1AP6A

Tyr34->phe mutant of human mitochondrial manganese superoxide dismutase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Crystal structure of Y34F mutant human mitochondrial manganese superoxide dismutase and the functional role of tyrosine 34.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ap6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ap6A02
1B06A 1ZUQA 1PL4A 4X9QA 3K9SA 3DC5A 4JYYA 4YIOA 1EN5A 1WB8A 1AR4A 1LUVA 2ADPA 3LSUA 3QVNA 4JZ2A 1AR5A 1BS3A 3BFRA 1MA1A 1MNGA 1LUWA 3TJTA 1ZLZA 1PM9A 1XUQA 1EM1A 3MDSA 1VARA 3EVKA 1D5NA 3C3TA 1SZXA 3OT7A 4GUNA 2AW9A 1BT8A 3RN4A 2GDSA 3AK3A 1AP6A 3AK2A 1GN3A 4JZGA 4BR6A 1I08A 1ZTEA 1QNMA 1P7GA 1IXBA 1GN2A 4E4EA 1I0HA 1XDCA 1BSMA 1WB7A 3AK1A 2ADQB 1JR9A 5A9GA 1IDSA 2CE4A 1EN4A 5AG2A 3C3SA 4FFKA 1AVMA 1N0JA 3DC6A 4F6EA 1GN6A 1ZSPA 4YIPA 3IC9A 1IX9A 2QKAA 1JA8A 2P4KA 1Y67A 1KKCA 1XILA 1VEWA 1GN4A 3KKYA 3CEIA 2QKCA 1EN6A 4C7UA 2RCVA 1MSDA 1N0NA 1AP5A 1MMMA 1XREA 2CDYA
chains in the Genus database with same CATH superfamily
2KSDA 1M90W 2QM8A 1KU9A 3MAQA 4DV3O 2ADPA 3R66A 3SGIA 4GKJO 3K5NA 2YICA 2YDEA 1VQLV 1RSOA 2RDCA 2ARHA 4DYLA 1SZTA 4IL6Z 3X2QB 1RP3B 1EM1A 5IY5C 2EULA 4IHJA 3P30A 2YIDA 3M8AA 4YY3O 2MK3A 4DV6O 4FPPA 3ABKC 4K0KO 3STZC 2B1IA 1DF4A 3JSLA 1NR7A 4CZZA 2CTWA 1MOFA 3P3PA 4DUYO 4FLUA 1KECA 4JGSA 1AI7A 1V55C 1AP6A 1NI8A 1S76D 4BR6A 2GUZB 3TETA 2ZINA 1MABG 4X1IA 4DV7B 4QPKA 1GN2A 4HBNA 2HJDA 4ZBMA 1H2LA 5KHIA 2PUSA 4UCOA 4P30A 1HR0B 1NR1A 4O2BA 3ABLC 1VF5B 2FYUH 5H6RA 1VQ7V 1XL4A 2DYRB 3D8CA 5L3CA 4RQFA 4X88A 2IJKA 2EIJB 2LFSA 1RPRA 2EINC 2LFRA 3U0ZA 2W6IG 5B1AC 4DV7O 3RW0A 1VEWA 4X65B 1FXKB 2DJVA 2DQ0A 2A7WA 1HR0O 2JGDA 1VQ6V 1N0NA 4NTXA 4GX5A 1SA0B 5CA0B 1XREA 1OJHA 4JYYA 3LDDA 4UB8Z 1SQGA 2CGNA 3LSUA 2KQXA 1ZL8A 4MVMA 2EIKB 2Q7HA 1FFTB 3ZHRA 5JVDA 3EFFK 4TQDA 5C8YA 1DK1A 5KA6A 4X65O 3ASNC 3JARA 1LR1A 2ZIOA 1GH6A 2LGWA 2JVDA 4NXMB 1E79G 4MVZA 2DWDC 1N8RW 5JQGB 1BT8A 2R72A 1Y76A 2PI5A 4X1YA 2A3QA 4UUJC 4JZGA 3TXQA 1S72V 3CS5A 1R6KA 1JX9A 1ZTEA 1IZ3A 4O2AB 4ZHQB 4DV4B 5D5PA 4R6ZA 3ZRSA 4HNAB 3SPHA 1K5QA 4NXMO 1P84F 1IDSA 5GONA 1A32A 2ILMA 3FB6C 3HR0A 4K3AA 3OTOB 2QWPB 3JALB 3FKSG 3ASOB 2B5UA 1TGOA 4LWSA 1VQ5V 4U3FH 3NXSA 2F66C 5EBLC 3T1HB 3K58A 1G4YB 5KHJA 2DW4A 1XILA 2H3OA 3A8TA 4DV4O 1IVSA 1M56B 1NS1A 5D5QA 3RVZA 5K1PA 4K8XA 2CDYA 4IYIA 3FFQA 1HNZB 2DOSA 4YIOA 3BY6A 1VQ9V 2P67A 2UU9B 4RUFA 2XTAA 1YXBA 3OTOO 1S77D 2AZ0A 1PV0A 3BFRA 3DTUB 1N4CA 4RO2A 4DW1A 1AI5A 3AG1C 1LUWA 4JF3A 4EB6A 3SYCA 2YS8A 3VOUA 3T1HO 3B77A 2WA3A 4J11A 4J7KA 4CS4A 4EEQA 1KD1W 2P5OA 2W6JG 1URFA 1OCOC 1AI4A 3AG2C 2E75B 4PDMA 5EK0A 3W7TA 3CCJV 5F2VO 1L0LH 1JQ0A 4OX9B 3TK1A 4CH4A 4I0XA 1HNZO 1BGYH 2UXBB 4MVSA 2UU9O 1DTOA 3N27A 4I50A 4PA3A 4AHCA 3JASA 1JCHA 1TVKB 4IYHA 3UT5A 2EX3A 1DF5A 2ADQB 2CH7A 2ZXWC 4I5SA 4JAVA 4UCUA 5ITZB 3X2QC 4B3MB 3QF7A 5LGUA 1CP9A 3OUFA 2EJ7A 1AROP 1XMOB 2HLDG 1BHAA 4OX9O 3FYIB 1WLEA 2GTAA 5B3SB 2UXBO 1G8MA 4X20B 3CJHB 4LCUC 1K5SA 4LF4B 2ZNJA 3ZJZA 1I94B 2IJIA 5CA1B 4KUMA 2OT5A 4O4IB 2JEUA 1VP7A 2YXYA 3KZIZ 4XDLA 2Q67A 1SQBH 2LP7A 1FPOA 2YUAA 4DV0B 3CYOA 1YZBA 1TAEA 2JGUA 4I55B 1SQFA 3STLC 2ZM6B 3AG7A 4NTWA 2QGNA 4B3MO 3SYQA 1JJOA 4DR6O 1XMOO 1IBKB 4FM0A 3QVNA 2WA4A 5LA6B 3HKDB 4TUYA 2WLMA 3FD9A 2DYRC 1FJGB 4ZOLB 4GX2A 3UKMA 1PM9A 3CPWU 1F4NA 2EZOA 5J2UA 4LF4O 1I94O 4IIJA 3I5DA 3EVKA 2RJZA 4QPJA 3RWRD 4WF9V 3Q4HB 2YXHA 2D3OW 3ZMZA 4DV0O 4DR5B 2DYSB 2V4DA 3L70H 2Y0IA 3JAWB 4JYCA 1HW7A 2IJHA 5IJ0B 4NR1A 1IBKO 2YEVA 2Y0PA 2ZE7A 4CS2A 4JAAA 4O4HA 1IBLO 2Z5UA 1FJGO 1QVFU 1IXBA 5IT9N 1BSMA 2A0LA 2PYLA 3E22B 3ABMB 4TV9A 1K92A 3ZIAG 3HKEA 4KL1A 2IM9A 1HNXB 5GW7A 4DR5O 1H8EG 1WPBA 4I9WA 1V54B 4ZI7B 2Q7EA 3P32A 1YTFD 2Y4TA 4EFBA 3C3SA 4TV8A 1AVMA 1W0KG 3AG4B 1FFXB 2QE7G 3SYAA 1BMFG 5JH7B 4YHHO 1ZSPA 2EILC 4J41A 3VBBA 4UCRA 2K9PA 3MD0A 2RMKB 2HFEC 5JCOC 2QSAA 4DW0A 2ETNA 1HNXO 1KQSU 3F5WC 3P3NA 4UV8A 4R8CA 4TQFA 2HVJC 1VQMV 3SDLA 1X59A 3T2MA 3AG3B 1AR5A 3I56V 4R7CA 3A0BZ 2VQEB 3ZHVA 3ETDA 4IGGA 1ZWIC 2BTQB 5H2FZ 3VQXA 4EFEA 3CRRA 2JJ2G 4KXRA 2OIGA 2WSSG 1EZVH 4IT5A 2WLLB 3THOA 2CUGA 2OCCB 3HKBA 1NVPD 3RYCB 3WB1A 4K8ZA 3B40A 1M56C 4Z2WA 4F6RA 5EIBC 3SYPA 1XMQB 3H1HH 3E8FA 5DEDA 3VQYA 2CGOA 2F1MA 3FX7A 5KHGA 1K4DC 3FB5C 1U97A 1R3IC 2VQEO 4WFFA 1FS0G 3E8BA 1SESA 4FFBA 4CH3A 2D2CB 2GHYA 2CTQA 2VWJA 2NN4A 3CD6V 1YEWA 1M1KW 4U3JA 3UO2A 4B7KA 1XOUA 1XMQO 1Q90D 3G67A 5J2TA 2YXLA 2EIMB 3ZMTA 3F7VC 2QKAA 3CMEV 3WG7B 1P49A 4J80A 3JAKB 1EN6A 4H37A 3ZRWA 4J7JA 2XNDG 2RCVA 1P4RA 5BZBA 1GRJA 3HKCB 4LNUA 2P06A 3CC7V 3SJCC 5JJJB 3KG2A 4PA9A 3G4SV 4BIZA 1VF7A 1H2SB 4X1KB 1QR8A 2YIBA 5EBWC 1YJ9V 3JD0A 5BMVA 1BZKA 4JZ2A 1Q7YW 4BWAA 2FB5A 3CXHF 3CC2V 4DV2O 5E1AC 5KHKA 2XASA 5B3SC 3DXRB 4RQEA 5CB4A 3OMIB 5EBMC 5JJNB 3W7XA 1G1XB 2P6JA 2Y4UA 5LP6A 3CCEV 3OT7A 4A5UB 2OYQA 2QM4A 2HVKC 4GUNA 2OCHA 5KA5A 2KG7A 4J42A 1PNLA 1FXHA 2HEPA 1N33O 4FJCC 4WFBV 1WN7A 3ZRVA 1OCCC 1YJWV 2IH1C 3K0DA 2A06H 3E89A 5LYJB 1I7FA 1GTOA 4LF5B 2QEXV 5KMGB 3ETQA 2B9ZA 1VMGA 2ZNIA 1K9MW 3UQ8A 5HFLA 2X6CA 4DUZB 4LFCB 3I55V 3ZCCA 4KFMA 1GM8A 2E74B 2LQTA 2UXDB 1WAZA 3MHSC 4D7SA 4LP8A 1W0JG 2PZSA 2RN9A 3M7MX 3B4SA 2OTJV 3K03A 1VF6C 5DM6V 1KB9F 1IX9A 5IYZA 2HR3A 2JRIA 5B1BB 3JYCA 3E83A 1Z2GA 4JYAB 3KCYA 3KKYA 4LF5O 2IBZH 3CCLV 2A9HA 1QLEC 4LH6A 2H8PC 1JFFA 4MTGA 4DUZO 4LFCO 4GZRB 5EZYA 3N2GB 5GTIZ 1AI6A 1XQ8A 2UXDO 4U7OA 2E5LB 3ZS8C 3ZRXA 4CS3A 5IDJA 1H8HG 1Y74B 4KP4A 2PF4E 4DR7B 1BCCH 1THZA 1Y66A 1ZLZA 2F43G 1WA8A 3OGCC 5FNVA 1M5IA 1Q43A 3ZX6A 4DRXB 4PD4F 4W4KA 4JYAO 3K5MA 2DQ3A 1PKXA 1AJNA 2ZR2A 1Q6IA 4MVUA 4L8JA 3E2EA 4ICGA 1TA8A 3C90A 2NLJC 2PTMA 1XNQB 1SRYA 2IJJA 4HZ3A 4PV1B 4JI0B 4BAYA 2XHBA 1GN3A 1Q3EA 3QO5A 1QVGU 2N04A 4UV9A 1KP2A 2E5LO 4I4TB 3QO7A 1QNMA 4DR7O 3JATB 5L3BA 1YITV 5LYJA 4FZ0A 1I0HA 3AG3C 4B3RB 4QE9A 2MW2B 2R70A 2WLKA 3PN1A 5J9PC 2Y69B 4LF6B 4FLTA 4LF7B 2QTSA 1SF9A 2HHHO 2GUZA 3BEHA 2CE4A 1B04A 1XNQO 3G71V 5LP6C 3GWOA 4LC1A 4JI0O 1K97A 5LHGA 5IYBO 3KCXA 4D7TA 1IURA 3IC9A 4FLVA 3ZHSA 3B8NA 2QKCA 3T4DA 4B3RO 2IW5A 4FM2A 3CE2A 1T5EA 4YJ2B 5LHIA 1CEZA 2L35A 4LF6O 2BCCH 2UUCB 3K5OA 4LF7O 5IYDO 1ZUQA 4ASUG 3RGBA 1H2NA 2QTOA 1WP7A 2GSMB 5IJ9B 1OCRB 3HPLC 1NT2B 3EHBB 3OUSA 1FXKA 1UFIA 2CK3G 3OAAG 4FMTA 3CB2A 2P4VA 3QG5A 1N34B 2Q8VA 2VRZA 1H38A 4LF9B 2JJ1G 1SA0A 5EC1C 5CA0A 1QCEA 1D5NA 3W7UA 2R9RB 2EIMC 1M93A 3RYHB 4I9QA 4DK1A 2YI9A 3UM7A 4UXNA 2UUCO 3S3WA 1R3JC 4GKKB 2Y48A 4PI2A 5K1XA 5B1OA 5B66Z 5KUMA 1P7GA 2XAGA 4H33A 4H0LB 1GO3F 3OEHG 1N34O 1B6QA 2QWQB 2EJRA 2DE0X 1FYJA 1I5YA 4FM1A 4LF9O 2AZ2A 5JQGA 3G6EV 1YTFB 2Q68A 4WCEV 3OW2U 4OGQB 5B5EZ 2XT9A 3SR2C 4N23A 5LXTB 1Q81W 2ZE8A 2A79B 5JCOA 2JDIG 5KUKA 3D3IA 3KDRA 2JIZG 2ZE6A 3IGAC 4O2AA 2P7TC 4GKKO 4ZHQA 4MVQA 4YIPA 4HNAA 4PELA 1YVWA 1KKCA 2AHYA 1BE3H 4NYKA 4NVPA 1O9HA 2PGGA 3ZMVA 3BVOA 3K04A 3RYFB 4DR6B 3FAVB 3ZMSA 1F51A 4FLYA 3JALA 5IWAB 3VQWA 3UCSC 3CCRV 1KMIZ 2W0XA 1AR1B 2UUAB 4UB6Z 5A2QN 3CRAA 1WPXA 1OCZB 2CTRA 3JCUZ 1XEQA 3CCUV 1L0NH 3J81N 1VARA 3GB7C 3APOA 1NKDA 2Z0AA 3UO3A 1X4TA 4AILC 5EYPB 5B1BC 4JI8B 1KBHA 2G38A 4KHPO 5IWAO 2WLIB 3RN4A 2BOCC 2Q73A 2WAMA 3H1LH 1IBLB 2AHZA 1J5EB 3GVMA 2UUAO 2FL4A 2FKXA 1K7DA 1I08A 2EIJC 5L3FA 4F4LA 4FLZA 3OGIB 1EZJA 1RM1B 2IH3C 3E86A 2ZIMA 3ABKB 4JPRA 3WU2Z 3JAMN 1FXKC 5KHHA 2QWNB 1UJWB 5BR8B 4JI8O 4LBEC 4YHHB 2JS3A 1TVKA 1R3LC 1HDJA 4O4JB 3OTFA 4YJ3B 1VQPV 3BAAA 5LOVB 1KYOF 5H9CA 1J5EO 4DK0A 1N0JA 1M9NA 5CBGA 5EIBD 1KC8W 3SPGA 2P4KA 1F7YA 1W2BU 5ITZA 1S5HC 2BOBC 1N32B 3ABLB 3L73H 2EIKC 5BY1A 4GYCB 5KX5B 5JJEB 1JJ2U 4H13B 2OIEA 1Q8IA 3N2KB 3TXSA 4DR4B 4PJ0Z 5EC2C 3K0GA 3D36A 3K06A 4QGPA 5BR8O 4X20A 3CJHA 1UPGA 1XL6A 2H94A 2X7RB 5CA1A 1AJQA 4JTDB 1HNWO 1VQKV 2XOKG 4O4IA 5B1AB 4HAMA 4FZ1A 3LDCA 2M7WA 2XAJA 3WB0A 1S3JA 1ZX3A 1NTKH 4I55A 2VS0A 1Q6UA 2WLNA 1N32O 4FLWA 4QE7A 4ZKIA 3ZHQA 4DR4O 1SETA 3T1YB 3ETGA 5LA6A 4UVAA 3RFRA 3HKDA 2WLJA 4JYBA 2YIAA 3IAYA 1TUBB 4ZOLA 5CN0A 4L87A 1R73A 1YCIA 3CCQV 2F4VB 2F93B 3F5TA 5JWPA 3ASOC 4WFEA 3H1IH 3Q4HA 3CSXA 5H5NA 4FK5C 1OCRC 3AEIA 3ASNB 1WB7A 2IU3A 3JAWA 2K1EA 1VF6A 3RYIB 1R6NA 4G27B 5IJ0A 5FPOA 3T1YO 2BSKB 2P22C 4LR3A 3G6BA 4O4LB 5BXZA 4JI3B 1YJNV 1JPXA 1WNSA 4WBNB 4WFGA 3LSQA 2F4VO 3E22A 4MW8A 4D6TH 3JD4A 1QR9A 1Y67A 2ZE5A 5LGTA 1GN4A 1FOUA 1RSOB 4X64B 3ICXA 4GX1A 4JV5B 3JSNA 4ZI7A 2ZD9A 4ABMA 1FFXA 4IHJB 1YDXA 4MW3A 4CBCA 5JH7A 2ZR3A 1R3KC 2XAHA 1BHBA 3J80N 1EFRG 4DV2B 2UXCB 4JI3O 3ZHUA 1BS3A 2R9AA 4B08A 4XDJA 3SJBC 5DN6G 3WFVA 1NZ6A 3A0RA 1XUQA 4DV5B 1JMKC 3LSSA 2F95B 1Q86W 4JI1B 4X1IB 3BA9A 3ETEA 4CC6A 4X64O 4JV5O 2X6AA 4TOIA 4UFZA 1Q82W 4FLXA 1N33B 2AW9A 2M6YA 4O2BB 5FL7G 3AK3A 2QWOB 2BTQA 2UXCO 4LF8B 3D36C 1Y4MA 2B1GA 2GV9A 3U11A 1QQCA 2KKWA 2WLLA 2LJ2A 1COWG 3M99B 1OCZC 4YXWG 4DV5O 1OCOB 5B1NA 3ZEDA 1JR9A 1QBZA 3RYCA 4MTOA 1CXZB 4JI1O 1NTZH 4Q6GA 5CBFA 1WJZA 2JGDB 2Q7GA 3OE7G 3PJSK 1IJGA 1L8DA 3H9VA 3ZBHA 4HYOA 3NR7A 4CC5A 1NH2D 2KB1A 4F6EA 1VQ4V 1M57B 4PDLA 4LF8O 2VQFB 3CRCA 1ZAUA 1CPYA 1E1RG 1OZ0A 1PPJH 4J10A 3DSQA 1ZL8B 2ZXWB 2ZT9B 3CRMA 2QWRB 4UVBA 4LH7A 4JTCB 1MSDA 5JVDB 1Z5WA 2Q9LA 2YIBD 5C8YB 1RM1C 3SPJA 2DMXA 2DYSC 3JARB 5DECA 3ZMUA 1EN5A 4P9OA 1WB8A 4UVCA 3CMAV 5KAFZ 3JAKA 4OPHA 4PHZA 1Y76B 3L71H 4MVOA 5L3EA 4X1YB 5LGNA 4DO2A 2VQFO 3HKCA 4UCVA 1YI2V 3B09A 1G6UA 4MT8A 4X1KA 2Q6AA 3ABMC 3H1JH 1OV9A 4OXSA 3CCVV 3CRQA 1K4CC 5TISZ 3ZHTA 1SC5B 1FXVA 1GKFA 1BL8A 1V54C 1GM7A 5GONB 2LW7A 1BQ0A 3DXRA 3WB2A 3AG4C 4B7EA 1VIBA 1H2GA 2UXXA 1SQXH 1XDCA 3ABTA 4AQYB 1JOYA 3L9DA 1H2KA 4LWSB 4E2LA 2HHHB 2HJFC 3FB7C 5L3DA 4MTFA 4BW5A 4GCZA 4PDRA 2WWWA 1K8AW 1WP8A 3O65A 4K35A 1Z5VA 3K59A 1MG1A 3D3QA 4U7NA 5KMGA 3LDEA 1SS3A 1JA8A 1FD9A 3EXAA 1D5AA 3H1KH 3BRCA 1NTMH 3CP1A 4AQYO 3ABUA 4EB6B 2ZKOA 3IJ4A 2BTOA 4QIWF 2AXTZ 3QNEA 2DN9A 2FTKA 1GAXA 2Q5ZA 3CCSV 1B06A 4X9QA 2OCCC 3OEEG 1XBLA 2CTPA 1AR4A 2EZPA 3L72H 2JEXA 1YIJV 3K79A 2EILB 5IYCO 3L75H 3TJTA 4I0XB 3OFNG 3FB8C 3MDSA 4JI6B 1HP8A 4DR3B 4I50B 2WPDG 1PD3A 1VQOV 3JASB 3BCCH 1Y6XA 3UT5B 3N2GA 1D2DA 2QDOA 3J7AU 4N21A 3RBZA 1Y74A 1GM9A 2CH7B 3SYOA 2ZQMA 1J95A 4WFAV 2GDSA 2E76B 5IE9A 2PY5A 4DRXA 5FLXN 4Z1MG 2Q4PA 1H2MA 1SQPH 1XNRB 1NQTA 4CH5A 4JI2B 2RNBA 5LMNB 5GTHZ 4LFAB 2L6LA 1AJPA 2CAZC 2WLHA 4JI6O 3AK1A 3FYEB 4DR3O 1L1FA 1SQQH 3WG7C 4JI5B 2QR4A 4B3TB 3B8MA 4XBFA 4B3SB 4JI7B 3APQA 3R65A 1M4UA 2F23A 1RPOA 5A9GA 1ROPA 4I4TA 2ATKC 1EN4A 2LW1A 2XUMA 3JATA 4MVRA 1ORQC 2V7QG 5C93A 1PL0A 3ZN0A 4X62B 1YHQV 2QJ1A 1FAFA 1XNRO 5LHHA 4J9ZB 4JI2O 3SJQC 5LMNO 4TUYB 4LFAO 3U10A 2HKOA 4R50A 4C7UA 4X66B 3TGUH 5J2UB 4JI5O 4DV1B 4B3TO 4GT1A 1DGSA 4B3SO 4I7ZB 4JI7O 4IIJB 4MTXA 1TUEB 5KLVH 4XDKA 2EBOA 1QHTA 3RVYA 3K9SA 2P90A 1R1BA 1Q6HA 5L3GA 1S5JA 4PA7A 1MA1A 4NKGB 4H44B 4X62O 1VQ8V 1P7BA 4YJ2A 2YEVB 1OHHG 1DLBA 4KHPB 4O4HB 3C3TA 1M57C 2E3CA 3CX5F 4OPAA 3TCUA 3H01A 4X66O 3S3XA 1SQVH 5IJ9A 4DV1O 5FPRA 3JD1A 2C2AA 4TV9B 1Q5OA 3HKEB 4MSWC 3VQVA 4W4LA 2YSUB 1XHZA 3LUTB 2HP8A 4X89A 1NVPB 4PA4A 4TV8B 3RYHA 1KP3A 4DXWA 1HWYA 4P2ZA 2QKSA 1W59A 3CCMV 4G28B 3CXCU 2ODMA 2XAFA 1MSWD 4JTAB 3IFXA 3OM3B 3W7SA 4JASA 2NR5A 1QU7A 3DGEA 5AG2A 5IY5B 1OCCB 1S0VA 1JVMA 3K3WA 4NXNB 3T1CA 3ZN1A 4FVMA 5CMUA 5CA3A 1KUQA 4TSFG 4Z1VA 2X6BA 1U96A 5LXTA 1PNMA 2ITCC 4GX0A 2QM7A 1V55B 1HNWB 2R9IA 3LNNA 5CBHA 2HG5C 2N74A 5LMUB 3DC5A 2Z3YA 2ZDIA 2ZM6O 3OR6C 1LUVA 3OR7C 2UXNA 2OTLV 1IBMB 3HKBB 1GMGA 4F6RB 4NXNO 3ML0A 3RYFA 3FAVA 1V9PA 4BIUA 1E1QG 1EBOA 1IXMA 4AI8A 1QLEB 1SZXA 2V1DA 2EINB 2O57A 1AB3A 4FFBB 2XAQA 2Y69C 4TWKA 5LBQA 5LMUO 4TT3G 2Q0AA 4ZIBA 4DR1B 5LL6Y 2JK5C 1K3EA 3F7YC 2VWKA 1MZFA 5E79Z 1IBMO 3K08A 4RUEA 4U3JB 1NBMG 4E4EA 3OMNB 3SPCA 4LFBB 2NNUA 5EYPA 1LNQA 2X0LA 5J2TB 1AILA 4QNHB 2WLIA 3CC4V 3L74H 4J7ZA 1SERA 2ZCEA 1NH2B 3LNMB 4G2KA 3ZRWB 1XHXA 3A2FA 2FMLA 4LNUB 1K73W 3BA8A 3E8HA 4DR2B 3DC6A 2YI8A 4DR1O 3HB3B 2BE3A 3JCZA 4RAIA 1GN6A 2W0FC 5KAIZ 2RQ6A 1YF2A 2N05A 3IC7A 2AGAA 3G80A 1JNBA 5BMVB 4WFHA 5HFMA 1PNKA 4LFBO 3T4ZA 2JS5A 1YSCA 1PP9H 3BHPA 4BIOA 1XI1A 4X8AA 4O4JA 4YJ3A 5LOVA 1MZEA 4BW9A 1S5LZ 1AP5A 4PA6A 2LGQA 5CB4B 1QLNA 4UCSA 5LP6B 1NU1H 1PL4A 1H5WA 1SKVA 4NTYA 1NJIW 2Q69A 1US6A 4DR2O 1MNGA 4PDVA 1O9GA 5KX5A 2ITDC 5H6QA 3A0HZ 2KG7B 3N2KA 3K57A 4UCTA 2GTSA 1F4MA 4J9YB 1I5XA 3E35A 4FIPC 1ENVA 1R6TA 3SPIA 3BABA 3K5LA 1N36B 1FKAO 3SJAC 1KKDA 4PI0A 3AK2A 4RWUA 3QTCA 2UUBB 2LO1A 4JI4B 2QA4V 4MS2A 3CHXA 2GBOA 2ZDIC 3QO8A 1GK9A 3RT3C 3GWKC 5IYZB 2Q0OC 4GLXA 1BQZA 3OD4A 1TUBA 2YC0A 3B2EE 3K9AA 3JD2A 3OMAB 1B3QA 4EKWA 3AG1B 3E8GA 1N36O 3O9OA 4DV3B 2OWOA 4GKJB 2IU0A 4FFKA 2PI4A 3BPZA 1K34A 1JFFB 3CWBH 3MHHC 4Q20A 5EZYB 2PYJA 4CH6A 2UUBO 4JI4O 3AG2B 3RYIA 1K33A 4NB5A 4QJFB 1RFYA 3CEIA 4YY3B 4DV6B 2DWEC 2BSKA 4K0KB 1VQNV 1WA8B 3JD3A 4O4LA 5FNVB 4P9PA 1F23A 4JAUA 4DUYB 1MMMA 4WBNA 3W7WA
chains in the Genus database with same CATH topology
1B06A 1ZUQA 1PL4A 4X9QA 3K9SA 3DC5A 4JYYA 4YIOA 1EN5A 1WB8A 1AR4A 1LUVA 2ADPA 3LSUA 3QVNA 4JZ2A 1AR5A 1BS3A 3BFRA 1MA1A 1MNGA 1LUWA 3TJTA 1ZLZA 1PM9A 1XUQA 1EM1A 3MDSA 1VARA 3EVKA 1D5NA 3C3TA 1SZXA 3OT7A 4GUNA 2AW9A 1BT8A 3RN4A 2GDSA 3AK3A 1AP6A 3AK2A 1GN3A 4JZGA 4BR6A 1I08A 1ZTEA 1QNMA 1P7GA 1IXBA 1GN2A 4E4EA 1I0HA 1XDCA 1BSMA 1WB7A 3AK1A 2ADQB 1JR9A 5A9GA 1IDSA 2CE4A 3KDRA 1EN4A 5AG2A 3C3SA 4FFKA 1AVMA 1N0JA 3DC6A 4F6EA 1GN6A 1ZSPA 4YIPA 3IC9A 1IX9A 2QKAA 1JA8A 2P4KA 1Y67A 1KKCA 1XILA 1VEWA 1GN4A 3KKYA 3CEIA 2QKCA 1EN6A 4C7UA 2RCVA 1MSDA 1N0NA 1AP5A 1MMMA 1XREA 2CDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B06 A;  1ZUQ A;  1PL4 A;  4X9Q A;  3K9S A;  3DC5 A;  4JYY A;  4YIO A;  1EN5 A;  1WB8 A;  1AR4 A;  1LUV A;  2ADP A;  3LSU A;  3QVN A;  4JZ2 A;  1AR5 A;  1BS3 A;  3BFR A;  1MA1 A;  1MNG A;  1LUW A;  3TJT A;  1ZLZ A;  1PM9 A;  1XUQ A;  1EM1 A;  3MDS A;  1VAR A;  3EVK A;  1D5N A;  3C3T A;  1SZX A;  3OT7 A;  4GUN A;  2AW9 A;  1BT8 A;  3RN4 A;  2GDS A;  3AK3 A;  1AP6 A;  3AK2 A;  1GN3 A;  4JZG A;  4BR6 A;  1I08 A;  1ZTE A;  1QNM A;  1P7G A;  1IXB A;  1GN2 A;  4E4E A;  1I0H A;  1XDC A;  1BSM A;  1WB7 A;  3AK1 A;  2ADQ B;  1JR9 A;  5A9G A;  1IDS A;  2CE4 A;  1EN4 A;  5AG2 A;  3C3S A;  4FFK A;  1AVM A;  1N0J A;  3DC6 A;  4F6E A;  1GN6 A;  1ZSP A;  4YIP A;  3IC9 A;  1IX9 A;  2QKA A;  1JA8 A;  2P4K A;  1Y67 A;  1KKC A;  1XIL A;  1VEW A;  1GN4 A;  3KKY A;  3CEI A;  2QKC A;  1EN6 A;  4C7U A;  2RCV A;  1MSD A;  1N0N A;  1AP5 A;  1MMM A;  1XRE A;  2CDY A; 
#chains in the Genus database with same CATH topology
 2KSD A;  1M90 W;  2QM8 A;  1KU9 A;  3MAQ A;  4DV3 O;  2ADP A;  3R66 A;  3SGI A;  4GKJ O;  3K5N A;  2YIC A;  2YDE A;  1VQL V;  1RSO A;  2RDC A;  2ARH A;  4DYL A;  1SZT A;  4IL6 Z;  3X2Q B;  1RP3 B;  1EM1 A;  5IY5 C;  2EUL A;  4IHJ A;  3P30 A;  2YID A;  3M8A A;  4YY3 O;  2MK3 A;  4DV6 O;  4FPP A;  3ABK C;  4K0K O;  3STZ C;  2B1I A;  1DF4 A;  3JSL A;  1NR7 A;  4CZZ A;  2CTW A;  1MOF A;  3P3P A;  4DUY O;  4FLU A;  1KEC A;  4JGS A;  1AI7 A;  1V55 C;  1AP6 A;  1NI8 A;  1S76 D;  4BR6 A;  2GUZ B;  3TET A;  2ZIN A;  1MAB G;  4X1I A;  4DV7 B;  4QPK A;  1GN2 A;  4HBN A;  2HJD A;  4ZBM A;  1H2L A;  5KHI A;  2PUS A;  4UCO A;  4P30 A;  1HR0 B;  1NR1 A;  4O2B A;  3ABL C;  1VF5 B;  2FYU H;  5H6R A;  1VQ7 V;  1XL4 A;  2DYR B;  3D8C A;  5L3C A;  4RQF A;  4X88 A;  2IJK A;  2EIJ B;  2LFS A;  1RPR A;  2EIN C;  2LFR A;  3U0Z A;  2W6I G;  5B1A C;  4DV7 O;  3RW0 A;  1VEW A;  4X65 B;  1FXK B;  2DJV A;  2DQ0 A;  2A7W A;  1HR0 O;  2JGD A;  1VQ6 V;  1N0N A;  4NTX A;  4GX5 A;  1SA0 B;  5CA0 B;  1XRE A;  1OJH A;  4JYY A;  3LDD A;  4UB8 Z;  1SQG A;  2CGN A;  3LSU A;  2KQX A;  1ZL8 A;  4MVM A;  2EIK B;  2Q7H A;  1FFT B;  3ZHR A;  5JVD A;  3EFF K;  4TQD A;  5C8Y A;  1DK1 A;  5KA6 A;  4X65 O;  3ASN C;  3JAR A;  1LR1 A;  2ZIO A;  1GH6 A;  2LGW A;  2JVD A;  4NXM B;  1E79 G;  4MVZ A;  2DWD C;  1N8R W;  5JQG B;  1BT8 A;  2R72 A;  1Y76 A;  2PI5 A;  4X1Y A;  2A3Q A;  4UUJ C;  4JZG A;  3TXQ A;  1S72 V;  3CS5 A;  1R6K A;  1JX9 A;  1ZTE A;  1IZ3 A;  4O2A B;  4ZHQ B;  4DV4 B;  5D5P A;  4R6Z A;  3ZRS A;  4HNA B;  3SPH A;  1K5Q A;  4NXM O;  1P84 F;  1IDS A;  5GON A;  1A32 A;  2ILM A;  3FB6 C;  3HR0 A;  4K3A A;  3OTO B;  2QWP B;  3JAL B;  3FKS G;  3ASO B;  2B5U A;  1TGO A;  4LWS A;  1VQ5 V;  4U3F H;  3NXS A;  2F66 C;  5EBL C;  3T1H B;  3K58 A;  1G4Y B;  5KHJ A;  2DW4 A;  1XIL A;  2H3O A;  3A8T A;  4DV4 O;  1IVS A;  1M56 B;  1NS1 A;  5D5Q A;  3RVZ A;  5K1P A;  4K8X A;  2CDY A;  4IYI A;  3FFQ A;  1HNZ B;  2DOS A;  4YIO A;  3BY6 A;  1VQ9 V;  2P67 A;  2UU9 B;  4RUF A;  2XTA A;  1YXB A;  3OTO O;  1S77 D;  2AZ0 A;  1PV0 A;  3BFR A;  3DTU B;  1N4C A;  4RO2 A;  4DW1 A;  1AI5 A;  3AG1 C;  1LUW A;  4JF3 A;  4EB6 A;  3SYC A;  2YS8 A;  3VOU A;  3T1H O;  3B77 A;  2WA3 A;  4J11 A;  4J7K A;  4CS4 A;  4EEQ A;  1KD1 W;  2P5O A;  2W6J G;  1URF A;  1OCO C;  1AI4 A;  3AG2 C;  2E75 B;  4PDM A;  5EK0 A;  3W7T A;  3CCJ V;  5F2V O;  1L0L H;  1JQ0 A;  4OX9 B;  3TK1 A;  4CH4 A;  4I0X A;  1HNZ O;  1BGY H;  2UXB B;  4MVS A;  2UU9 O;  1DTO A;  3N27 A;  4I50 A;  4PA3 A;  4AHC A;  3JAS A;  1JCH A;  1TVK B;  4IYH A;  3UT5 A;  2EX3 A;  1DF5 A;  2ADQ B;  2CH7 A;  2ZXW C;  4I5S A;  4JAV A;  4UCU A;  5ITZ B;  3X2Q C;  4B3M B;  3QF7 A;  5LGU A;  1CP9 A;  3OUF A;  2EJ7 A;  1ARO P;  1XMO B;  2HLD G;  1BHA A;  4OX9 O;  3FYI B;  1WLE A;  2GTA A;  5B3S B;  2UXB O;  1G8M A;  4X20 B;  3CJH B;  4LCU C;  1K5S A;  4LF4 B;  2ZNJ A;  3ZJZ A;  1I94 B;  2IJI A;  5CA1 B;  4KUM A;  2OT5 A;  4O4I B;  2JEU A;  1VP7 A;  2YXY A;  3KZI Z;  4XDL A;  2Q67 A;  1SQB H;  2LP7 A;  1FPO A;  2YUA A;  4DV0 B;  3CYO A;  1YZB A;  1TAE A;  2JGU A;  4I55 B;  1SQF A;  3STL C;  2ZM6 B;  3AG7 A;  4NTW A;  2QGN A;  4B3M O;  3SYQ A;  1JJO A;  4DR6 O;  1XMO O;  1IBK B;  4FM0 A;  3QVN A;  2WA4 A;  5LA6 B;  3HKD B;  4TUY A;  2WLM A;  3FD9 A;  2DYR C;  1FJG B;  4ZOL B;  4GX2 A;  3UKM A;  1PM9 A;  3CPW U;  1F4N A;  2EZO A;  5J2U A;  4LF4 O;  1I94 O;  4IIJ A;  3I5D A;  3EVK A;  2RJZ A;  4QPJ A;  3RWR D;  4WF9 V;  3Q4H B;  2YXH A;  2D3O W;  3ZMZ A;  4DV0 O;  4DR5 B;  2DYS B;  2V4D A;  3L70 H;  2Y0I A;  3JAW B;  4JYC A;  1HW7 A;  2IJH A;  5IJ0 B;  4NR1 A;  1IBK O;  2YEV A;  2Y0P A;  2ZE7 A;  4CS2 A;  4JAA A;  4O4H A;  1IBL O;  2Z5U A;  1FJG O;  1QVF U;  1IXB A;  5IT9 N;  1BSM A;  2A0L A;  2PYL A;  3E22 B;  3ABM B;  4TV9 A;  1K92 A;  3ZIA G;  3HKE A;  4KL1 A;  2IM9 A;  1HNX B;  5GW7 A;  4DR5 O;  1H8E G;  1WPB A;  4I9W A;  1V54 B;  4ZI7 B;  2Q7E A;  3P32 A;  1YTF D;  2Y4T A;  4EFB A;  3C3S A;  4TV8 A;  1AVM A;  1W0K G;  3AG4 B;  1FFX B;  2QE7 G;  3SYA A;  1BMF G;  5JH7 B;  4YHH O;  1ZSP A;  2EIL C;  4J41 A;  3VBB A;  4UCR A;  2K9P A;  3MD0 A;  2RMK B;  2HFE C;  5JCO C;  2QSA A;  4DW0 A;  2ETN A;  1HNX O;  1KQS U;  3F5W C;  3P3N A;  4UV8 A;  4R8C A;  4TQF A;  2HVJ C;  1VQM V;  3SDL A;  1X59 A;  3T2M A;  3AG3 B;  1AR5 A;  3I56 V;  4R7C A;  3A0B Z;  2VQE B;  3ZHV A;  3ETD A;  4IGG A;  1ZWI C;  2BTQ B;  5H2F Z;  3VQX A;  4EFE A;  3CRR A;  2JJ2 G;  4KXR A;  2OIG A;  2WSS G;  1EZV H;  4IT5 A;  2WLL B;  3THO A;  2CUG A;  2OCC B;  3HKB A;  1NVP D;  3RYC B;  3WB1 A;  4K8Z A;  3B40 A;  1M56 C;  4Z2W A;  4F6R A;  5EIB C;  3SYP A;  1XMQ B;  3H1H H;  3E8F A;  5DED A;  3VQY A;  2CGO A;  2F1M A;  3FX7 A;  5KHG A;  1K4D C;  3FB5 C;  1U97 A;  1R3I C;  2VQE O;  4WFF A;  1FS0 G;  3E8B A;  1SES A;  4FFB A;  4CH3 A;  2D2C B;  2GHY A;  2CTQ A;  2VWJ A;  2NN4 A;  3CD6 V;  1YEW A;  1M1K W;  4U3J A;  3UO2 A;  4B7K A;  1XOU A;  1XMQ O;  1Q90 D;  3G67 A;  5J2T A;  2YXL A;  2EIM B;  3ZMT A;  3F7V C;  2QKA A;  3CME V;  3WG7 B;  1P49 A;  4J80 A;  3JAK B;  1EN6 A;  4H37 A;  3ZRW A;  4J7J A;  2XND G;  2RCV A;  1P4R A;  5BZB A;  1GRJ A;  3HKC B;  4LNU A;  2P06 A;  3CC7 V;  3SJC C;  5JJJ B;  3KG2 A;  4PA9 A;  3G4S V;  4BIZ A;  1VF7 A;  1H2S B;  4X1K B;  1QR8 A;  2YIB A;  5EBW C;  1YJ9 V;  3JD0 A;  5BMV A;  1BZK A;  4JZ2 A;  1Q7Y W;  4BWA A;  2FB5 A;  3CXH F;  3CC2 V;  4DV2 O;  5E1A C;  5KHK A;  2XAS A;  5B3S C;  3DXR B;  4RQE A;  5CB4 A;  3OMI B;  5EBM C;  5JJN B;  3W7X A;  1G1X B;  2P6J A;  2Y4U A;  5LP6 A;  3CCE V;  3OT7 A;  4A5U B;  2OYQ A;  2QM4 A;  2HVK C;  4GUN A;  2OCH A;  5KA5 A;  2KG7 A;  4J42 A;  1PNL A;  1FXH A;  2HEP A;  1N33 O;  4FJC C;  4WFB V;  1WN7 A;  3ZRV A;  1OCC C;  1YJW V;  2IH1 C;  3K0D A;  2A06 H;  3E89 A;  5LYJ B;  1I7F A;  1GTO A;  4LF5 B;  2QEX V;  5KMG B;  3ETQ A;  2B9Z A;  1VMG A;  2ZNI A;  1K9M W;  3UQ8 A;  5HFL A;  2X6C A;  4DUZ B;  4LFC B;  3I55 V;  3ZCC A;  4KFM A;  1GM8 A;  2E74 B;  2LQT A;  2UXD B;  1WAZ A;  3MHS C;  4D7S A;  4LP8 A;  1W0J G;  2PZS A;  2RN9 A;  3M7M X;  3B4S A;  2OTJ V;  3K03 A;  1VF6 C;  5DM6 V;  1KB9 F;  1IX9 A;  5IYZ A;  2HR3 A;  2JRI A;  5B1B B;  3JYC A;  3E83 A;  1Z2G A;  4JYA B;  3KCY A;  3KKY A;  4LF5 O;  2IBZ H;  3CCL V;  2A9H A;  1QLE C;  4LH6 A;  2H8P C;  1JFF A;  4MTG A;  4DUZ O;  4LFC O;  4GZR B;  5EZY A;  3N2G B;  5GTI Z;  1AI6 A;  1XQ8 A;  2UXD O;  4U7O A;  2E5L B;  3ZS8 C;  3ZRX A;  4CS3 A;  5IDJ A;  1H8H G;  1Y74 B;  4KP4 A;  2PF4 E;  4DR7 B;  1BCC H;  1THZ A;  1Y66 A;  1ZLZ A;  2F43 G;  1WA8 A;  3OGC C;  5FNV A;  1M5I A;  1Q43 A;  3ZX6 A;  4DRX B;  4PD4 F;  4W4K A;  4JYA O;  3K5M A;  2DQ3 A;  1PKX A;  1AJN A;  2ZR2 A;  1Q6I A;  4MVU A;  4L8J A;  3E2E A;  4ICG A;  1TA8 A;  3C90 A;  2NLJ C;  2PTM A;  1XNQ B;  1SRY A;  2IJJ A;  4HZ3 A;  4PV1 B;  4JI0 B;  4BAY A;  2XHB A;  1GN3 A;  1Q3E A;  3QO5 A;  1QVG U;  2N04 A;  4UV9 A;  1KP2 A;  2E5L O;  4I4T B;  3QO7 A;  1QNM A;  4DR7 O;  3JAT B;  5L3B A;  1YIT V;  5LYJ A;  4FZ0 A;  1I0H A;  3AG3 C;  4B3R B;  4QE9 A;  2MW2 B;  2R70 A;  2WLK A;  3PN1 A;  5J9P C;  2Y69 B;  4LF6 B;  4FLT A;  4LF7 B;  2QTS A;  1SF9 A;  2HHH O;  2GUZ A;  3BEH A;  2CE4 A;  1B04 A;  1XNQ O;  3G71 V;  5LP6 C;  3GWO A;  4LC1 A;  4JI0 O;  1K97 A;  5LHG A;  5IYB O;  3KCX A;  4D7T A;  1IUR A;  3IC9 A;  4FLV A;  3ZHS A;  3B8N A;  2QKC A;  3T4D A;  4B3R O;  2IW5 A;  4FM2 A;  3CE2 A;  1T5E A;  4YJ2 B;  5LHI A;  1CEZ A;  2L35 A;  4LF6 O;  2BCC H;  2UUC B;  3K5O A;  4LF7 O;  5IYD O;  1ZUQ A;  4ASU G;  3RGB A;  1H2N A;  2QTO A;  1WP7 A;  2GSM B;  5IJ9 B;  1OCR B;  3HPL C;  1NT2 B;  3EHB B;  3OUS A;  1FXK A;  1UFI A;  2CK3 G;  3OAA G;  4FMT A;  3CB2 A;  2P4V A;  3QG5 A;  1N34 B;  2Q8V A;  2VRZ A;  1H38 A;  4LF9 B;  2JJ1 G;  1SA0 A;  5EC1 C;  5CA0 A;  1QCE A;  1D5N A;  3W7U A;  2R9R B;  2EIM C;  1M93 A;  3RYH B;  4I9Q A;  4DK1 A;  2YI9 A;  3UM7 A;  4UXN A;  2UUC O;  3S3W A;  1R3J C;  4GKK B;  2Y48 A;  4PI2 A;  5K1X A;  5B1O A;  5B66 Z;  5KUM A;  1P7G A;  2XAG A;  4H33 A;  4H0L B;  1GO3 F;  3OEH G;  1N34 O;  1B6Q A;  2QWQ B;  2EJR A;  2DE0 X;  1FYJ A;  1I5Y A;  4FM1 A;  4LF9 O;  2AZ2 A;  5JQG A;  3G6E V;  1YTF B;  2Q68 A;  4WCE V;  3OW2 U;  4OGQ B;  5B5E Z;  2XT9 A;  3SR2 C;  4N23 A;  5LXT B;  1Q81 W;  2ZE8 A;  2A79 B;  5JCO A;  2JDI G;  5KUK A;  3D3I A;  3KDR A;  2JIZ G;  2ZE6 A;  3IGA C;  4O2A A;  2P7T C;  4GKK O;  4ZHQ A;  4MVQ A;  4YIP A;  4HNA A;  4PEL A;  1YVW A;  1KKC A;  2AHY A;  1BE3 H;  4NYK A;  4NVP A;  1O9H A;  2PGG A;  3ZMV A;  3BVO A;  3K04 A;  3RYF B;  4DR6 B;  3FAV B;  3ZMS A;  1F51 A;  4FLY A;  3JAL A;  5IWA B;  3VQW A;  3UCS C;  3CCR V;  1KMI Z;  2W0X A;  1AR1 B;  2UUA B;  4UB6 Z;  5A2Q N;  3CRA A;  1WPX A;  1OCZ B;  2CTR A;  3JCU Z;  1XEQ A;  3CCU V;  1L0N H;  3J81 N;  1VAR A;  3GB7 C;  3APO A;  1NKD A;  2Z0A A;  3UO3 A;  1X4T A;  4AIL C;  5EYP B;  5B1B C;  4JI8 B;  1KBH A;  2G38 A;  4KHP O;  5IWA O;  2WLI B;  3RN4 A;  2BOC C;  2Q73 A;  2WAM A;  3H1L H;  1IBL B;  2AHZ A;  1J5E B;  3GVM A;  2UUA O;  2FL4 A;  2FKX A;  1K7D A;  1I08 A;  2EIJ C;  5L3F A;  4F4L A;  4FLZ A;  3OGI B;  1EZJ A;  1RM1 B;  2IH3 C;  3E86 A;  2ZIM A;  3ABK B;  4JPR A;  3WU2 Z;  3JAM N;  1FXK C;  5KHH A;  2QWN B;  1UJW B;  5BR8 B;  4JI8 O;  4LBE C;  4YHH B;  2JS3 A;  1TVK A;  1R3L C;  1HDJ A;  4O4J B;  3OTF A;  4YJ3 B;  1VQP V;  3BAA A;  5LOV B;  1KYO F;  5H9C A;  1J5E O;  4DK0 A;  1N0J A;  1M9N A;  5CBG A;  5EIB D;  1KC8 W;  3SPG A;  2P4K A;  1F7Y A;  1W2B U;  5ITZ A;  1S5H C;  2BOB C;  1N32 B;  3ABL B;  3L73 H;  2EIK C;  5BY1 A;  4GYC B;  5KX5 B;  5JJE B;  1JJ2 U;  4H13 B;  2OIE A;  1Q8I A;  3N2K B;  3TXS A;  4DR4 B;  4PJ0 Z;  5EC2 C;  3K0G A;  3D36 A;  3K06 A;  4QGP A;  5BR8 O;  4X20 A;  3CJH A;  1UPG A;  1XL6 A;  2H94 A;  2X7R B;  5CA1 A;  1AJQ A;  4JTD B;  1HNW O;  1VQK V;  2XOK G;  4O4I A;  5B1A B;  4HAM A;  4FZ1 A;  3LDC A;  2M7W A;  2XAJ A;  3WB0 A;  1S3J A;  1ZX3 A;  1NTK H;  4I55 A;  2VS0 A;  1Q6U A;  2WLN A;  1N32 O;  4FLW A;  4QE7 A;  4ZKI A;  3ZHQ A;  4DR4 O;  1SET A;  3T1Y B;  3ETG A;  5LA6 A;  4UVA A;  3RFR A;  3HKD A;  2WLJ A;  4JYB A;  2YIA A;  3IAY A;  1TUB B;  4ZOL A;  5CN0 A;  4L87 A;  1R73 A;  1YCI A;  3CCQ V;  2F4V B;  2F93 B;  3F5T A;  5JWP A;  3ASO C;  4WFE A;  3H1I H;  3Q4H A;  3CSX A;  5H5N A;  4FK5 C;  1OCR C;  3AEI A;  3ASN B;  1WB7 A;  2IU3 A;  3JAW A;  2K1E A;  1VF6 A;  3RYI B;  1R6N A;  4G27 B;  5IJ0 A;  5FPO A;  3T1Y O;  2BSK B;  2P22 C;  4LR3 A;  3G6B A;  4O4L B;  5BXZ A;  4JI3 B;  1YJN V;  1JPX A;  1WNS A;  4WBN B;  4WFG A;  3LSQ A;  2F4V O;  3E22 A;  4MW8 A;  4D6T H;  3JD4 A;  1QR9 A;  1Y67 A;  2ZE5 A;  5LGT A;  1GN4 A;  1FOU A;  1RSO B;  4X64 B;  3ICX A;  4GX1 A;  4JV5 B;  3JSN A;  4ZI7 A;  2ZD9 A;  4ABM A;  1FFX A;  4IHJ B;  1YDX A;  4MW3 A;  4CBC A;  5JH7 A;  2ZR3 A;  1R3K C;  2XAH A;  1BHB A;  3J80 N;  1EFR G;  4DV2 B;  2UXC B;  4JI3 O;  3ZHU A;  1BS3 A;  2R9A A;  4B08 A;  4XDJ A;  3SJB C;  5DN6 G;  3WFV A;  1NZ6 A;  3A0R A;  1XUQ A;  4DV5 B;  1JMK C;  3LSS A;  2F95 B;  1Q86 W;  4JI1 B;  4X1I B;  3BA9 A;  3ETE A;  4CC6 A;  4X64 O;  4JV5 O;  2X6A A;  4TOI A;  4UFZ A;  1Q82 W;  4FLX A;  1N33 B;  2AW9 A;  2M6Y A;  4O2B B;  5FL7 G;  3AK3 A;  2QWO B;  2BTQ A;  2UXC O;  4LF8 B;  3D36 C;  1Y4M A;  2B1G A;  2GV9 A;  3U11 A;  1QQC A;  2KKW A;  2WLL A;  2LJ2 A;  1COW G;  3M99 B;  1OCZ C;  4YXW G;  4DV5 O;  1OCO B;  5B1N A;  3ZED A;  1JR9 A;  1QBZ A;  3RYC A;  4MTO A;  1CXZ B;  4JI1 O;  1NTZ H;  4Q6G A;  5CBF A;  1WJZ A;  2JGD B;  2Q7G A;  3OE7 G;  3PJS K;  1IJG A;  1L8D A;  3H9V A;  3ZBH A;  4HYO A;  3NR7 A;  4CC5 A;  1NH2 D;  2KB1 A;  4F6E A;  1VQ4 V;  1M57 B;  4PDL A;  4LF8 O;  2VQF B;  3CRC A;  1ZAU A;  1CPY A;  1E1R G;  1OZ0 A;  1PPJ H;  4J10 A;  3DSQ A;  1ZL8 B;  2ZXW B;  2ZT9 B;  3CRM A;  2QWR B;  4UVB A;  4LH7 A;  4JTC B;  1MSD A;  5JVD B;  1Z5W A;  2Q9L A;  2YIB D;  5C8Y B;  1RM1 C;  3SPJ A;  2DMX A;  2DYS C;  3JAR B;  5DEC A;  3ZMU A;  1EN5 A;  4P9O A;  1WB8 A;  4UVC A;  3CMA V;  5KAF Z;  3JAK A;  4OPH A;  4PHZ A;  1Y76 B;  3L71 H;  4MVO A;  5L3E A;  4X1Y B;  5LGN A;  4DO2 A;  2VQF O;  3HKC A;  4UCV A;  1YI2 V;  3B09 A;  1G6U A;  4MT8 A;  4X1K A;  2Q6A A;  3ABM C;  3H1J H;  1OV9 A;  4OXS A;  3CCV V;  3CRQ A;  1K4C C;  5TIS Z;  3ZHT A;  1SC5 B;  1FXV A;  1GKF A;  1BL8 A;  1V54 C;  1GM7 A;  5GON B;  2LW7 A;  1BQ0 A;  3DXR A;  3WB2 A;  3AG4 C;  4B7E A;  1VIB A;  1H2G A;  2UXX A;  1SQX H;  1XDC A;  3ABT A;  4AQY B;  1JOY A;  3L9D A;  1H2K A;  4LWS B;  4E2L A;  2HHH B;  2HJF C;  3FB7 C;  5L3D A;  4MTF A;  4BW5 A;  4GCZ A;  4PDR A;  2WWW A;  1K8A W;  1WP8 A;  3O65 A;  4K35 A;  1Z5V A;  3K59 A;  1MG1 A;  3D3Q A;  4U7N A;  5KMG A;  3LDE A;  1SS3 A;  1JA8 A;  1FD9 A;  3EXA A;  1D5A A;  3H1K H;  3BRC A;  1NTM H;  3CP1 A;  4AQY O;  3ABU A;  4EB6 B;  2ZKO A;  3IJ4 A;  2BTO A;  4QIW F;  2AXT Z;  3QNE A;  2DN9 A;  2FTK A;  1GAX A;  2Q5Z A;  3CCS V;  1B06 A;  4X9Q A;  2OCC C;  3OEE G;  1XBL A;  2CTP A;  1AR4 A;  2EZP A;  3L72 H;  2JEX A;  1YIJ V;  3K79 A;  2EIL B;  5IYC O;  3L75 H;  3TJT A;  4I0X B;  3OFN G;  3FB8 C;  3MDS A;  4JI6 B;  1HP8 A;  4DR3 B;  4I50 B;  2WPD G;  1PD3 A;  1VQO V;  3JAS B;  3BCC H;  1Y6X A;  3UT5 B;  3N2G A;  1D2D A;  2QDO A;  3J7A U;  4N21 A;  3RBZ A;  1Y74 A;  1GM9 A;  2CH7 B;  3SYO A;  2ZQM A;  1J95 A;  4WFA V;  2GDS A;  2E76 B;  5IE9 A;  2PY5 A;  4DRX A;  5FLX N;  4Z1M G;  2Q4P A;  1H2M A;  1SQP H;  1XNR B;  1NQT A;  4CH5 A;  4JI2 B;  2RNB A;  5LMN B;  5GTH Z;  4LFA B;  2L6L A;  1AJP A;  2CAZ C;  2WLH A;  4JI6 O;  3AK1 A;  3FYE B;  4DR3 O;  1L1F A;  1SQQ H;  3WG7 C;  4JI5 B;  2QR4 A;  4B3T B;  3B8M A;  4XBF A;  4B3S B;  4JI7 B;  3APQ A;  3R65 A;  1M4U A;  2F23 A;  1RPO A;  5A9G A;  1ROP A;  4I4T A;  2ATK C;  1EN4 A;  2LW1 A;  2XUM A;  3JAT A;  4MVR A;  1ORQ C;  2V7Q G;  5C93 A;  1PL0 A;  3ZN0 A;  4X62 B;  1YHQ V;  2QJ1 A;  1FAF A;  1XNR O;  5LHH A;  4J9Z B;  4JI2 O;  3SJQ C;  5LMN O;  4TUY B;  4LFA O;  3U10 A;  2HKO A;  4R50 A;  4C7U A;  4X66 B;  3TGU H;  5J2U B;  4JI5 O;  4DV1 B;  4B3T O;  4GT1 A;  1DGS A;  4B3S O;  4I7Z B;  4JI7 O;  4IIJ B;  4MTX A;  1TUE B;  5KLV H;  4XDK A;  2EBO A;  1QHT A;  3RVY A;  3K9S A;  2P90 A;  1R1B A;  1Q6H A;  5L3G A;  1S5J A;  4PA7 A;  1MA1 A;  4NKG B;  4H44 B;  4X62 O;  1VQ8 V;  1P7B A;  4YJ2 A;  2YEV B;  1OHH G;  1DLB A;  4KHP B;  4O4H B;  3C3T A;  1M57 C;  2E3C A;  3CX5 F;  4OPA A;  3TCU A;  3H01 A;  4X66 O;  3S3X A;  1SQV H;  5IJ9 A;  4DV1 O;  5FPR A;  3JD1 A;  2C2A A;  4TV9 B;  1Q5O A;  3HKE B;  4MSW C;  3VQV A;  4W4L A;  2YSU B;  1XHZ A;  3LUT B;  2HP8 A;  4X89 A;  1NVP B;  4PA4 A;  4TV8 B;  3RYH A;  1KP3 A;  4DXW A;  1HWY A;  4P2Z A;  2QKS A;  1W59 A;  3CCM V;  4G28 B;  3CXC U;  2ODM A;  2XAF A;  1MSW D;  4JTA B;  3IFX A;  3OM3 B;  3W7S A;  4JAS A;  2NR5 A;  1QU7 A;  3DGE A;  5AG2 A;  5IY5 B;  1OCC B;  1S0V A;  1JVM A;  3K3W A;  4NXN B;  3T1C A;  3ZN1 A;  4FVM A;  5CMU A;  5CA3 A;  1KUQ A;  4TSF G;  4Z1V A;  2X6B A;  1U96 A;  5LXT A;  1PNM A;  2ITC C;  4GX0 A;  2QM7 A;  1V55 B;  1HNW B;  2R9I A;  3LNN A;  5CBH A;  2HG5 C;  2N74 A;  5LMU B;  3DC5 A;  2Z3Y A;  2ZDI A;  2ZM6 O;  3OR6 C;  1LUV A;  3OR7 C;  2UXN A;  2OTL V;  1IBM B;  3HKB B;  1GMG A;  4F6R B;  4NXN O;  3ML0 A;  3RYF A;  3FAV A;  1V9P A;  4BIU A;  1E1Q G;  1EBO A;  1IXM A;  4AI8 A;  1QLE B;  1SZX A;  2V1D A;  2EIN B;  2O57 A;  1AB3 A;  4FFB B;  2XAQ A;  2Y69 C;  4TWK A;  5LBQ A;  5LMU O;  4TT3 G;  2Q0A A;  4ZIB A;  4DR1 B;  5LL6 Y;  2JK5 C;  1K3E A;  3F7Y C;  2VWK A;  1MZF A;  5E79 Z;  1IBM O;  3K08 A;  4RUE A;  4U3J B;  1NBM G;  4E4E A;  3OMN B;  3SPC A;  4LFB B;  2NNU A;  5EYP A;  1LNQ A;  2X0L A;  5J2T B;  1AIL A;  4QNH B;  2WLI A;  3CC4 V;  3L74 H;  4J7Z A;  1SER A;  2ZCE A;  1NH2 B;  3LNM B;  4G2K A;  3ZRW B;  1XHX A;  3A2F A;  2FML A;  4LNU B;  1K73 W;  3BA8 A;  3E8H A;  4DR2 B;  3DC6 A;  2YI8 A;  4DR1 O;  3HB3 B;  2BE3 A;  3JCZ A;  4RAI A;  1GN6 A;  2W0F C;  5KAI Z;  2RQ6 A;  1YF2 A;  2N05 A;  3IC7 A;  2AGA A;  3G80 A;  1JNB A;  5BMV B;  4WFH A;  5HFM A;  1PNK A;  4LFB O;  3T4Z A;  2JS5 A;  1YSC A;  1PP9 H;  3BHP A;  4BIO A;  1XI1 A;  4X8A A;  4O4J A;  4YJ3 A;  5LOV A;  1MZE A;  4BW9 A;  1S5L Z;  1AP5 A;  4PA6 A;  2LGQ A;  5CB4 B;  1QLN A;  4UCS A;  5LP6 B;  1NU1 H;  1PL4 A;  1H5W A;  1SKV A;  4NTY A;  1NJI W;  2Q69 A;  1US6 A;  4DR2 O;  1MNG A;  4PDV A;  1O9G A;  5KX5 A;  2ITD C;  5H6Q A;  3A0H Z;  2KG7 B;  3N2K A;  3K57 A;  4UCT A;  2GTS A;  1F4M A;  4J9Y B;  1I5X A;  3E35 A;  4FIP C;  1ENV A;  1R6T A;  3SPI A;  3BAB A;  3K5L A;  1N36 B;  1FKA O;  3SJA C;  1KKD A;  4PI0 A;  3AK2 A;  4RWU A;  3QTC A;  2UUB B;  2LO1 A;  4JI4 B;  2QA4 V;  4MS2 A;  3CHX A;  2GBO A;  2ZDI C;  3QO8 A;  1GK9 A;  3RT3 C;  3GWK C;  5IYZ B;  2Q0O C;  4GLX A;  1BQZ A;  3OD4 A;  1TUB A;  2YC0 A;  3B2E E;  3K9A A;  3JD2 A;  3OMA B;  1B3Q A;  4EKW A;  3AG1 B;  3E8G A;  1N36 O;  3O9O A;  4DV3 B;  2OWO A;  4GKJ B;  2IU0 A;  4FFK A;  2PI4 A;  3BPZ A;  1K34 A;  1JFF B;  3CWB H;  3MHH C;  4Q20 A;  5EZY B;  2PYJ A;  4CH6 A;  2UUB O;  4JI4 O;  3AG2 B;  3RYI A;  1K33 A;  4NB5 A;  4QJF B;  1RFY A;  3CEI A;  4YY3 B;  4DV6 B;  2DWE C;  2BSK A;  4K0K B;  1VQN V;  1WA8 B;  3JD3 A;  4O4L A;  5FNV B;  4P9P A;  1F23 A;  4JAU A;  4DUY B;  1MMM A;  4WBN A;  3W7W A; 
#chains in the Genus database with same CATH homology
 1B06 A;  1ZUQ A;  1PL4 A;  4X9Q A;  3K9S A;  3DC5 A;  4JYY A;  4YIO A;  1EN5 A;  1WB8 A;  1AR4 A;  1LUV A;  2ADP A;  3LSU A;  3QVN A;  4JZ2 A;  1AR5 A;  1BS3 A;  3BFR A;  1MA1 A;  1MNG A;  1LUW A;  3TJT A;  1ZLZ A;  1PM9 A;  1XUQ A;  1EM1 A;  3MDS A;  1VAR A;  3EVK A;  1D5N A;  3C3T A;  1SZX A;  3OT7 A;  4GUN A;  2AW9 A;  1BT8 A;  3RN4 A;  2GDS A;  3AK3 A;  1AP6 A;  3AK2 A;  1GN3 A;  4JZG A;  4BR6 A;  1I08 A;  1ZTE A;  1QNM A;  1P7G A;  1IXB A;  1GN2 A;  4E4E A;  1I0H A;  1XDC A;  1BSM A;  1WB7 A;  3AK1 A;  2ADQ B;  1JR9 A;  5A9G A;  1IDS A;  2CE4 A;  3KDR A;  1EN4 A;  5AG2 A;  3C3S A;  4FFK A;  1AVM A;  1N0J A;  3DC6 A;  4F6E A;  1GN6 A;  1ZSP A;  4YIP A;  3IC9 A;  1IX9 A;  2QKA A;  1JA8 A;  2P4K A;  1Y67 A;  1KKC A;  1XIL A;  1VEW A;  1GN4 A;  3KKY A;  3CEI A;  2QKC A;  1EN6 A;  4C7U A;  2RCV A;  1MSD A;  1N0N A;  1AP5 A;  1MMM A;  1XRE A;  2CDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...