20 A;  4J10 A;  1H8H G;  2XAG A;  4UV8 A;  5J2U B;  4LF7 B;  5CB4 A;  1UPG A;  2P5O A;  1MG1 A;  1KMI Z;  5L3E A;  5B1A B;  1W0K G;  4U3J A;  3JAR A;  2YXL A;  1SQB H;  1SER A;  5J2T B;  3ABT A;  4I4T A;  2OCH A;  5KMG A;  1SZX A;  2DOS A;  2DYR C;  5JH7 B;  3MAQ A;  2EIN C;  1H2K A;  3ABM C;  3G71 V;  4D7S A;  5LHI A;  2Y48 A;  2ITD C;  3UT5 B;  2Q0A A;  4GX5 A;  4WFB V;  3PN1 A;  3ZJZ A;  2RNB A;  4DR4 O;  3UM7 A;  4JTC B;  1K34 A;  3I55 V;  1HNZ B;  4P30 A;  1COW G;  4LBE C;  1OZ0 A;  2XTA A;  5LYJ A;  1BGY H;  1KBH A;  3CYO A;  4DRX B;  1XIL A;  2UXN A;  4MVS A;  4TV8 B;  4DYL A;  2WLL A;  4JI2 B;  4X1I A;  3CJH B;  3IAY A;  1IBL O;  2WPD G;  5D5Q A;  2Y0I A;  4DV1 B;  1H5W A;  4B3T O;  3EFF K;  3G6B A;  1V54 C;  3J80 N;  1UJW B;  3H1H H;  3QO7 A;  5B1O A;  4J9Y B;  1ZSP A;  4DR6 O;  2YEV A;  1M9N A;  3ZCC A;  1HW7 A;  5L3F A;  4O2A B;  3F7V C;  2AZ2 A;  3T1H B;  1ZLZ A;  3ETQ A;  5ITZ A;  4K35 A;  1WPX A;  3RWR D;  1HNW B;  1H2N A;  4KFM A;  2FB5 A;  4RUE A;  3K08 A;  4RO2 A;  4O2B B;  5A2Q N;  5B1N A;  4DR5 O;  4DUY O;  1GM7 A;  1R6T A;  1GAX A;  3K9A A;  2DE0 X;  4CS4 A;  4U7O A;  2R9I A;  2HJF C;  2IJI A;  2JDI G;  1BE3 H;  1N0N A;  2XAJ A;  1NTM H;  1OCO B;  4J41 A;  3JAW B;  3AG2 B;  5BMV A;  1ENV A;  3ZN1 A;  2MW2 B;  4X1K A;  4C7U A;  5BR8 O;  4DV2 O;  4NXN B;  2WLH A;  1M4U A;  3W7X A;  1WB7 A;  5EIB D;  1IBK O;  4R8C A;  4EB6 B;  3ML0 A;  3B2E E;  4WFF A;  4CC5 A;  3TXQ A;  1B06 A;  1TUB A;  2ZR3 A;  1I5X A;  1RP3 B;  4FLY A;  2QEX V;  3OGC C;  4TOI A;  4DV5 B;  1QLN A;  5KHI A;  4YY3 B;  2HEP A;  3RYI A;  1YJN V;  3SPC A;  4WFH A;  1DF5 A;  3ABK C;  4LF4 B;  1NU1 H;  2B1I A;  3M7M X;  2MK3 A;  1OJH A;  1XL4 A;  4QE7 A;  4B3R O;  1XOU A;  2OYQ A;  3OTO B;  1AJN A;  4JV5 B;  3L72 H;  1K9M W;  2LO1 A;  2UXB O;  4LF8 B;  4PI0 A;  4WCE V;  1WAZ A;  5B3S C;  5KLV H;  2UUC O;  2KSD A;  1S5L Z;  2QWR B;  2N05 A;  2HP8 A;  4I9W A;  3J81 N;  2OWO A;  4RUF A;  4YXW G;  1YHQ V;  1PL4 A;  2UUA B;  3RVZ A;  5IJ0 B;  1S76 D;  1Y74 B;  2GDS A;  2ILM A;  1QBZ A;  4ZOL A;  1US6 A;  5KUK A;  1TA8 A;  5EC2 C;  1P84 F;  1JVM A;  2A0L A;  3Q4H A;  5IDJ A;  2QWN B;  1K33 A;  3ZRX A;  4FJC C;  4NTY A;  3OM3 B;  4JPR A;  1YTF D;  1QCE A;  2R70 A;  3ZRV A;  3RYC B;  1IVS A;  3AG1 B;  1R3J C;  3H1K H;  1JR9 A;  1CP9 A;  5CBG A;  5JCO C;  4JYA B;  1Y67 A;  4NYK A;  4B3S B;  1WA8 B;  1M93 A;  2XUM A;  4KHP B;  5EK0 A;  4K8X A;  1V55 B;  4EEQ A;  1VF6 A;  2P7T C;  3B40 A;  1YJ9 V;  3AK3 A;  1R3I C;  1JA8 A;  1NVP B;  4TUY A;  1KD1 W;  4H13 B;  3SJQ C;  3N27 A;  1PPJ H;  4YJ2 B;  4O4J B;  1V54 B;  1WLE A;  5FPR A;  2YI9 A;  3UO3 A;  4ZI7 A;  2OIG A;  5KMG B;  4NTW A;  5E1A C;  2LW1 A;  3E83 A;  2HJD A;  2WWW A;  4LF6 B;  2QDO A;  1M57 B;  2WLI B;  4UB6 Z;  3IC7 A;  1XMO O;  3OW2 U;  2CE4 A;  3TJT A;  2Q69 A;  4D6T H;  5CN0 A;  1B04 A;  2DN9 A;  4LNU B;  2W6I G;  1K92 A;  1FXK C;  1ZWI C;  4B3M B;  3UO2 A;  4JI6 O;  2JGD B;  2QGN A;  4DV0 O;  4DK0 A;  1KP2 A;  4EFE A;  3ASO C;  3D36 A;  4BR6 A;  5CA1 B;  3ETE A;  3P30 A;  4MS2 A;  5E79 Z;  5LYJ B;  5EZY A;  2FKX A;  3JAS B;  5EYP A;  4I55 A;  4DXW A;  4J9Z B;  3I5D A;  4X9Q A;  2VRZ A;  4D7T A;  3RYH A;  1JFF B;  3GWO A;  3N2G B;  5C8Y A;  3ICX A;  5B1B C;  4J42 A;  3OR6 C;  4TV9 A;  3CCE V;  1AR5 A;  1BL8 A;  5FNV B;  5LMU O;  2HVK C;  1BHA A;  5ITZ B;  2ZE7 A;  5J2U A;  5BR8 B;  3CD6 V;  3CMA V;  3U11 A;  2FYU H;  4R6Z A;  1Z2G A;  1XL6 A;  5LGT A;  1L8D A;  3ZMV A;  1GM9 A;  1MA1 A;  3BFR A;  2ZNJ A;  1YJW V;  1PP9 H;  4UCS A;  3LUT B;  4JI3 O;  1VAR A;  5J2T A;  4IHJ B;  3A0H Z;  5D5P A;  1BS3 A;  5JH7 A;  4JI5 O;  1NTK H;  3WG7 B;  2EIL B;  3S3W A;  1U96 A;  2KQX A;  2W0F C;  1F4M A;  4GX2 A;  4IYH A;  3OUF A;  4QIW F;  4U7N A;  1KUQ A;  1MNG A;  5DEC A;  2Z0A A;  5B3S B;  1GN6 A;  4WBN A;  3UT5 A;  4B3R B;  3IC9 A;  2ZDI A;  2D3O W;  4HAM A;  4OPA A;  1OCR B;  1YSC A;  2CTP A;  2EIM B;  1SRY A;  3LNN A;  2WSS G;  2UUC B;  2P22 C;  3E89 A;  1BQZ A;  2OTL V;  3ETD A;  1M1K W;  4DRX A;  1ZL8 A;  4TV8 A;  4TWK A;  3OE7 G;  1NH2 D;  3CJH A;  3F5W C;  5BZB A;  1K4D C;  1VP7 A;  5IWA O;  1KKD A;  3CXC U;  2NNU A;  1D5N A;  2H8P C;  2N74 A;  4F6R B;  4JYB A;  1GN3 A;  4KL1 A;  4DR1 O;  4O2A A;  4O4H A;  4FFB B;  2LJ2 A;  3E8B A;  3CRA A;  3JAM N;  1JJO A;  1LUV A;  5H2F Z;  2ZIN A;  5KAI Z;  4JI2 O;  5LOV B;  2XAQ A;  3K57 A;  1R6K A;  4ZOL B;  2DWE C;  2JIZ G;  3Q4H B;  1AIL A;  2XT9 A;  3ZMT A;  4FIP C;  5LGU A;  1DF4 A;  4DV3 O;  2R9R B;  4WFE A;  1KP3 A;  3ZMZ A;  2Q7H A;  2HVJ C;  4HYO A;  4JTD B;  4JYY A;  1W59 A;  3LDE A;  1QQC A;  4FLX A;  3AK2 A;  5L3B A;  2IJH A;  5EBL C;  1AR1 B;  5L3D A;  3C3S A;  1G6U A;  1K5S A;  1NZ6 A;  1S72 V;  1O9H A;  4E2L A;  2EX3 A;  2E5L O;  3D8C A;  2RCV A;  3VOU A;  3LSQ A;  2Q5Z A;  2IH3 C;  1VMG A;  1W2B U;  3B77 A;  1ARO P;  3ZHV A;  2VQF B;  4EB6 A;  1QU7 A;  1XQ8 A;  4JAV A;  1AI6 A;  4TUY B;  4JI6 B;  2QTS A;  1ROP A;  3RVY A;  4X62 B;  1EZJ A;  4DV0 B;  2P67 A;  2D2C B;  3OAA G;  5GTH Z;  4ZI7 B;  2JS5 A;  4NXM O;  2Q7G A;  4FLV A;  2EIJ B;  4LFA B;  1XNQ O;  3W7U A;  2YC0 A;  4NXN O;  4LP8 A;  2QSA A;  2RN9 A;  3L73 H;  4Q6G A;  2R72 A;  5KHG A;  3VQX A;  1S77 D;  2L35 A;  2QWQ B;  2LFS A;  1J5E O;  5GTI Z;  1BQ0 A;  1NJI W;  1FFX A;  4PEL A;  4PA6 A;  5DED A;  5LP6 C;  1X59 A;  1JJ2 U;  3JCU Z;  4GUN A;  4UCT A;  1SZT A;  1AB3 A;  3FB8 C;  1BZK A;  1IX9 A;  2OT5 A;  1RFY A;  1CEZ A;  4FK5 C;  3ZN0 A;  2UXD B;  1VQK V;  1H2S B;  3KDR A;  2PI4 A;  5IJ0 A;  4I55 B;  1Y74 A;  4Z1V A;  4MTF A;  4LF4 O;  2E76 B;  4DR3 B;  3RYH B;  2HR3 A;  3PJS K;  2YID A;  3OTO O;  2LW7 A;  4JV5 O;  1JCH A;  2DQ0 A;  2Q7E A;  3H01 A;  4GKK B;  4TV9 B;  2QWO B;  1VQ5 V;  4LF8 O;  1B6Q A;  4J80 A;  1GK9 A;  4K3A A;  4JI5 B;  1SQQ H;  3HKC A;  3OFN G;  2XAH A;  4DW1 A;  1WA8 A;  3CX5 F;  3HKB B;  1F51 A;  3JD2 A;  1YVW A;  2UUA O;  1AP5 A;  1DGS A;  5JJN B;  1QR8 A;  1R1B A;  4QE9 A;  2YIC A;  4HNA B;  4X65 B;  1SET A;  3G67 A;  2Y69 B;  2LGW A;  5BY1 A;  4YJ2 A;  1HDJ A;  4O4J A;  4YJ3 B;  3DGE A;  1GH6 A;  4MTX A;  2X7R B;  2CUG A;  2OCC C;  1PKX A;  2ZR2 A;  1MOF A;  3ZBH A;  2CK3 G;  5FLX N;  3J7A U;  3OR7 C;  3ZED A;  3THO A;  5EIB C;  2EIK B;  4JYA O;  2WLI A;  4B3S O;  2UU9 B;  1EBO A;  3L74 H;  1H2M A;  4KHP O;  2FL4 A;  4ZHQ A;  1AI4 A;  3SR2 C;  5KHJ A;  3B09 A;  2GSM B;  1M56 C;  2CH7 A;  4WBN B;  5IWA B;  4LNU A;  4LR3 A;  3T4D A;  1F23 A;  3BAA A;  2PYL A;  1U97 A;  2B9Z A;  2DYS B;  4G2K A;  1SQF A;  2JGD A;  3G80 A;  3ZX6 A;  3HR0 A;  4DR1 B;  4ZKI A;  3NR7 A;  5CA1 A;  1P4R A;  1PL0 A;  3CCJ V;  3AG4 B;  4LF6 O;  2QA4 V;  3JAS A;  2WLN A;  1ZL8 B;  1S5H C;  1Q3E A;  4GZR B;  5KA5 A;  3N2K B;  4YIO A;  2YXH A;  2P6J A;  1J95 A;  1RM1 C;  1JFF A;  2AXT Z;  5LXT B;  3N2G A;  4FLT A;  2Q68 A;  2GUZ B;  2H3O A;  1D2D A;  1SQG A;  4DV3 B;  5C93 A;  2Q4P A;  3QG5 A;  4B3M O;  2DJV A;  4IIJ B;  4BW9 A;  1ZAU A;  4CH4 A;  2X0L A;  5FNV A;  2XHB A;  3MHH C;  4I0X B;  4O4H B;  1IBM O;  5H5N A;  4CS2 A;  1MAB G;  4X89 A;  2HFE C;  3VBB A;  1SKV A;  2Q0O C;  3CWB H;  1SES A;  3OMN B;  5K1X A;  2E5L B;  1OCZ B;  1W0J G;  5LHG A;  1IDS A;  1F4N A;  5HFL A;  2P06 A;  4ABM A;  1XHZ A;  4GX1 A;  3SJA C;  1EN5 A;  1YZB A;  1I7F A;  1S5J A;  3IFX A;  4NKG B;  3LSS A;  2JVD A;  4IHJ A;  4KP4 A;  1V9P A;  3IJ4 A;  4OXS A;  1O9G A;  3RYF B;  2PZS A;  4GT1 A;  4EFB A;  3X2Q B;  3FYI B;  1L0N H;  2GHY A;  3CC7 V;  4NXM B;  4JZG A;  1XNQ B;  5LBQ A;  3JSN A;  3B8M A;  1R3L C;  1I0H A;  3AG3 B;  4RQE A;  1J5E B;  1NKD A;  1GMG A;  1Z5V A;  4AI8 A;  1TUE B;  3SYC A;  2ATK C;  2NR5 A;  5IE9 A;  2BTO A;  4MVR A;  3C90 A;  1M5I A;  2KG7 B;  3OT7 A;  1YCI A;  1WJZ A;  4K0K B;  3JAL B;  1XBL A;  1VQ9 V;  2V1D A;  2OIE A;  5JQG B;  2HKO A;  5HFM A;  1YXB A;  4B7E A;  3K58 A;  3O9O A;  4F6R A;  3SPJ A;  2ADQ B;  1FFX B;  4DV7 O;  3JSL A;  1ORQ C;  4UB8 Z;  3A8T A;  2P4V A;  2PF4 E;  2NLJ C;  4FFB A;  4KXR A;  1MSW D;  2RMK B;  5K1P A;  4LH7 A;  3MHS C;  3WU2 Z;  2VWJ A;  2ZE8 A;  5IYZ B;  3OUS A;  5LOV A;  3OGI B;  3CXH F;  4IGG A;  1NVP D;  2DYR B;  4DUZ B;  1WN7 A;  2OTJ V;  2AHY A;  4WFA V;  1Q6H A;  2EIN B;  3ABM B;  2Q8V A;  2EZO A;  1PNL A;  4XDJ A;  1Y76 A;  4JI8 O;  4XBF A;  2YS8 A;  4CH3 A;  3HKC B;  2YIA A;  4RQF A;  1XI1 A;  1XEQ A;  4N23 A;  3CC2 V;  5JVD B;  1YDX A;  4XDK A;  3FB5 C;  2GTS A;  4BAY A;  3AEI A;  3E2E A;  3F5T A;  3QO8 A;  4YHH O;  1M90 W;  1KEC A;  2IJJ A;  4P9P A;  3RT3 C;  4UVB A;  1D5A A;  4JGS A;  3ZMS A;  1VQL V;  3KKY A;  1EN4 A;  3TK1 A;  1HR0 B;  4AHC A;  2ITC C;  2WAM A;  5J9P C;  1EM1 A;  1L1F A;  4IL6 Z;  4DR2 B;  4WF9 V;  3BEH A;  4ZHQ B;  5TIS Z;  1PNK A;  4UCR A;  4JI4 B;  2VQF O;  2CH7 B;  1QVF U;  2UUB B;  4AQY B;  1VF5 B;  1FJG O;  1G4Y B;  1WP7 A;  1SS3 A;  1QLE C;  4J7J A;  4ZBM A;  4GCZ A;  1MSD A;  4X62 O;  4O4L B;  5LGN A;  3ABL C;  3CCS V;  1IBM B;  3FB6 C;  1VQP V;  1FAF A;  3ZRW B;  4LFA O;  2R9A A;  4DO2 A;  4GKJ O;  2PUS A;  1KKC A;  1IXB A;  3E8F A;  4JAA A;  3R66 A;  4CH5 A;  4P9O A;  3RGB A;  4Q20 A;  1WB8 A;  2LQT A;  4YIP A;  1VQO V;  3HKB A;  3CHX A;  2Y0P A;  5KHK A;  2BE3 A;  4U3F H;  3QO5 A;  2UXD O;  1AP6 A;  4X64 O;  3ZHS A;  3ASN C;  1H2L A;  2QWP B;  1N36 O;  3LDD A;  2CTW A;  3H9V A;  1BCC H;  4PA4 A;  5H9C A;  1K4C C;  4DR3 O;  4HNA A;  5LHH A;  3CRQ A;  4XDL A;  3ABK B;  1BHB A;  4IYI A;  4GKK O;  1CXZ B;  3E8H A;  4YJ3 A;  2W0X A;  3RBZ A;  4J11 A;  2X6B A;  1FS0 G;  2GTA A;  1YIJ V;  3OMI B;  4LF5 B;  1XHX A;  2P90 A;  2PI5 A;  2CTQ A;  5KA6 A;  1XDC A;  1L0L H;  2X6A A;  1K3E A;  2EBO A;  5EBM C;  3GVM A;  2EJ7 A;  4X65 O;  3K59 A;  3CPW U;  4DV7 B;  3JD4 A;  1Q7Y W;  2QKC A;  2E75 B;  2CDY A;  4FLZ A;  1PM9 A;  2DQ3 A;  1I94 O;  4FZ1 A;  3CRM A;  2UU9 O;  2EUL A;  3N2K A;  2WLJ A;  3DC6 A;  3SJC C;  2XOK G;  4JTA B;  5A9G A;  5F2V O;  5LXT A;  3HKD B;  3OEH G;  2GUZ A;  5IYB O;  4LFC O;  4IIJ A;  1S3J A;  4AIL C;  3K79 A;  2CTR A;  3FAV B;  1GO3 F;  3O65 A;  4TQF A;  3BRC A;  1DK1 A;  4JI8 B;  4I0X A;  2Q9L A;  1H2G A;  5B1A C;  2AHZ A;  3D3Q A;  3CCU V;  4HZ3 A;  1N32 O;  1XNR B;  4MW8 A;  1RPO A;  2PYJ A;  1VQ6 V;  5CA3 A;  3E35 A;  2IU0 A;  4RAI A;  1Q8I A;  1VIB A;  2CAZ C;  3CCV V;  2B5U A;  3BPZ A;  3ZHU A;  1VQ8 V;  4YHH B;  3VQW A;  4QPK A;  3K5M A;  2L6L A;  2C2A A;  4IT5 A;  1G1X B;  2N04 A;  3SPI A;  5IT9 N;  3FX7 A;  5FL7 G;  4UCV A;  2F66 C;  2KB1 A;  4JZ2 A;  5IYC O;  1Y76 B;  2ZCE A;  3K03 A;  4FVM A;  3RYF A;  1XMQ O;  3H1I H;  2A3Q A;  1FXK B;  1GN2 A;  1AI5 A;  1UFI A;  1JNB A;  4Z1M G;  5AG2 A;  1TGO A;  1JX9 A;  3UQ8 A;  2EJR A;  2PTM A;  5FPO A;  1R6N A;  4X1Y B;  3ASO B;  1KU9 A;  4I7Z B;  3K5L A;  2LP7 A;  1FJG B;  3OMA B;  3DSQ A;  5EC1 C;  4OGQ B;  2KG7 A;  4H0L B;  1TVK B;  1K73 W;  3JAL A;  1JMK C;  5B1B B;  2WA4 A;  1QVG U;  3A0B Z;  3K0G A;  2ZKO A;  2HHH B;  5LA6 B;  5L3G A;  4NB5 A;  3U10 A;  1IXM A;  4DR7 O;  5JQG A;  3RW0 A;  5JJJ B;  3L75 H;  3SYP A;  3BCC H;  1HNX O;  2IBZ H;  4GKJ B;  2DMX A;  4H44 B;  1DLB A;  4CBC A;  1NS1 A;  3DXR A;  4K8Z A;  1N33 O;  2YI8 A;  1AJQ A;  2YUA A;  2QE7 G;  4FPP A;  4W4K A;  2GBO A;  1K97 A;  3RFR A;  4K0K O;  1N0J A;  4MW3 A;  3IGA C;  2Z3Y A;  3H1L H;  5IYZ A;  3M99 B;  3ZRS A;  1JOY A;  3WB0 A;  3BHP A;  4L8J A;  4BWA A;  2K1E A;  1OCO C;  4X64 B;  3AG2 C;  1N36 B;  4X66 O;  3L71 H;  3ZHR A;  3AG7 A;  3CCQ V;  2K9P A;  1BT8 A;  1RSO B;  1OV9 A;  4LC1 A;  4TT3 G;  2F43 G;  1NTZ H;  2QKS A;  4E4E A;  2VQE O;  3VQV A;  4NTX A;  1AVM A;  2GV9 A;  1N8R W;  1MZE A;  5GW7 A;  1NT2 B;  1KB9 F;  5KUM A;  2RDC A;  3SYQ A;  2JK5 C;  5JVD A;  4DUZ O;  4QNH B;  3SYO A;  2YSU B;  4MVM A;  5BXZ A;  4J7K A;  4JAU A;  3CS5 A;  2F93 B;  1KQS U;  3ZS8 C;  1Q81 W;  5GON B;  1I94 B;  4KUM A;  2UXC O;  3MDS A;  1R3K C;  3OTF A;  2VS0 A;  1FXV A;  3CME V;  4R7C A;  1JPX A;  2BOB C;  5LL6 Y;  5IYD O;  2G38 A;  3QNE A;  3HB3 B;  4I50 B;  2JGU A;  1KYO F;  3E22 B;  4LFC B;  2Y4T A;  1FOU A;  1OHH G;  4HBN A;  1Y4M A;  4LF9 O;  4O4L A;  4LFB B;  3BAB A;  1HR0 O;  4PDR A;  3EXA A;  4DK1 A;  1N32 B;  1G8M A;  2ADP A;  3ZRW A;  4ZIB A;  4DR2 O;  3AG1 C;  4UV9 A;  4PV1 B;  4B08 A;  5KX5 B;  3I56 V;  4JI4 O;  4RWU A;  1N4C A;  1VEW A;  2UUB O;  4AQY O;  2AZ0 A;  1V55 C;  2A79 B;  1QR9 A;  5JWP A;  2FML A;  3JAT B;  4MVQ A;  1MZF A;  1LNQ A;  1Q90 D;  3DC5 A;  3BA9 A;  1XMQ B;  2WLK A;  3JAK B;  4B7K A;  3B8N A;  3P32 A;  4BIZ A;  1THZ A;  1I5Y A;  3W7W A;  3P3N A;  4MTG A;  3STL C;  4DV4 B;  1M57 C;  2F4V B;  3H1J H;  3BA8 A;  2YIB A;  4TQD A;  5CBH A;  2A9H A;  3P3P A;  3SPH A;  3FYE B;  3E8G A;  2A06 H;  4GYC B;  4OX9 O;  1JQ0 A;  2P4K A;  4MTO A;  4O4I B;  1OCC C;  4P2Z A;  3JD3 A;  5LP6 B;  4DR7 B;  4DW0 A;  3FFQ A;  2QKA A;  3G4S V;  1HNX B;  2PGG A;  1PV0 A;  5IJ9 B;  2QTO A;  1AI7 A;  5LMN B;  1N33 B;  1ZUQ A;  3AK1 A;  1VQ7 V;  1KC8 W;  3S3X A;  1FPO A;  2UXX A;  3HKE B;  2ZXW C;  1VQ4 V;  1YIT V;  2QM8 A;  5KHH A;  4BW5 A;  4GX0 A;  3K5N A;  4LF5 O;  1FD9 A;  2IH1 C;  4I5S A;  2ZM6 B;  1Q43 A;  1GTO A;  1XRE A;  5JCO A;  1Z5W A;  3L70 H;  4X66 B;  3HKD A;  3QTC A;  2JEX A;  3APO A;  3DXR B;  3C3T A;  3FAV A;  3JYC A;  4JI1 O;  2DWD C;  3APQ A;  1I08 A;  1LUW A;  2VQE B;  4JI0 B;  2BCC H;  3A2F A;  2H94 A;  1AJP A;  4Z2W A;  2O57 A;  2LGQ A;  2ODM A;  3SJB C;  2M7W A;  4UVC A;  1VF7 A;  3ZMU A;  1QHT A;  1YI2 V;  4JI7 O;  4J7Z A;  4LWS B;  2OCC B;  3K06 A;  3WG7 C;  1SQX H;  2EIL C;  1FYJ A;  3K5O A;  1H8E G;  3BY6 A;  1SQP H;  4DV6 O;  3T1Y B;  3CSX A;  4QGP A;  3E86 A;  3ABU A;  3F7Y C;  1QNM A;  2BTQ B;  2ZNI A;  1M56 B;  3WB2 A;  3DTU B;  3W7T A;  1FXK A;  1OCR C;  1WNS A;  4F4L A;  1XNR O;  3MD0 A;  1CPY A;  2UXC B;  2EIM C;  4UVA A;  2WLM A;  4X1Y A;  4CC6 A;  3WB1 A;  1T5E A;  1N34 O;  3K3W A;  3ETG A;  4PI2 A;  2NN4 A;  3KCX A;  2DW4 A;  4LF9 B;  2YDE A;  1RM1 B;  5CA0 B;  2QM4 A;  1TVK A;  4X20 B;  5IY5 C;  3D3I A;  5CB4 B;  4JAS A;  5LA6 A;  2E74 B;  2HG5 C;  2F1M A;  5KAF Z;  4U3J B;  4H33 A;  3ZHT A;  4PHZ A;  4DR4 B;  3JAR B;  4EKW A;  2RQ6 A;  1Q5O A;  4I4T B;  1SA0 A;  2XAF A;  4FM2 A;  3SPG A;  1YTF B;  2ZIM A;  1IBL B;  2JRI A;  2ZQM A;  2HHH O;  2LFR A;  2ZE5 A;  4B3T B;  4WFG A;  4PJ0 Z;  2AGA A;  2YIB D;  4CH6 A;  2F95 B;  4DR6 B;  4F6E A;  2B1G A;  2BSK A;  5H6Q A;  1OCC B;  1SC5 B;  3JD0 A;  1RSO A;  3CC4 V;  4JYC A;  4BIU A;  4G28 B;  1F7Y A; 
#chains in the Genus database with same CATH homology
 4JZ2 A;  4JZG A;  3IC9 A;  2CE4 A;  3TJT A;  1QNM A;  1I0H A;  1GN2 A;  3LSU A;  5AG2 A;  3CEI A;  1EN6 A;  1XUQ A;  3KKY A;  1XIL A;  1EN4 A;  2P4K A;  1P7G A;  1XDC A;  4BR6 A;  3OT7 A;  3QVN A;  1EM1 A;  1GN4 A;  1ZSP A;  2QKA A;  3MDS A;  4X9Q A;  1D5N A;  4GUN A;  1ZLZ A;  1PL4 A;  2QKC A;  2CDY A;  1GN3 A;  2GDS A;  1PM9 A;  1AR4 A;  1IX9 A;  1MSD A;  4YIO A;  1ZUQ A;  3RN4 A;  3K9S A;  3AK1 A;  2ADQ B;  3KDR A;  4FFK A;  1AR5 A;  1LUV A;  3DC6 A;  5A9G A;  1JR9 A;  2ADP A;  3EVK A;  1XRE A;  1KKC A;  1N0N A;  1IXB A;  1Y67 A;  1N0J A;  1MA1 A;  3BFR A;  4JYY A;  3AK2 A;  1MMM A;  4C7U A;  3C3T A;  1SZX A;  1VEW A;  1IDS A;  1WB8 A;  1VAR A;  4YIP A;  1I08 A;  1LUW A;  3AK3 A;  3C3S A;  1JA8 A;  1AP5 A;  1WB7 A;  1EN5 A;  1BS3 A;  1BT8 A;  1BSM A;  2AW9 A;  2RCV A;  3DC5 A;  1AP6 A;  4F6E A;  1ZTE A;  1B06 A;  4E4E A;  1MNG A;  1GN6 A;  1AVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...