3OT7A

Escherichia coli apo-manganese superoxide dismutase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Subunit dissociation and metal binding by Escherichia coli apo-manganese superoxide dismutase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 73
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ot7A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ot7A02
3CEIA 4YIOA 3MDSA 1Y67A 3TJTA 1WB8A 1JR9A 1EN4A 3EVKA 4JZ2A 1GN2A 1MA1A 1PM9A 1EM1A 1WB7A 1JA8A 1KKCA 4E4EA 3DC6A 3DC5A 1EN5A 1AR4A 1GN3A 1LUVA 5A9GA 1I0HA 3BFRA 4GUNA 1I08A 2AW9A 4YIPA 1MMMA 1AP5A 1IDSA 1EN6A 2QKCA 4BR6A 1BSMA 2P4KA 1AVMA 3IC9A 3LSUA 1SZXA 3OT7A 1LUWA 4FFKA 3C3SA 1AP6A 1XILA 1XDCA 1ZUQA 3K9SA 3AK1A 2GDSA 1AR5A 4JYYA 4F6EA 3AK2A 1XREA 1MSDA 1BT8A 2RCVA 1MNGA 3AK3A 1GN6A 4C7UA 3RN4A 1B06A 1ZSPA 1VEWA 3QVNA 1VARA 1XUQA 3KKYA 1PL4A 2ADPA 1N0JA 2CDYA 1D5NA 4X9QA 1N0NA 5AG2A 2QKAA 3C3TA 1P7GA 1IXBA 1BS3A 4JZGA 2ADQB 1GN4A 1IX9A 2CE4A 1ZLZA 1ZTEA 1QNMA
chains in the Genus database with same CATH superfamily
1VQ4V 4PELA 4YIOA 1JR9A 2ZNJA 1JQ0A 1QLEB 3PJSK 3I5DA 4DV4O 2QWOB 4HBNA 5LHIA 2EZOA 1N34B 2B9ZA 4DV2O 4RQEA 2YEVB 1HDJA 3ML0A 2M7WA 3CRQA 3FB7C 4R50A 3BA9A 4WFFA 2Q67A 1I5YA 1XOUA 4DR5B 5LP6C 1JVMA 2ZKOA 1G8MA 3H1IH 2YXLA 2PTMA 1KP2A 3A2FA 2YIBA 1GN6A 1QCEA 1ZSPA 3FD9A 4LF5B 2W6IG 3KKYA 1VMGA 2IJHA 4J7JA 4MS2A 3E22A 4YJ3A 4ASUG 2UXNA 2EIKB 1Q43A 2UXBB 2EULA 5FPRA 4B3TB 4B3RB 3E8GA 2WLHA 5IYCO 3VQWA 2NLJC 3RYFA 1RPRA 3CSXA 1OCCB 1M57B 2IU0A 1EBOA 2UXCB 3P32A 5L3EA 4GT1A 3ZMVA 2XHBA 2IBZH 2M6YA 3EVKA 2JGDB 1N36B 1XNRO 2AZ2A 3OR6C 2LJ2A 1SETA 2B1GA 3RWRD 3UM7A 1SS3A 1K9MW 3DXRB 3U11A 1WP8A 3NXSA 1Q81W 2XAHA 1R3KC 2AW9A 3DTUB 3RBZA 5EBLC 3GWKC 3ZHRA 1IBKB 4JGSA 3ZN0A 2K9PA 1PNLA 1GRJA 1H2NA 3BAAA 4OGQB 3ZRWA 3FFQA 2OCHA 2QA4V 4CBCA 4U7OA 1XMQO 5KHKA 1TUBA 2QKSA 2EX3A 1DK1A 5KHIA 1M4UA 1US6A 1AB3A 4LF6O 2X6AA 3CCUV 1ORQC 2PY5A 3TGUH 4JAVA 2F4VO 5H2FZ 2ZDIC 4F6RA 3CRCA 2JEUA 4R8CA 3MHSC 4LR3A 4DR7O 1H2MA 3K3WA 3JD1A 4G27B 4JF3A 2XAJA 1PL4A 2IH3C 4TUYA 4PDLA 4OPAA 3WU2Z 3B8MA 2PI4A 4JZGA 5JQGA 3ABLC 5LGTA 4FJCC 3OMIB 4RUFA 2OIGA 3N2GA 2WA3A 2X0LA 3KDRA 5LMNO 1PPJH 4LF4O 3G6BA 4TSFG 1BMFG 1I5XA 2IU3A 2UU9O 3P3PA 1J5EO 1BHAA 5H9CA 3HPLC 1WB8A 1SA0B 4GKJO 4IGGA 2HP8A 1V54C 4X1KA 1SC5B 4TUYB 3JAWA 1WB7A 3D8CA 4DR2O 2ZINA 2JRIA 3K0DA 2LP7A 5GONB 4G28B 1JFFA 2P22C 4Z1VA 5LXTA 3CRAA 5JQGB 1YITV 2Q7HA 4K8ZA 1R73A 5EYPB 3LDCA 4X8AA 2R70A 2FL4A 1HNZB 5CB4B 4YY3O 2P06A 2YSUB 3SJQC 3OEHG 2GUZB 3CP1A 1IBLB 3JATB 1SZXA 2LGWA 1LUWA 5LP6B 4QIWF 1JPXA 1TVKA 2RMKB 3ABUA 4JV5O 2LW7A 3J7AU 2OTJV 2ILMA 4YXWG 2UUAB 3ZMUA 4WFHA 4R6ZA 2ZNIA 1HR0O 4FM1A 1AJQA 4W4LA 2RCVA 4FFBA 4QNHB 3H1LH 5FL7G 4DV0O 2WWWA 3EXAA 4IYHA 2DN9A 5JCOC 3K59A 4DV7B 1K73W 4YHHB 2E5LB 4B3MO 1PV0A 2QE7G 5IYZB 3TXSA 5KAFZ 4JI3B 3JSNA 1SF9A 2DWDC 2ODMA 2RDCA 1TVKB 1SKVA 4O2BB 1LNQA 2VWKA 3ZX6A 3JALB 2UUBO 5B66Z 4MTOA 4O4HA 1R1BA 3CWBH 5J9PC 4FFBB 4AQYO 1ROPA 3ZIAG 1R6TA 3ASNC 1K4DC 1G1XB 3OMNB 3G67A 2ZIMA 3LNMB 1Q7YW 4JYBA 3ZBHA 2WLLA 3VQXA 3LNNA 4I9WA 2BTOA 3FYEB 4P2ZA 1NBMG 3CJHB 4R7CA 2Y0PA 4FLYA 1TUEB 4IT5A 1FD9A 4FK5C 2EIJC 4Z1MG 1XBLA 3B09A 3OEEG 2YUAA 4JTCB 3MHHC 2QTSA 3BFRA 3EHBB 3J81N 2ZT9B 1L0LH 4YIPA 4O4HB 5C8YA 2R9RB 1AP5A 5KA6A 5B3SB 1TGOA 2ITCC 1NS1A 1FFXA 1CEZA 4EB6B 3QO8A 1BCCH 2PZSA 3IC9A 5KMGB 5J2UB 4IHJA 4JAAA 1NI8A 3RVYA 3RYIA 3OT7A 2JJ2G 2PYJA 3C3SA 1YJNV 4QE7A 1WPXA 5IYDO 3WB2A 4JI0O 2UUCB 4JTDB 3K04A 3WG7C 4X66B 5K1XA 3CB2A 4LF8B 1SRYA 1E1RG 1MSDA 3OTOO 5HFLA 2Q0OC 1I94B 2PYLA 4U7NA 4BIZA 1VQOV 2IJJA 3OR7C 4LNUA 1M1KW 3RN4A 2OWOA 2DMXA 1MZEA 4F4LA 4JI7O 2XAFA 2ZM6B 3ABLB 5KHGA 1AJNA 2ARHA 4DR1O 5EK0A 4P9PA 2CDYA 1D5NA 2Q0AA 2RQ6A 4NXNB 1DF4A 4O4LA 2W6JG 3STZC 3STLC 3JAKA 5KHHA 3O9OA 1IBMO 3LSQA 1WAZA 1KMIZ 4CS3A 2UXBO 1S5LZ 2XTAA 3AEIA 2QWNB 5D5PA 5DEDA 1ZLZA 2MW2B 1H2KA 1ZWIC 4MSWC 4LNUB 4LH7A 4OPHA 3CEIA 5HFMA 3MDSA 1IVSA 1LR1A 1KD1W 2GTAA 3OUSA 5KX5A 4O4LB 3FB5C 1AR4A 2A9HA 1IURA 3Q4HA 3ETEA 4O2AA 5IDJA 1DGSA 1F4NA 4GKKB 2ZE8A 3KZIZ 3JCUZ 4LFAB 3BABA 4KXRA 4DUZB 3AG7A 1R3JC 2Q69A 1IBKO 5JH7B 4FLTA 1DTOA 3LSUA 2F23A 4EEQA 1FJGB 2YIDA 5JWPA 1VP7A 2QWRB 1S5HC 3AK1A 3LSSA 1XMOB 1H2GA 4H13B 5IJ9A 3Q4HB 4PA3A 3AK2A 3GWOA 1NQTA 3JASA 1BT8A 1M93A 4I5SA 3RYCB 1Q82W 4EFEA 4FLWA 4TT3G 4C7UA 3TK1A 4KFMA 3ETQA 4MVSA 4YJ2A 1GH6A 3T1HB 2ADPA 1NKDA 3E8BA 4FPPA 1OCOC 5BR8O 3SYQA 1AI4A 4UCRA 1XQ8A 2F66C 2WLJA 5CN0A 3BVOA 1XEQA 4FLXA 2YI8A 2E74B 2CGOA 1QNMA 3K79A 4DV1O 1V9PA 4LF9O 3QF7A 4TV8B 1S3JA 4WBNA 4FLVA 2XAQA 2EIJB 4PI2A 2DWEC 3AG3C 1JMKC 1QBZA 1VIBA 3S3WA 4NR1A 5C93A 2UXXA 3SPGA 5BZBA 4FLUA 2NNUA 4AHCA 1P7BA 4E4EA 1HWYA 2Q73A 3DC5A 1WN7A 1GN3A 1CXZB 2XNDG 2YEVA 4KUMA 4GUNA 3HKCB 1I08A 4NXMB 2R9IA 2KQXA 1QR9A 2ZXWC 4AILC 3ICXA 2PUSA 3K57A 2JDIG 3I56V 4X65B 1W2BU 1V55C 2HEPA 4WBNB 3JARA 1N33B 3WG7B 5LOVB 1FXVA 3FB6C 2Q7GA 4DXWA 4PJ0Z 1K34A 3L75H 4HAMA 1NH2D 3BCCH 4DV3B 4LCUC 2GDSA 4UCUA 4WFGA 4X62O 2VQFB 1XHZA 1M56B 2UUAO 4DR6B 1KBHA 3T2MA 2RNBA 4CZZA 3SYOA 3AK3A 1P4RA 3L73H 2FYUH 4LFBB 4RQFA 2Y4TA 5KUKA 4LH6A 1Y66A 1BQZA 3L9DA 3QO7A 4DV6B 5DECA 1VF6C 3ZRXA 3JARB 1FOUA 3HKDB 5F2VO 4WFEA 3A0RA 1H5WA 5LA6B 4DR3B 4I4TB 5IY5C 4UCVA 3H01A 2VQEO 2HG5C 1N4CA 1GN4A 2CGNA 3CX5F 2ZE5A 3KG2A 1P84F 2DYRC 3CCSV 3ABMC 3R65A 3S3XA 1S5JA 3B77A 4MVMA 4LFCO 3WFVA 4IL6Z 3ASOC 4NTYA 2JGDA 1M90W 2QM8A 3ZRVA 1YJWV 4DUYB 4PHZA 4BIUA 1N32B 4LC1A 3RVZA 4JZ2A 3DXRA 1RSOB 5L3CA 3ZMTA 5CA3A 2VS0A 5IWAO 3OGCC 2IJKA 4P30A 1QVGU 5KAIZ 3W7UA 2WA4A 4JPRA 4CH5A 2RN9A 2Z3YA 1I0HA 3D36A 3ZCCA 3MD0A 3CCJV 3ZHSA 1KQSU 3BPZA 5CBHA 2ITDC 2UXDO 3H1JH 1VQ5V 1NU1H 1YJ9V 3L72H 2WSSG 4GX2A 4UVBA 5CMUA 4N21A 4PV1B 3UO3A 1NJIW 4FLZA 1KUQA 3R66A 4TWKA 2ZD9A 4PDMA 3HKBA 3B4SA 4B08A 2WLMA 4JI2B 3CC4V 4CH3A 3W7TA 5BXZA 1Q86W 4X1YB 4DW0A 5LMUB 2D2CB 3QVNA 2P6JA 1GO3F 4UCOA 2H3OA 1YCIA 2KG7A 4JI1B 2L6LA 3HKBB 1P7GA 3SPCA 2X6BA 3THOA 4UCSA 1VQKV 4X64B 1MOFA 3A0HZ 3MAQA 2ADQB 3JYCA 4J9YB 4U3JB 5CA1B 1KKDA 4D7TA 3P3NA 3JD4A 3AG3B 2ATKC 3RYHB 3JAMN 1I7FA 1SA0A 3A0BZ 5B1BC 3ZRSA 2H94A 4QGPA 1WA8B 2HLDG 4GLXA 2OT5A 1G6UA 5GONA 2HVKC 4RO2A 2KG7B 5IT9N 5EYPA 1X59A 2ZXWB 2JIZG 4UFZA 5CA0A 2QWPB 5LBQA 1BL8A 3OW2U 5CB4A 1V55B 2VWJA 3X2QC 1U97A 2BOBC 2CH7B 2EINC 2GUZA 3OUFA 1IDSA 2MK3A 4JI5B 5B5EZ 3E83A 3JATA 1NVPB 4LWSA 3GB7C 2PF4E 4OX9B 3BEHA 1K4CC 5LP6A 5TISZ 3ABTA 1VF7A 1OCRC 3H1KH 1M5IA 1PP9H 4DO2A 2F43G 3E86A 1GKFA 1U96A 1JJOA 2PGGA 2CTPA 1JOYA 1XDCA 2E3CA 2QR4A 1WJZA 1XNQB 4Q20A 4HYOA 5CA0B 5D5QA 4K8XA 3T1YO 5H6RA 2LFSA 5IYZA 4LWSB 4EFBA 3CPWU 3D3QA 3SYAA 1IXMA 5IY5B 4DR4O 2Y4UA 2QEXV 3FB8C 3G80A 4J42A 4O2BA 2BOCC 3JALA 1E1QG 1JJ2U 3M8AA 2AZ0A 4L87A 1HNWO 2DYRB 3FAVA 3RW0A 5KUMA 1TA8A 3ABMB 1JCHA 3VQYA 4DV4B 4JTAB 5GTHZ 4DV5O 1E79G 1ZTEA 1HNXO 1IJGA 4DV2B 3CJHA 2PI5A 5EZYB 1T5EA 3L70H 2QTOA 1Q3EA 2XAGA 1S72V 4HNAB 3KCYA 5IYBO 2DQ0A 5DN6G 4JI4O 2X7RB 5L3DA 4ZI7B 4TOIA 3IAYA 3M7MX 3CD6V 1D5AA 4PDRA 3B8NA 4WF9V 1URFA 2ZIOA 3SPJA 2QWQB 3FAVB 1YTFD 1O9HA 4LF7O 2DW4A 4FVMA 4EB6A 1K92A 4LP8A 4DK1A 1KP3A 5KMGA 5J2UA 4JYAO 2YIAA 1OJHA 1SERA 1HP8A 4UXNA 1FXKC 3HR0A 3K06A 2ZDIA 1GTOA 3QNEA 4RUEA 1XILA 4GX5A 2FTKA 1TAEA 4D7SA 4GX0A 1N34O 1COWG 3HB3B 1Y76A 2WLNA 1Z5WA 3CCRV 1XREA 1BQ0A 1DF5A 4H44B 3UQ8A 2Q9LA 5CBFA 2W0XA 4I9QA 4LFBO 5LHHA 2FKXA 3OGIB 5H5NA 1QQCA 1HW7A 1Q6IA 3LDDA 5ITZA 4DR5O 1K7DA 3DSQA 2ETNA 2JVDA 1W0KG 1XNRB 1G4YB 1SZTA 5B1BB 1Y76B 4J9ZB 2CE4A 3M99B 3OAAG 5A2QN 1QLEC 2GSMB 4X1IA 2Q8VA 5GW7A 2L35A 3U0ZA 1WNSA 4LF5O 1RPOA 2OIEA 5B1OA 4MT8A 1N32O 4NTWA 5KHJA 4I50A 5ITZB 5JJEB 2LW1A 2HVJC 2QJ1A 5A9GA 3OD4A 1AILA 3CCQV 4B3TO 4LF6B 4B3RO 2B1IA 1Y74A 1QLNA 1V54B 1A32A 4MVUA 1OCRB 5JJNB 4PA4A 5JH7A 4IIJB 3BHPA 2F4VB 1EN6A 2ZR3A 4X1IB 2UXCO 2P4KA 4OXSA 3G4SV 4DR7B 4MVOA 3ZHQA 1SQFA 1N36O 2JS5A 4FFKA 3SGIA 1S77D 3E2EA 2ZE6A 5JCOA 1QVFU 2XOKG 4GZRB 4J41A 4I50B 4KL1A 3RYCA 1XL4A 2YIBD 2IM9A 1Y74B 3K08A 4FM2A 1FFTB 2LFRA 4L8JA 3JSLA 2G38A 5LMNB 2Q68A 4UVCA 4LF4B 2DYSC 5EC2C 4JASA 3E8FA 3F7VC 4JI8B 3F5TA 1VEWA 4I0XB 1J5EB 3HKEA 2K1EA 4CH4A 1ZAUA 1R3LC 4XBFA 4GKJB 1N0NA 5AG2A 3ZJZA 2F95B 2QKAA 3FYIB 2ZQMA 1VQ6V 1IXBA 2YXYA 3SJBC 4DK0A 2GBOA 4WFBV 1B3QA 3KCXA 4TV8A 3TCUA 1EZJA 1Q5OA 4RWUA 3CHXA 1GK9A 1PKXA 5JVDB 1F7YA 4FMTA 1GM8A 3HKEB 4H0LB 2EBOA 1MA1A 3JD0A 5EBWC 1RM1C 3ASNB 3SDLA 1VQ8V 3HKCA 3ZN1A 3B2EE 4TV9B 4JV5B 2YI9A 3W7SA 4MTFA 1AROP 1K5QA 3W7WA 1Q6HA 4XDLA 1FXKB 3FKSG 5FNVA 4DV0B 2YDEA 5LOVA 2BTQA 3CXCU 3LDEA 2QGNA 4J80A 1AJPA 4MVZA 1X4TA 1W59A 3E89A 1H2LA 4J11A 2B5UA 3BA8A 2CUGA 2XASA 3CYOA 4NB5A 5J2TB 3I55V 3K9SA 1SQVH 2F93B 2WLKA 3E8HA 1HNZO 3UT5A 1XNQO 2UUBB 2E76B 1AI5A 5FNVB 2Y69C 3HKDA 4AQYB 2D3OW 4KHPB 3AG1C 4DRXB 1IBLO 2R9AA 2BTQB 5LA6A 1VARA 4I4TA 1YVWA 2A79B 1H8HG 4K0KB 3F5WC 1JX9A 3T4DA 3JD3A 2Q4PA 2AHYA 3C3TA 1VQNV 2WAMA 5LGUA 4WFAV 4E2LA 4O4JA 4X20B 1EZVH 4XDKA 3AG4C 4ZBMA 3TETA 2CK3G 1YHQV 4DW1A 3APOA 3UT5B 4O4IA 5LYJB 3IJ4A 4DV7O 4YHHO 2E5LO 1RSOA 2P4VA 3IFXA 3PN1A 1Y67A 4I55B 4ABMA 3CCMV 4JI3O 1S0VA 1BHBA 3WB1A 2EILC 1QU7A 3NR7A 3CRMA 4GX1A 3CRRA 2R72A 4JI0B 1BE3H 1IZ3A 2IJIA 4O4JB 3T4ZA 5EBMC 3VOUA 4JI6B 3UKMA 1VQPV 1L1FA 5L3GA 2XT9A 3K58A 2IW5A 3OTOB 4O4IB 4Z2WA 1Q8IA 1NTZH 5FLXN 1AVMA 4BIOA 2YC0A 4JI7B 2GV9A 2YXHA 4BW9A 5LHGA 4G2KA 4DR1B 4MTXA 2QDOA 3SPIA 4X1YA 2DYSB 1F23A 1GAXA 1IBMB 5JJJB 4WCEV 3ETDA 4F6EA 1FYJA 3CXHF 1YI2V 3E35A 2EIMC 2CAZC 4X88A 2P67A 1K5SA 2FMLA 1MG1A 2Q6AA 1XUQA 2Z5UA 1VQLV 1Y6XA 2ZCEA 5CBGA 4QJFB 1PL0A 1QHTA 4U3JA 1SQBH 2UUCO 5CA1A 3TXQA 3K5OA 3OMAB 4X66O 3EFFK 1Q6UA 3CCLV 3D3IA 4LF8O 3RYHA 3E22B 4YJ3B 1I94O 1ZX3A 1BGYH 1WA8A 3K9AA 2P7TC 1H8EG 5LL6Y 4H37A 3IGAC 1NT2B 3F7YC 3CS5A 1RM1B 1OCOB 3B40A 2W0FC 1UJWB 2VRZA 2FB5A 3CC2V 1KYOF 3SYPA 2CTWA 2ZM6O 2GHYA 4RAIA 5K1PA 3RYFB 4K35A 1K33A 4NXNO 4MVRA 1GN2A 1PM9A 5IJ0A 3RFRA 3RT3C 4CC6A 5B3SC 1P49A 2CH7A 2BCCH 4MW3A 1SQPH 2X6CA 1Q90D 2QKCA 3SPHA 4FM0A 3N27A 1RP3B 1AR1B 2WLIA 2HHHB 1S76D 1YF2A 1AP6A 3ZRWB 4ZKIA 5IJ0B 1H38A 5B1NA 2RJZA 1YIJV 4B3SB 2Y69B 3W7XA 1VF6A 5B1AC 1UPGA 1WP7A 1TUBB 1CPYA 3AG1B 5BR8B 4GKKO 1AR5A 2N74A 4LFAO 4DUZO 5E79Z 4EKWA 3L74H 4B7KA 1YDXA 1F4MA 1Y4MA 1YZBA 1K8AW 3AG2C 1MSWD 1B06A 4DV1B 2QM7A 4LF9B 4JI8O 4F6RB 1D2DA 3P30A 1OCZC 2JEXA 1Z5VA 4W4KA 2WLIB 1N0JA 2HFEC 2ZE7A 2AGAA 3G6EV 1FJGO 3AG4B 1XMOO 1VF5B 3UO2A 2QM4A 3H1HH 1WLEA 3K5MA 1Z2GA 5EZYA 1ZL8A 5H6QA 1UFIA 4HNAA 1GM9A 2EJ7A 4DYLA 1NH2B 4PD4F 4UB8Z 4TQFA 3N2GB 4ZI7A 2YS8A 2EILB 1R6NA 1B6QA 4MW8A 1WPBA 3T1HO 1KU9A 2V4DA 1EM1A 3OE7G 1N8RW 1YEWA 1EN5A 3ASOB 4JAUA 3GVMA 2A7WA 4X1KB 3JAWB 3APQA 3JCZA 2AHZA 1VQMV 3VQVA 4X62B 3A8TA 1ZL8B 1JFFB 4UCTA 1MMMA 5LXTB 1BSMA 4CS2A 2XUMA 2QSAA 4MVQA 4BAYA 4ZOLA 3ABKC 3UCSC 2EZPA 2EIMB 5BY1A 2LO1A 3J80N 4NXMO 2VQEB 3G71V 4JYYA 1VQ7V 1MNGA 1DLBA 4X65O 1NTMH 2EJRA 3QG5A 4KP4A 3O65A 5BMVA 3K5LA 4LFCB 4KHPO 1N33O 3WB0A 4PA9A 1K3EA 4ZOLB 4K0KO 1R3IC 3QTCA 4UB6Z 4PA6A 2OCCC 5IWAB 4IYIA 4DV3O 2VQFO 4DR6O 3ETGA 1BS3A 3ZEDA 1XHXA 4QPJA 4K3AA 4XDJA 3RGBA 1SQXH 4JYCA 5GTIZ 1W0JG 4QPKA 1RFYA 1XL6A 3K03A 4QE9A 2NN4A 3ZHVA 2UXDB 4DV6O 3FX7A 4AI8A 2DE0X 3TJTA 3IC7A 5BMVB 1PD3A 4UV9A 1PNKA 3JD2A 4DR3O 4ICGA 1JA8A 2WLLB 2DOSA 3DC6A 1L0NH 2JK5C 3CCEV 4IIJA 1THZA 1LUVA 4PA7A 4N23A 1SQGA 4UVAA 4PDVA 3LUTB 1NR1A 3L71H 1FPOA 4UUJC 4JI6O 2CTQA 4BR6A 1OZ0A 3OFNG 4X89A 4GYCB 2OTLV 4CS4A 4DUYO 1YSCA 1YXBA 1SQQH 5IE9A 2N05A 5C8YB 1M56C 4FZ0A 3X2QB 2EINB 1CP9A 1FFXB 1XMQB 5B1AB 1VQ9V 1F51A 4IHJB 3RYIB 3OM3B 4BWAA 2CTRA 1SESA 1KB9F 3AG2B 2H8PC 1KC8W 1EFRG 4I0XA 2V1DA 1OCZB 2KB1A 4D6TH 2JS3A 4A5UB 5L3BA 4NYKA 4CC5A 4FIPC 4MTGA 3VBBA 3CMAV 4X9QA 2HJFC 4UV8A 4P9OA 2O57A 1KECA 4JI2O 3CE2A 3BRCA 2E75B 1O9GA 3JAKB 2P90A 2Y48A 2A0LA 5LMUO 5JVDA 2UU9B 2EIKC 3C90A 3ZHTA 4U3FH 5KA5A 3SR2C 4ZIBA 1MABG 4NVPA 1GM7A 1JNBA 4I7ZB 4TV9A 1EN4A 1QR8A 2BE3A 5EIBD 4DR2B 4J7ZA 1XI1A 4JI1O 2C2AA 1OCCC 1M57C 1NR7A 1GMGA 3ZHUA 1KKCA 3SYCA 1NTKH 4X64O 1PNMA 1MZFA 1FXKA 2Z0AA 4B7EA 3T1CA 2AXTZ 3N2KA 2GTSA 5KX5B 2HR3A 3SJCC 4FZ1A 1NZ6A 1OV9A 1L8DA 1R6KA 4YY3B 2KKWA 3ABKB 1BZKA 4O2AB 3QO5A 1AI6A 3T1YB 3K0GA 2NR5A 5EIBC 2JGUA 4DR4B 4CH6A 2F1MA 5J2TA 4ZHQA 3D36C 3CCVV 3ZS8C 4TQDA 4HZ3A 4Q6GA 2HHHO 1H2SB 5KLVH 1ZUQA 2A3QA 1FKAO 1FS0G 1HNWB 1HR0B 3DGEA 1FAFA 4PI0A 2ZR2A 4B3SO 2OYQA 2N04A 4LBEC 2HJDA 3N2KB 4DRXA 2BSKA 4JI5O 3OTFA 2P5OA 3K5NA 1M9NA 5DM6V 4H33A 4OX9O 1YTFB 4DV5B 2JJ1G 2V7QG 5IJ9B 1HNXB 2Y0IA 4B3MB 3JASB 3CC7V 2OCCB 2DQ3A 5E1AC 3ZMSA 2Q7EA 2LQTA 2WPDG 2KSDA 4NKGB 4ZHQB 2IH1C 4NTXA 4X20A 4JI4B 2LGQA 4J10A 1B04A 4YJ2B 5L3FA 1J95A 1AI7A 1ENVA 1NVPD 5LYJA 3BY6A 4J7KA 3H9VA 3SJAC 3CMEV 1IX9A 2YICA 4LF7B 2A06H 5FPOA 5EC1C 1OHHG 2DJVA 2BSKB 2Q5ZA 4I55A 4GCZA 1K97A 1FXHA 3ZMZA 4BW5A 3U10A 5LGNA 2HKOA 4JYAB
chains in the Genus database with same CATH topology
3CEIA 4YIOA 3MDSA 1Y67A 3TJTA 1WB8A 1JR9A 1EN4A 3EVKA 4JZ2A 1GN2A 1MA1A 1PM9A 1EM1A 1WB7A 1JA8A 1KKCA 4E4EA 3DC6A 3DC5A 1EN5A 1AR4A 1GN3A 1LUVA 5A9GA 1I0HA 3BFRA 4GUNA 1I08A 2AW9A 4YIPA 1MMMA 1AP5A 1IDSA 1EN6A 2QKCA 4BR6A 1BSMA 2P4KA 1AVMA 3IC9A 3LSUA 1SZXA 3OT7A 1LUWA 4FFKA 3C3SA 1AP6A 1XILA 1XDCA 1ZUQA 3K9SA 3AK1A 2GDSA 1AR5A 4JYYA 4F6EA 3AK2A 1XREA 1MSDA 1BT8A 2RCVA 1MNGA 3AK3A 1GN6A 4C7UA 3RN4A 1B06A 1ZSPA 1VEWA 3QVNA 1VARA 1XUQA 3KKYA 1PL4A 2ADPA 1N0JA 2CDYA 1D5NA 4X9QA 1N0NA 5AG2A 2QKAA 3C3TA 1P7GA 1IXBA 1BS3A 4JZGA 2ADQB 1GN4A 1IX9A 2CE4A 3KDRA 1ZLZA 1ZTEA 1QNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEI A;  4YIO A;  3MDS A;  1Y67 A;  3TJT A;  1WB8 A;  1JR9 A;  1EN4 A;  3EVK A;  4JZ2 A;  1GN2 A;  1MA1 A;  1PM9 A;  1EM1 A;  1WB7 A;  1JA8 A;  1KKC A;  4E4E A;  3DC6 A;  3DC5 A;  1EN5 A;  1AR4 A;  1GN3 A;  1LUV A;  5A9G A;  1I0H A;  3BFR A;  4GUN A;  1I08 A;  2AW9 A;  4YIP A;  1MMM A;  1AP5 A;  1IDS A;  1EN6 A;  2QKC A;  4BR6 A;  1BSM A;  2P4K A;  1AVM A;  3IC9 A;  3LSU A;  1SZX A;  3OT7 A;  1LUW A;  4FFK A;  3C3S A;  1AP6 A;  1XIL A;  1XDC A;  1ZUQ A;  3K9S A;  3AK1 A;  2GDS A;  1AR5 A;  4JYY A;  4F6E A;  3AK2 A;  1XRE A;  1MSD A;  1BT8 A;  2RCV A;  1MNG A;  3AK3 A;  1GN6 A;  4C7U A;  3RN4 A;  1B06 A;  1ZSP A;  1VEW A;  3QVN A;  1VAR A;  1XUQ A;  3KKY A;  1PL4 A;  2ADP A;  1N0J A;  2CDY A;  1D5N A;  4X9Q A;  1N0N A;  5AG2 A;  2QKA A;  3C3T A;  1P7G A;  1IXB A;  1BS3 A;  4JZG A;  2ADQ B;  1GN4 A;  1IX9 A;  2CE4 A;  1ZLZ A;  1ZTE A;  1QNM A; 
#chains in the Genus database with same CATH topology
 1VQ4 V;  4PEL A;  4YIO A;  1JR9 A;  2ZNJ A;  1JQ0 A;  1QLE B;  3PJS K;  3I5D A;  4DV4 O;  2QWO B;  4HBN A;  5LHI A;  2EZO A;  1N34 B;  2B9Z A;  4DV2 O;  4RQE A;  2YEV B;  1HDJ A;  3ML0 A;  2M7W A;  3CRQ A;  3FB7 C;  4R50 A;  3BA9 A;  4WFF A;  2Q67 A;  1I5Y A;  1XOU A;  4DR5 B;  5LP6 C;  1JVM A;  2ZKO A;  1G8M A;  3H1I H;  2YXL A;  2PTM A;  1KP2 A;  3A2F A;  2YIB A;  1GN6 A;  1QCE A;  1ZSP A;  3FD9 A;  4LF5 B;  2W6I G;  3KKY A;  1VMG A;  2IJH A;  4J7J A;  4MS2 A;  3E22 A;  4YJ3 A;  4ASU G;  2UXN A;  2EIK B;  1Q43 A;  2UXB B;  2EUL A;  5FPR A;  4B3T B;  4B3R B;  3E8G A;  2WLH A;  5IYC O;  3VQW A;  2NLJ C;  3RYF A;  1RPR A;  3CSX A;  1OCC B;  1M57 B;  2IU0 A;  1EBO A;  2UXC B;  3P32 A;  5L3E A;  4GT1 A;  3ZMV A;  2XHB A;  2IBZ H;  2M6Y A;  3EVK A;  2JGD B;  1N36 B;  1XNR O;  2AZ2 A;  3OR6 C;  2LJ2 A;  1SET A;  2B1G A;  3RWR D;  3UM7 A;  1SS3 A;  1K9M W;  3DXR B;  3U11 A;  1WP8 A;  3NXS A;  1Q81 W;  2XAH A;  1R3K C;  2AW9 A;  3DTU B;  3RBZ A;  5EBL C;  3GWK C;  3ZHR A;  1IBK B;  4JGS A;  3ZN0 A;  2K9P A;  1PNL A;  1GRJ A;  1H2N A;  3BAA A;  4OGQ B;  3ZRW A;  3FFQ A;  2OCH A;  2QA4 V;  4CBC A;  4U7O A;  1XMQ O;  5KHK A;  1TUB A;  2QKS A;  2EX3 A;  1DK1 A;  5KHI A;  1M4U A;  1US6 A;  1AB3 A;  4LF6 O;  2X6A A;  3CCU V;  1ORQ C;  2PY5 A;  3TGU H;  4JAV A;  2F4V O;  5H2F Z;  2ZDI C;  4F6R A;  3CRC A;  2JEU A;  4R8C A;  3MHS C;  4LR3 A;  4DR7 O;  1H2M A;  3K3W A;  3JD1 A;  4G27 B;  4JF3 A;  2XAJ A;  1PL4 A;  2IH3 C;  4TUY A;  4PDL A;  4OPA A;  3WU2 Z;  3B8M A;  2PI4 A;  4JZG A;  5JQG A;  3ABL C;  5LGT A;  4FJC C;  3OMI B;  4RUF A;  2OIG A;  3N2G A;  2WA3 A;  2X0L A;  3KDR A;  5LMN O;  1PPJ H;  4LF4 O;  3G6B A;  4TSF G;  1BMF G;  1I5X A;  2IU3 A;  2UU9 O;  3P3P A;  1J5E O;  1BHA A;  5H9C A;  3HPL C;  1WB8 A;  1SA0 B;  4GKJ O;  4IGG A;  2HP8 A;  1V54 C;  4X1K A;  1SC5 B;  4TUY B;  3JAW A;  1WB7 A;  3D8C A;  4DR2 O;  2ZIN A;  2JRI A;  3K0D A;  2LP7 A;  5GON B;  4G28 B;  1JFF A;  2P22 C;  4Z1V A;  5LXT A;  3CRA A;  5JQG B;  1YIT V;  2Q7H A;  4K8Z A;  1R73 A;  5EYP B;  3LDC A;  4X8A A;  2R70 A;  2FL4 A;  1HNZ B;  5CB4 B;  4YY3 O;  2P06 A;  2YSU B;  3SJQ C;  3OEH G;  2GUZ B;  3CP1 A;  1IBL B;  3JAT B;  1SZX A;  2LGW A;  1LUW A;  5LP6 B;  4QIW F;  1JPX A;  1TVK A;  2RMK B;  3ABU A;  4JV5 O;  2LW7 A;  3J7A U;  2OTJ V;  2ILM A;  4YXW G;  2UUA B;  3ZMU A;  4WFH A;  4R6Z A;  2ZNI A;  1HR0 O;  4FM1 A;  1AJQ A;  4W4L A;  2RCV A;  4FFB A;  4QNH B;  3H1L H;  5FL7 G;  4DV0 O;  2WWW A;  3EXA A;  4IYH A;  2DN9 A;  5JCO C;  3K59 A;  4DV7 B;  1K73 W;  4YHH B;  2E5L B;  4B3M O;  1PV0 A;  2QE7 G;  5IYZ B;  3TXS A;  5KAF Z;  4JI3 B;  3JSN A;  1SF9 A;  2DWD C;  2ODM A;  2RDC A;  1TVK B;  1SKV A;  4O2B B;  1LNQ A;  2VWK A;  3ZX6 A;  3JAL B;  2UUB O;  5B66 Z;  4MTO A;  4O4H A;  1R1B A;  3CWB H;  5J9P C;  4FFB B;  4AQY O;  1ROP A;  3ZIA G;  1R6T A;  3ASN C;  1K4D C;  1G1X B;  3OMN B;  3G67 A;  2ZIM A;  3LNM B;  1Q7Y W;  4JYB A;  3ZBH A;  2WLL A;  3VQX A;  3LNN A;  4I9W A;  2BTO A;  3FYE B;  4P2Z A;  1NBM G;  3CJH B;  4R7C A;  2Y0P A;  4FLY A;  1TUE B;  4IT5 A;  1FD9 A;  4FK5 C;  2EIJ C;  4Z1M G;  1XBL A;  3B09 A;  3OEE G;  2YUA A;  4JTC B;  3MHH C;  2QTS A;  3BFR A;  3EHB B;  3J81 N;  2ZT9 B;  1L0L H;  4YIP A;  4O4H B;  5C8Y A;  2R9R B;  1AP5 A;  5KA6 A;  5B3S B;  1TGO A;  2ITC C;  1NS1 A;  1FFX A;  1CEZ A;  4EB6 B;  3QO8 A;  1BCC H;  2PZS A;  3IC9 A;  5KMG B;  5J2U B;  4IHJ A;  4JAA A;  1NI8 A;  3RVY A;  3RYI A;  3OT7 A;  2JJ2 G;  2PYJ A;  3C3S A;  1YJN V;  4QE7 A;  1WPX A;  5IYD O;  3WB2 A;  4JI0 O;  2UUC B;  4JTD B;  3K04 A;  3WG7 C;  4X66 B;  5K1X A;  3CB2 A;  4LF8 B;  1SRY A;  1E1R G;  1MSD A;  3OTO O;  5HFL A;  2Q0O C;  1I94 B;  2PYL A;  4U7N A;  4BIZ A;  1VQO V;  2IJJ A;  3OR7 C;  4LNU A;  1M1K W;  3RN4 A;  2OWO A;  2DMX A;  1MZE A;  4F4L A;  4JI7 O;  2XAF A;  2ZM6 B;  3ABL B;  5KHG A;  1AJN A;  2ARH A;  4DR1 O;  5EK0 A;  4P9P A;  2CDY A;  1D5N A;  2Q0A A;  2RQ6 A;  4NXN B;  1DF4 A;  4O4L A;  2W6J G;  3STZ C;  3STL C;  3JAK A;  5KHH A;  3O9O A;  1IBM O;  3LSQ A;  1WAZ A;  1KMI Z;  4CS3 A;  2UXB O;  1S5L Z;  2XTA A;  3AEI A;  2QWN B;  5D5P A;  5DED A;  1ZLZ A;  2MW2 B;  1H2K A;  1ZWI C;  4MSW C;  4LNU B;  4LH7 A;  4OPH A;  3CEI A;  5HFM A;  3MDS A;  1IVS A;  1LR1 A;  1KD1 W;  2GTA A;  3OUS A;  5KX5 A;  4O4L B;  3FB5 C;  1AR4 A;  2A9H A;  1IUR A;  3Q4H A;  3ETE A;  4O2A A;  5IDJ A;  1DGS A;  1F4N A;  4GKK B;  2ZE8 A;  3KZI Z;  3JCU Z;  4LFA B;  3BAB A;  4KXR A;  4DUZ B;  3AG7 A;  1R3J C;  2Q69 A;  1IBK O;  5JH7 B;  4FLT A;  1DTO A;  3LSU A;  2F23 A;  4EEQ A;  1FJG B;  2YID A;  5JWP A;  1VP7 A;  2QWR B;  1S5H C;  3AK1 A;  3LSS A;  1XMO B;  1H2G A;  4H13 B;  5IJ9 A;  3Q4H B;  4PA3 A;  3AK2 A;  3GWO A;  1NQT A;  3JAS A;  1BT8 A;  1M93 A;  4I5S A;  3RYC B;  1Q82 W;  4EFE A;  4FLW A;  4TT3 G;  4C7U A;  3TK1 A;  4KFM A;  3ETQ A;  4MVS A;  4YJ2 A;  1GH6 A;  3T1H B;  2ADP A;  1NKD A;  3E8B A;  4FPP A;  1OCO C;  5BR8 O;  3SYQ A;  1AI4 A;  4UCR A;  1XQ8 A;  2F66 C;  2WLJ A;  5CN0 A;  3BVO A;  1XEQ A;  4FLX A;  2YI8 A;  2E74 B;  2CGO A;  1QNM A;  3K79 A;  4DV1 O;  1V9P A;  4LF9 O;  3QF7 A;  4TV8 B;  1S3J A;  4WBN A;  4FLV A;  2XAQ A;  2EIJ B;  4PI2 A;  2DWE C;  3AG3 C;  1JMK C;  1QBZ A;  1VIB A;  3S3W A;  4NR1 A;  5C93 A;  2UXX A;  3SPG A;  5BZB A;  4FLU A;  2NNU A;  4AHC A;  1P7B A;  4E4E A;  1HWY A;  2Q73 A;  3DC5 A;  1WN7 A;  1GN3 A;  1CXZ B;  2XND G;  2YEV A;  4KUM A;  4GUN A;  3HKC B;  1I08 A;  4NXM B;  2R9I A;  2KQX A;  1QR9 A;  2ZXW C;  4AIL C;  3ICX A;  2PUS A;  3K57 A;  2JDI G;  3I56 V;  4X65 B;  1W2B U;  1V55 C;  2HEP A;  4WBN B;  3JAR A;  1N33 B;  3WG7 B;  5LOV B;  1FXV A;  3FB6 C;  2Q7G A;  4DXW A;  4PJ0 Z;  1K34 A;  3L75 H;  4HAM A;  1NH2 D;  3BCC H;  4DV3 B;  4LCU C;  2GDS A;  4UCU A;  4WFG A;  4X62 O;  2VQF B;  1XHZ A;  1M56 B;  2UUA O;  4DR6 B;  1KBH A;  3T2M A;  2RNB A;  4CZZ A;  3SYO A;  3AK3 A;  1P4R A;  3L73 H;  2FYU H;  4LFB B;  4RQF A;  2Y4T A;  5KUK A;  4LH6 A;  1Y66 A;  1BQZ A;  3L9D A;  3QO7 A;  4DV6 B;  5DEC A;  1VF6 C;  3ZRX A;  3JAR B;  1FOU A;  3HKD B;  5F2V O;  4WFE A;  3A0R A;  1H5W A;  5LA6 B;  4DR3 B;  4I4T B;  5IY5 C;  4UCV A;  3H01 A;  2VQE O;  2HG5 C;  1N4C A;  1GN4 A;  2CGN A;  3CX5 F;  2ZE5 A;  3KG2 A;  1P84 F;  2DYR C;  3CCS V;  3ABM C;  3R65 A;  3S3X A;  1S5J A;  3B77 A;  4MVM A;  4LFC O;  3WFV A;  4IL6 Z;  3ASO C;  4NTY A;  2JGD A;  1M90 W;  2QM8 A;  3ZRV A;  1YJW V;  4DUY B;  4PHZ A;  4BIU A;  1N32 B;  4LC1 A;  3RVZ A;  4JZ2 A;  3DXR A;  1RSO B;  5L3C A;  3ZMT A;  5CA3 A;  2VS0 A;  5IWA O;  3OGC C;  2IJK A;  4P30 A;  1QVG U;  5KAI Z;  3W7U A;  2WA4 A;  4JPR A;  4CH5 A;  2RN9 A;  2Z3Y A;  1I0H A;  3D36 A;  3ZCC A;  3MD0 A;  3CCJ V;  3ZHS A;  1KQS U;  3BPZ A;  5CBH A;  2ITD C;  2UXD O;  3H1J H;  1VQ5 V;  1NU1 H;  1YJ9 V;  3L72 H;  2WSS G;  4GX2 A;  4UVB A;  5CMU A;  4N21 A;  4PV1 B;  3UO3 A;  1NJI W;  4FLZ A;  1KUQ A;  3R66 A;  4TWK A;  2ZD9 A;  4PDM A;  3HKB A;  3B4S A;  4B08 A;  2WLM A;  4JI2 B;  3CC4 V;  4CH3 A;  3W7T A;  5BXZ A;  1Q86 W;  4X1Y B;  4DW0 A;  5LMU B;  2D2C B;  3QVN A;  2P6J A;  1GO3 F;  4UCO A;  2H3O A;  1YCI A;  2KG7 A;  4JI1 B;  2L6L A;  3HKB B;  1P7G A;  3SPC A;  2X6B A;  3THO A;  4UCS A;  1VQK V;  4X64 B;  1MOF A;  3A0H Z;  3MAQ A;  2ADQ B;  3JYC A;  4J9Y B;  4U3J B;  5CA1 B;  1KKD A;  4D7T A;  3P3N A;  3JD4 A;  3AG3 B;  2ATK C;  3RYH B;  3JAM N;  1I7F A;  1SA0 A;  3A0B Z;  5B1B C;  3ZRS A;  2H94 A;  4QGP A;  1WA8 B;  2HLD G;  4GLX A;  2OT5 A;  1G6U A;  5GON A;  2HVK C;  4RO2 A;  2KG7 B;  5IT9 N;  5EYP A;  1X59 A;  2ZXW B;  2JIZ G;  4UFZ A;  5CA0 A;  2QWP B;  5LBQ A;  1BL8 A;  3OW2 U;  5CB4 A;  1V55 B;  2VWJ A;  3X2Q C;  1U97 A;  2BOB C;  2CH7 B;  2EIN C;  2GUZ A;  3OUF A;  1IDS A;  2MK3 A;  4JI5 B;  5B5E Z;  3E83 A;  3JAT A;  1NVP B;  4LWS A;  3GB7 C;  2PF4 E;  4OX9 B;  3BEH A;  1K4C C;  5LP6 A;  5TIS Z;  3ABT A;  1VF7 A;  1OCR C;  3H1K H;  1M5I A;  1PP9 H;  4DO2 A;  2F43 G;  3E86 A;  1GKF A;  1U96 A;  1JJO A;  2PGG A;  2CTP A;  1JOY A;  1XDC A;  2E3C A;  2QR4 A;  1WJZ A;  1XNQ B;  4Q20 A;  4HYO A;  5CA0 B;  5D5Q A;  4K8X A;  3T1Y O;  5H6R A;  2LFS A;  5IYZ A;  4LWS B;  4EFB A;  3CPW U;  3D3Q A;  3SYA A;  1IXM A;  5IY5 B;  4DR4 O;  2Y4U A;  2QEX V;  3FB8 C;  3G80 A;  4J42 A;  4O2B A;  2BOC C;  3JAL A;  1E1Q G;  1JJ2 U;  3M8A A;  2AZ0 A;  4L87 A;  1HNW O;  2DYR B;  3FAV A;  3RW0 A;  5KUM A;  1TA8 A;  3ABM B;  1JCH A;  3VQY A;  4DV4 B;  4JTA B;  5GTH Z;  4DV5 O;  1E79 G;  1ZTE A;  1HNX O;  1IJG A;  4DV2 B;  3CJH A;  2PI5 A;  5EZY B;  1T5E A;  3L70 H;  2QTO A;  1Q3E A;  2XAG A;  1S72 V;  4HNA B;  3KCY A;  5IYB O;  2DQ0 A;  5DN6 G;  4JI4 O;  2X7R B;  5L3D A;  4ZI7 B;  4TOI A;  3IAY A;  3M7M X;  3CD6 V;  1D5A A;  4PDR A;  3B8N A;  4WF9 V;  1URF A;  2ZIO A;  3SPJ A;  2QWQ B;  3FAV B;  1YTF D;  1O9H A;  4LF7 O;  2DW4 A;  4FVM A;  4EB6 A;  1K92 A;  4LP8 A;  4DK1 A;  1KP3 A;  5KMG A;  5J2U A;  4JYA O;  2YIA A;  1OJH A;  1SER A;  1HP8 A;  4UXN A;  1FXK C;  3HR0 A;  3K06 A;  2ZDI A;  1GTO A;  3QNE A;  4RUE A;  1XIL A;  4GX5 A;  2FTK A;  1TAE A;  4D7S A;  4GX0 A;  1N34 O;  1COW G;  3HB3 B;  1Y76 A;  2WLN A;  1Z5W A;  3CCR V;  1XRE A;  1BQ0 A;  1DF5 A;  4H44 B;  3UQ8 A;  2Q9L A;  5CBF A;  2W0X A;  4I9Q A;  4LFB O;  5LHH A;  2FKX A;  3OGI B;  5H5N A;  1QQC A;  1HW7 A;  1Q6I A;  3LDD A;  5ITZ A;  4DR5 O;  1K7D A;  3DSQ A;  2ETN A;  2JVD A;  1W0K G;  1XNR B;  1G4Y B;  1SZT A;  5B1B B;  1Y76 B;  4J9Z B;  2CE4 A;  3M99 B;  3OAA G;  5A2Q N;  1QLE C;  2GSM B;  4X1I A;  2Q8V A;  5GW7 A;  2L35 A;  3U0Z A;  1WNS A;  4LF5 O;  1RPO A;  2OIE A;  5B1O A;  4MT8 A;  1N32 O;  4NTW A;  5KHJ A;  4I50 A;  5ITZ B;  5JJE B;  2LW1 A;  2HVJ C;  2QJ1 A;  5A9G A;  3OD4 A;  1AIL A;  3CCQ V;  4B3T O;  4LF6 B;  4B3R O;  2B1I A;  1Y74 A;  1QLN A;  1V54 B;  1A32 A;  4MVU A;  1OCR B;  5JJN B;  4PA4 A;  5JH7 A;  4IIJ B;  3BHP A;  2F4V B;  1EN6 A;  2ZR3 A;  4X1I B;  2UXC O;  2P4K A;  4OXS A;  3G4S V;  4DR7 B;  4MVO A;  3ZHQ A;  1SQF A;  1N36 O;  2JS5 A;  4FFK A;  3SGI A;  1S77 D;  3E2E A;  2ZE6 A;  5JCO A;  1QVF U;  2XOK G;  4GZR B;  4J41 A;  4I50 B;  4KL1 A;  3RYC A;  1XL4 A;  2YIB D;  2IM9 A;  1Y74 B;  3K08 A;  4FM2 A;  1FFT B;  2LFR A;  4L8J A;  3JSL A;  2G38 A;  5LMN B;  2Q68 A;  4UVC A;  4LF4 B;  2DYS C;  5EC2 C;  4JAS A;  3E8F A;  3F7V C;  4JI8 B;  3F5T A;  1VEW A;  4I0X B;  1J5E B;  3HKE A;  2K1E A;  4CH4 A;  1ZAU A;  1R3L C;  4XBF A;  4GKJ B;  1N0N A;  5AG2 A;  3ZJZ A;  2F95 B;  2QKA A;  3FYI B;  2ZQM A;  1VQ6 V;  1IXB A;  2YXY A;  3SJB C;  4DK0 A;  2GBO A;  4WFB V;  1B3Q A;  3KCX A;  4TV8 A;  3TCU A;  1EZJ A;  1Q5O A;  4RWU A;  3CHX A;  1GK9 A;  1PKX A;  5JVD B;  1F7Y A;  4FMT A;  1GM8 A;  3HKE B;  4H0L B;  2EBO A;  1MA1 A;  3JD0 A;  5EBW C;  1RM1 C;  3ASN B;  3SDL A;  1VQ8 V;  3HKC A;  3ZN1 A;  3B2E E;  4TV9 B;  4JV5 B;  2YI9 A;  3W7S A;  4MTF A;  1ARO P;  1K5Q A;  3W7W A;  1Q6H A;  4XDL A;  1FXK B;  3FKS G;  5FNV A;  4DV0 B;  2YDE A;  5LOV A;  2BTQ A;  3CXC U;  3LDE A;  2QGN A;  4J80 A;  1AJP A;  4MVZ A;  1X4T A;  1W59 A;  3E89 A;  1H2L A;  4J11 A;  2B5U A;  3BA8 A;  2CUG A;  2XAS A;  3CYO A;  4NB5 A;  5J2T B;  3I55 V;  3K9S A;  1SQV H;  2F93 B;  2WLK A;  3E8H A;  1HNZ O;  3UT5 A;  1XNQ O;  2UUB B;  2E76 B;  1AI5 A;  5FNV B;  2Y69 C;  3HKD A;  4AQY B;  2D3O W;  4KHP B;  3AG1 C;  4DRX B;  1IBL O;  2R9A A;  2BTQ B;  5LA6 A;  1VAR A;  4I4T A;  1YVW A;  2A79 B;  1H8H G;  4K0K B;  3F5W C;  1JX9 A;  3T4D A;  3JD3 A;  2Q4P A;  2AHY A;  3C3T A;  1VQN V;  2WAM A;  5LGU A;  4WFA V;  4E2L A;  4O4J A;  4X20 B;  1EZV H;  4XDK A;  3AG4 C;  4ZBM A;  3TET A;  2CK3 G;  1YHQ V;  4DW1 A;  3APO A;  3UT5 B;  4O4I A;  5LYJ B;  3IJ4 A;  4DV7 O;  4YHH O;  2E5L O;  1RSO A;  2P4V A;  3IFX A;  3PN1 A;  1Y67 A;  4I55 B;  4ABM A;  3CCM V;  4JI3 O;  1S0V A;  1BHB A;  3WB1 A;  2EIL C;  1QU7 A;  3NR7 A;  3CRM A;  4GX1 A;  3CRR A;  2R72 A;  4JI0 B;  1BE3 H;  1IZ3 A;  2IJI A;  4O4J B;  3T4Z A;  5EBM C;  3VOU A;  4JI6 B;  3UKM A;  1VQP V;  1L1F A;  5L3G A;  2XT9 A;  3K58 A;  2IW5 A;  3OTO B;  4O4I B;  4Z2W A;  1Q8I A;  1NTZ H;  5FLX N;  1AVM A;  4BIO A;  2YC0 A;  4JI7 B;  2GV9 A;  2YXH A;  4BW9 A;  5LHG A;  4G2K A;  4DR1 B;  4MTX A;  2QDO A;  3SPI A;  4X1Y A;  2DYS B;  1F23 A;  1GAX A;  1IBM B;  5JJJ B;  4WCE V;  3ETD A;  4F6E A;  1FYJ A;  3CXH F;  1YI2 V;  3E35 A;  2EIM C;  2CAZ C;  4X88 A;  2P67 A;  1K5S A;  2FML A;  1MG1 A;  2Q6A A;  1XUQ A;  2Z5U A;  1VQL V;  1Y6X A;  2ZCE A;  5CBG A;  4QJF B;  1PL0 A;  1QHT A;  4U3J A;  1SQB H;  2UUC O;  5CA1 A;  3TXQ A;  3K5O A;  3OMA B;  4X66 O;  3EFF K;  1Q6U A;  3CCL V;  3D3I A;  4LF8 O;  3RYH A;  3E22 B;  4YJ3 B;  1I94 O;  1ZX3 A;  1BGY H;  1WA8 A;  3K9A A;  2P7T C;  1H8E G;  5LL6 Y;  4H37 A;  3IGA C;  1NT2 B;  3F7Y C;  3CS5 A;  1RM1 B;  1OCO B;  3B40 A;  2W0F C;  1UJW B;  2VRZ A;  2FB5 A;  3CC2 V;  1KYO F;  3SYP A;  2CTW A;  2ZM6 O;  2GHY A;  4RAI A;  5K1P A;  3RYF B;  4K35 A;  1K33 A;  4NXN O;  4MVR A;  1GN2 A;  1PM9 A;  5IJ0 A;  3RFR A;  3RT3 C;  4CC6 A;  5B3S C;  1P49 A;  2CH7 A;  2BCC H;  4MW3 A;  1SQP H;  2X6C A;  1Q90 D;  2QKC A;  3SPH A;  4FM0 A;  3N27 A;  1RP3 B;  1AR1 B;  2WLI A;  2HHH B;  1S76 D;  1YF2 A;  1AP6 A;  3ZRW B;  4ZKI A;  5IJ0 B;  1H38 A;  5B1N A;  2RJZ A;  1YIJ V;  4B3S B;  2Y69 B;  3W7X A;  1VF6 A;  5B1A C;  1UPG A;  1WP7 A;  1TUB B;  1CPY A;  3AG1 B;  5BR8 B;  4GKK O;  1AR5 A;  2N74 A;  4LFA O;  4DUZ O;  5E79 Z;  4EKW A;  3L74 H;  4B7K A;  1YDX A;  1F4M A;  1Y4M A;  1YZB A;  1K8A W;  3AG2 C;  1MSW D;  1B06 A;  4DV1 B;  2QM7 A;  4LF9 B;  4JI8 O;  4F6R B;  1D2D A;  3P30 A;  1OCZ C;  2JEX A;  1Z5V A;  4W4K A;  2WLI B;  1N0J A;  2HFE C;  2ZE7 A;  2AGA A;  3G6E V;  1FJG O;  3AG4 B;  1XMO O;  1VF5 B;  3UO2 A;  2QM4 A;  3H1H H;  1WLE A;  3K5M A;  1Z2G A;  5EZY A;  1ZL8 A;  5H6Q A;  1UFI A;  4HNA A;  1GM9 A;  2EJ7 A;  4DYL A;  1NH2 B;  4PD4 F;  4UB8 Z;  4TQF A;  3N2G B;  4ZI7 A;  2YS8 A;  2EIL B;  1R6N A;  1B6Q A;  4MW8 A;  1WPB A;  3T1H O;  1KU9 A;  2V4D A;  1EM1 A;  3OE7 G;  1N8R W;  1YEW A;  1EN5 A;  3ASO B;  4JAU A;  3GVM A;  2A7W A;  4X1K B;  3JAW B;  3APQ A;  3JCZ A;  2AHZ A;  1VQM V;  3VQV A;  4X62 B;  3A8T A;  1ZL8 B;  1JFF B;  4UCT A;  1MMM A;  5LXT B;  1BSM A;  4CS2 A;  2XUM A;  2QSA A;  4MVQ A;  4BAY A;  4ZOL A;  3ABK C;  3UCS C;  2EZP A;  2EIM B;  5BY1 A;  2LO1 A;  3J80 N;  4NXM O;  2VQE B;  3G71 V;  4JYY A;  1VQ7 V;  1MNG A;  1DLB A;  4X65 O;  1NTM H;  2EJR A;  3QG5 A;  4KP4 A;  3O65 A;  5BMV A;  3K5L A;  4LFC B;  4KHP O;  1N33 O;  3WB0 A;  4PA9 A;  1K3E A;  4ZOL B;  4K0K O;  1R3I C;  3QTC A;  4UB6 Z;  4PA6 A;  2OCC C;  5IWA B;  4IYI A;  4DV3 O;  2VQF O;  4DR6 O;  3ETG A;  1BS3 A;  3ZED A;  1XHX A;  4QPJ A;  4K3A A;  4XDJ A;  3RGB A;  1SQX H;  4JYC A;  5GTI Z;  1W0J G;  4QPK A;  1RFY A;  1XL6 A;  3K03 A;  4QE9 A;  2NN4 A;  3ZHV A;  2UXD B;  4DV6 O;  3FX7 A;  4AI8 A;  2DE0 X;  3TJT A;  3IC7 A;  5BMV B;  1PD3 A;  4UV9 A;  1PNK A;  3JD2 A;  4DR3 O;  4ICG A;  1JA8 A;  2WLL B;  2DOS A;  3DC6 A;  1L0N H;  2JK5 C;  3CCE V;  4IIJ A;  1THZ A;  1LUV A;  4PA7 A;  4N23 A;  1SQG A;  4UVA A;  4PDV A;  3LUT B;  1NR1 A;  3L71 H;  1FPO A;  4UUJ C;  4JI6 O;  2CTQ A;  4BR6 A;  1OZ0 A;  3OFN G;  4X89 A;  4GYC B;  2OTL V;  4CS4 A;  4DUY O;  1YSC A;  1YXB A;  1SQQ H;  5IE9 A;  2N05 A;  5C8Y B;  1M56 C;  4FZ0 A;  3X2Q B;  2EIN B;  1CP9 A;  1FFX B;  1XMQ B;  5B1A B;  1VQ9 V;  1F51 A;  4IHJ B;  3RYI B;  3OM3 B;  4BWA A;  2CTR A;  1SES A;  1KB9 F;  3AG2 B;  2H8P C;  1KC8 W;  1EFR G;  4I0X A;  2V1D A;  1OCZ B;  2KB1 A;  4D6T H;  2JS3 A;  4A5U B;  5L3B A;  4NYK A;  4CC5 A;  4FIP C;  4MTG A;  3VBB A;  3CMA V;  4X9Q A;  2HJF C;  4UV8 A;  4P9O A;  2O57 A;  1KEC A;  4JI2 O;  3CE2 A;  3BRC A;  2E75 B;  1O9G A;  3JAK B;  2P90 A;  2Y48 A;  2A0L A;  5LMU O;  5JVD A;  2UU9 B;  2EIK C;  3C90 A;  3ZHT A;  4U3F H;  5KA5 A;  3SR2 C;  4ZIB A;  1MAB G;  4NVP A;  1GM7 A;  1JNB A;  4I7Z B;  4TV9 A;  1EN4 A;  1QR8 A;  2BE3 A;  5EIB D;  4DR2 B;  4J7Z A;  1XI1 A;  4JI1 O;  2C2A A;  1OCC C;  1M57 C;  1NR7 A;  1GMG A;  3ZHU A;  1KKC A;  3SYC A;  1NTK H;  4X64 O;  1PNM A;  1MZF A;  1FXK A;  2Z0A A;  4B7E A;  3T1C A;  2AXT Z;  3N2K A;  2GTS A;  5KX5 B;  2HR3 A;  3SJC C;  4FZ1 A;  1NZ6 A;  1OV9 A;  1L8D A;  1R6K A;  4YY3 B;  2KKW A;  3ABK B;  1BZK A;  4O2A B;  3QO5 A;  1AI6 A;  3T1Y B;  3K0G A;  2NR5 A;  5EIB C;  2JGU A;  4DR4 B;  4CH6 A;  2F1M A;  5J2T A;  4ZHQ A;  3D36 C;  3CCV V;  3ZS8 C;  4TQD A;  4HZ3 A;  4Q6G A;  2HHH O;  1H2S B;  5KLV H;  1ZUQ A;  2A3Q A;  1FKA O;  1FS0 G;  1HNW B;  1HR0 B;  3DGE A;  1FAF A;  4PI0 A;  2ZR2 A;  4B3S O;  2OYQ A;  2N04 A;  4LBE C;  2HJD A;  3N2K B;  4DRX A;  2BSK A;  4JI5 O;  3OTF A;  2P5O A;  3K5N A;  1M9N A;  5DM6 V;  4H33 A;  4OX9 O;  1YTF B;  4DV5 B;  2JJ1 G;  2V7Q G;  5IJ9 B;  1HNX B;  2Y0I A;  4B3M B;  3JAS B;  3CC7 V;  2OCC B;  2DQ3 A;  5E1A C;  3ZMS A;  2Q7E A;  2LQT A;  2WPD G;  2KSD A;  4NKG B;  4ZHQ B;  2IH1 C;  4NTX A;  4X20 A;  4JI4 B;  2LGQ A;  4J10 A;  1B04 A;  4YJ2 B;  5L3F A;  1J95 A;  1AI7 A;  1ENV A;  1NVP D;  5LYJ A;  3BY6 A;  4J7K A;  3H9V A;  3SJA C;  3CME V;  1IX9 A;  2YIC A;  4LF7 B;  2A06 H;  5FPO A;  5EC1 C;  1OHH G;  2DJV A;  2BSK B;  2Q5Z A;  4I55 A;  4GCZ A;  1K97 A;  1FXH A;  3ZMZ A;  4BW5 A;  3U10 A;  5LGN A;  2HKO A;  4JYA B; 
#chains in the Genus database with same CATH homology
 3CEI A;  4YIO A;  3MDS A;  1Y67 A;  3TJT A;  1WB8 A;  1JR9 A;  1EN4 A;  3EVK A;  4JZ2 A;  1GN2 A;  1MA1 A;  1PM9 A;  1EM1 A;  1WB7 A;  1JA8 A;  1KKC A;  4E4E A;  3DC6 A;  3DC5 A;  1EN5 A;  1AR4 A;  1GN3 A;  1LUV A;  5A9G A;  1I0H A;  3BFR A;  4GUN A;  1I08 A;  2AW9 A;  4YIP A;  1MMM A;  1AP5 A;  1IDS A;  1EN6 A;  2QKC A;  4BR6 A;  1BSM A;  2P4K A;  1AVM A;  3IC9 A;  3LSU A;  1SZX A;  3OT7 A;  1LUW A;  4FFK A;  3C3S A;  1AP6 A;  1XIL A;  1XDC A;  1ZUQ A;  3K9S A;  3AK1 A;  2GDS A;  1AR5 A;  4JYY A;  4F6E A;  3AK2 A;  1XRE A;  1MSD A;  1BT8 A;  2RCV A;  1MNG A;  3AK3 A;  1GN6 A;  4C7U A;  3RN4 A;  1B06 A;  1ZSP A;  1VEW A;  3QVN A;  1VAR A;  1XUQ A;  3KKY A;  1PL4 A;  2ADP A;  1N0J A;  2CDY A;  1D5N A;  4X9Q A;  1N0N A;  5AG2 A;  2QKA A;  3C3T A;  1P7G A;  1IXB A;  1BS3 A;  4JZG A;  2ADQ B;  1GN4 A;  1IX9 A;  2CE4 A;  3KDR A;  1ZLZ A;  1ZTE A;  1QNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...