3OT7A

Escherichia coli apo-manganese superoxide dismutase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Subunit dissociation and metal binding by Escherichia coli apo-manganese superoxide dismutase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 73
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ot7A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ot7A02
1EN6A 2AW9A 4JZGA 1AR4A 3CEIA 1EN4A 1BSMA 3RN4A 1ZTEA 1IX9A 1AP6A 1D5NA 1SZXA 4JZ2A 1ZUQA 5AG2A 1Y67A 1XILA 4FFKA 2RCVA 2QKCA 4X9QA 3BFRA 1VEWA 4YIOA 2P4KA 3KKYA 1JA8A 1WB7A 1BS3A 1XREA 1GN6A 1IDSA 1AR5A 3TJTA 4YIPA 1GN4A 2ADQB 3C3SA 1B06A 1LUVA 3QVNA 5A9GA 1EM1A 1XDCA 2ADPA 1PL4A 4C7UA 2GDSA 1IXBA 1QNMA 3LSUA 3C3TA 3MDSA 1MA1A 3AK3A 3DC6A 4GUNA 1PM9A 4F6EA 3OT7A 1LUWA 1GN2A 2CDYA 1N0NA 1BT8A 1I08A 1P7GA 1AP5A 1VARA 1KKCA 3AK2A 1MSDA 1ZSPA 4E4EA 1EN5A 1ZLZA 1JR9A 3K9SA 1XUQA 1N0JA 3IC9A 4JYYA 1MNGA 2QKAA 3EVKA 2CE4A 1I0HA 3DC5A 3AK1A 1WB8A 1AVMA 1MMMA 4BR6A 1GN3A
chains in the Genus database with same CATH superfamily
3SYQA 2EULA 5B1BB 1GM8A 1NTKH 2Q68A 2ZR3A 3CHXA 3JSLA 1RSOA 1IX9A 1FXKA 2NLJC 2EINB 4GKKO 1PNMA 1P7BA 3DGEA 4RQEA 1IJGA 2FB5A 3K03A 3CCSV 4K0KB 2N74A 4IIJB 4Z1VA 5LOVB 3L75H 3JCZA 1XEQA 1FFXA 4X62B 5IJ9B 3FB6C 3T1YB 4MVZA 2GTAA 2HHHB 3GWKC 4DV2B 2CTQA 4IHJB 2MK3A 1QLEB 1T5EA 4D7TA 4OX9B 1MSWD 4CH3A 4WFEA 4X1KB 1AR5A 3A2FA 1N32B 3Q4HB 3BAAA 3W7TA 4DK0A 4O2BB 2ZDIC 3CCEV 4LBEC 3CCRV 3QO7A 3JAMN 2BSKA 5L3GA 5FNVA 3IAYA 4XDKA 3CXHF 4FLXA 4TV9B 1N34B 1IBKO 4WFBV 2ZT9B 4B3TB 3P3NA 3R65A 4WFGA 3BHPA 2IM9A 2GBOA 2WWWA 1Q81W 3D3QA 1IBLB 5CBFA 1SQFA 4MTGA 1AJPA 3L74H 5JVDA 1OCZC 4KXRA 3ZN0A 2EIJB 1XUQA 2FYUH 4B3SB 5IYDO 4LNUA 1HP8A 4LFCB 4FLTA 3AK1A 5JJJB 5B66Z 3ZEDA 2ZR2A 3ZRSA 4ASUG 1BGYH 4ICGA 5JQGB 5A2QN 3SYPA 3H1KH 1ZTEA 5BY1A 2Y69C 4LFCO 1FAFA 1VQKV 5CA0B 4I0XB 4AQYB 2NNUA 5KHGA 5LHGA 3ZRXA 5B3SB 5LP6C 2OTLV 2B9ZA 4JYCA 2VWJA 3FX7A 2XAHA 3DSQA 3CWBH 4HAMA 4I55B 1EBOA 5KX5A 4JAVA 2G38A 2V7QG 1VQ9V 1YXBA 4YY3O 5F2VO 4JGSA 4PA3A 4GLXA 1EZJA 5CB4B 1UJWB 3TJTA 3SDLA 2HG5C 1N4CA 4I4TB 1TA8A 4XDLA 3JASB 1VP7A 2QA4V 3WB2A 1N36B 4L8JA 3OUFA 4LR3A 4MVOA 2VQFO 4DR2B 1SETA 2ADPA 2UXDB 2ZIMA 2JRIA 4C7UA 1F4MA 5CA3A 4UCUA 1RSOB 4PA6A 2DYRC 4X66O 1IXBA 3MAQA 1FJGB 5EC2C 2Y0PA 1NQTA 2AZ2A 2ZD9A 4BAYA 4DV4B 2KB1A 1VQLV 2ZNJA 4GKJB 4EFBA 1Q3EA 1YIJV 1I08A 4HNAA 2IU0A 2LW7A 3VBBA 2PTMA 2F66C 2ZE7A 3HKBA 4W4KA 3MD0A 1Q7YW 1O9HA 3JATB 3FB5C 4MT8A 1PPJH 4JF3A 2BOCC 3ZS8C 4DR5B 4QPKA 1Y76A 2W0FC 2Q0OC 3ABKB 2YI8A 2QKSA 5B1AC 3RVYA 1AR1B 3CS5A 4JPRA 3RYIA 4ZOLA 4YHHO 2W6IG 3I56V 4TQFA 3RFRA 3D36C 3H1LH 1YI2V 1MG1A 1YZBA 3CCMV 1D5NA 1SZXA 2AHYA 4CH4A 4UCSA 4CS3A 3WU2Z 4DV5B 1JNBA 2M7WA 1BHBA 3K5NA 4MVUA 2BTQA 4QJFB 2N05A 3A0HZ 4RUEA 1Q43A 5LA6A 2CUGA 1M1KW 1L8DA 5CA1A 3QO5A 3K5MA 1NT2B 3JD0A 3L70H 1FFTB 2EX3A 1TUBA 4JTCB 4X1IA 4H44B 1SQPH 1FXHA 1YVWA 1NH2B 4MTFA 5D5QA 4RUFA 1JOYA 2DYSB 4LF6O 2Z5UA 4G27B 2BCCH 4I50A 2A7WA 1L0LH 1BCCH 4EFEA 2QE7G 3K04A 1URFA 4JI3O 3ABMB 1JFFA 4AILC 2P4VA 5EYPB 1LUWA 2CDYA 5B1NA 3B4SA 3B8NA 5JH7A 1S72V 2JDIG 2BTQB 5DN6G 1QBZA 1ORQC 3RWRD 2PZSA 5CBHA 3LUTB 1KBHA 3A8TA 4QNHB 4LCUC 3G4SV 2ZQMA 4WFHA 2OWOA 3AG4B 2YXYA 1W59A 3B8MA 3AG3C 3ABLB 3E8HA 4H0LB 2CK3G 1SESA 3U0ZA 1AVMA 1K7DA 1KQSU 3PJSK 2DW4A 1DF4A 2UUCB 1WN7A 3BY6A 4DYLA 1IBMO 1HNXB 2JVDA 5KUKA 1BSMA 3ZMVA 1R3LC 4JI7B 5EK0A 4JZ2A 5IYZA 1ZUQA 1VQPV 4FPPA 4Z2WA 4ZI7A 1M57C 3SPHA 4YJ3B 4HYOA 2P7TC 2DQ3A 4HNAB 2RJZA 1HR0O 1G6UA 1RM1C 1R3JC 5JCOA 1IXMA 2F93B 4J41A 3SPGA 1BL8A 1R3IC 2IJHA 5L3DA 4NTYA 4K8ZA 3T1HO 5C8YA 1BS3A 4IHJA 3UT5B 2X6BA 4ZBMA 1DK1A 4JI5B 4NXNO 1IDSA 2ARHA 5FPOA 3UO2A 4GYCB 2EZPA 3OMIB 2D3OW 1Q6IA 3ASNC 4DR4O 1XMOB 1H38A 4IYHA 1G4YB 4DUYB 3CCLV 1Y66A 2GDSA 5H6QA 1RPOA 3CB2A 3SJQC 1THZA 3VQYA 1LR1A 4J11A 2RN9A 1MOFA 5IYZB 3VQWA 1AI4A 2X7RB 4JAAA 2UU9O 2E74B 4DV2O 5B1BC 2L35A 3N27A 3ABKC 3SGIA 3CC2V 4K8XA 3ZJZA 4DXWA 1U97A 2ATKC 2QTSA 1V54C 1XNQO 1KKDA 3JSNA 1XQ8A 1R6TA 1QCEA 1K34A 4B3RO 1JPXA 1JMKC 1I5XA 3HKEB 3D3IA 1BQ0A 1WB8A 2CAZC 3ZIAG 2ZDIA 5J2UA 1EN6A 1HNWB 1OV9A 4LF6B 1MABG 4DV4O 4RAIA 4PD4F 3OFNG 3UQ8A 5JJEB 5D5PA 3JCUZ 1B6QA 3HKCB 4O2BA 1JFFB 4DR1O 2OCCC 5AG2A 4R50A 4WFFA 2VWKA 1N36O 2F1MA 2P22C 5HFMA 4TV8A 5LGNA 3L73H 2YIAA 3N2GA 4LF4O 1VQOV 2LFRA 5CBGA 5IJ0A 1JA8A 4DR6O 2GHYA 4X8AA 4JI1O 5GONB 2VQEB 4I55A 1YDXA 3K9AA 1WPXA 5CB4A 1BMFG 3WG7C 2Q69A 2X0LA 2E75B 3CCVV 3J7AU 1IBLO 4U3JB 4RWUA 5IJ9A 5ITZA 4UVCA 2CGOA 4P2ZA 4B3MB 5IYBO 1CPYA 5LYJB 5IWAO 4LFBO 3DC6A 3RYIB 2F95B 2QM7A 1I7FA 2FTKA 1SQGA 4MVSA 1H2MA 4O2AB 1IBMB 1BT8A 2Y4TA 1GKFA 4P30A 3THOA 1K73W 1AROP 4OGQB 1WA8A 4DV7O 1VARA 1WA8B 3AG2C 4L87A 4B3SO 4FLYA 4FIPC 1EN5A 3WG7B 1YCIA 3HR0A 3K9SA 3CD6V 1SKVA 2XASA 3U10A 2Q5ZA 1QLEC 3MHHC 3B09A 3VQVA 5B5EZ 1HNZB 5J9PC 3APQA 1M57B 2ITCC 4GX0A 2UXCB 4JV5B 4DUZO 3FYIB 4JAUA 1YF2A 5E1AC 3OEHG 5GTIZ 4JI4O 1NR1A 2Q8VA 3M8AA 1XNQB 3BA9A 3JARB 1QQCA 1KECA 2MW2B 2V1DA 2PYLA 5LMNB 1P49A 3ETQA 1S3JA 2H3OA 2YS8A 3CC7V 1X59A 1XILA 1YTFB 4Q6GA 1KP2A 4BIOA 2ZM6O 3AG4C 2UU9B 3J81N 2JGDB 5DM6V 1YHQV 4FLVA 5CA1B 1VQ6V 1TVKA 2Z3YA 1NZ6A 1RFYA 3OAAG 2YIBD 1GN6A 1QU7A 4AI8A 4WF9V 3KCXA 4O4LB 3QNEA 2AGAA 5LGUA 1GN4A 1YSCA 5KA6A 1O9GA 4UFZA 2R72A 1GO3F 3E86A 2WLNA 1EM1A 4NB5A 1IVSA 4K0KO 4LF9O 4JASA 5LGTA 1K5QA 2ITDC 2Q9LA 3SYAA 4J7JA 1KUQA 3RYHA 2EIKB 4FM2A 5LHIA 5JVDB 3CRQA 4ZI7B 1S5HC 2GTSA 3CC4V 1VMGA 2EBOA 1N0NA 4YHHB 2R9RB 1FS0G 1KMIZ 2BE3A 2B1IA 3LDDA 1YEWA 3JD2A 4IT5A 2Y4UA 3FB7C 4DR7O 1N8RW 3OMNB 1R6NA 5BR8O 1L0NH 3ZMTA 4NKGB 2XAQA 2H94A 1S5LZ 1SQQH 2A79B 2L6LA 1KC8W 2P6JA 1V55B 1U96A 2A0LA 1GAXA 3GVMA 2IJJA 1VF6C 2ZXWB 1M93A 5B1AB 1K4CC 5CN0A 3W7SA 1ROPA 3OE7G 4NYKA 3DXRA 4KFMA 1WLEA 3H1HH 4TWKA 3K5LA 4IGGA 3ZMSA 1XBLA 2PGGA 2Y0IA 4MW3A 1M9NA 4P9OA 3K06A 3KZIZ 4PA9A 4LFAB 1FXKB 2NN4A 5L3BA 4O4IB 2VS0A 3RVZA 5KX5B 4GKJO 2YEVA 3NXSA 4CH5A 1JVMA 4BIUA 1JJOA 4DUYO 1BHAA 1M5IA 5LP6B 2R9AA 1FFXB 4H33A 4CC6A 4D7SA 2HHHO 3CXCU 2DJVA 4FZ1A 2HVKC 3H1IH 4X1IB 3JATA 1AJQA 3ZBHA 4LWSA 2QWOB 1PP9H 1COWG 1GN2A 2KG7B 3T1CA 4JYAB 3ETGA 1XHXA 1WP8A 4W4LA 1XHZA 4EB6B 3IFXA 4PDLA 3ASOB 4N21A 1BE3H 1NVPB 3CRMA 2UXBO 1VF7A 3E2EA 2K9PA 2ZM6B 2WLJA 2CGNA 5LBQA 2IU3A 2K1EA 2EIJC 5KHJA 4JI1B 2A06H 3BEHA 3S3WA 2QEXV 4PV1B 4WCEV 3ABTA 5EC1C 5DEDA 3AG2B 1H2LA 1KU9A 1MZEA 1F4NA 1R1BA 3ICXA 3JALA 4FVMA 1N34O 3HKEA 3SR2C 1IBKB 5HFLA 1TGOA 1WP7A 4ZKIA 1VF6A 3ZHTA 5LP6A 4R7CA 2JS5A 5GW7A 2OIEA 3L72H 3P30A 1VEWA 5K1XA 4CBCA 1OZ0A 3BPZA 1QR8A 1FXKC 1FJGO 2V4DA 3F7VC 2UXDO 2YUAA 4F4LA 5IDJA 5CMUA 5H2FZ 2NR5A 3OD4A 3ABUA 3T4DA 2JJ1G 2H8PC 2AXTZ 4H37A 4LC1A 3CJHA 3QTCA 4UB6Z 4LF5O 1GM9A 4K35A 2Q67A 4O4LA 2HP8A 1V9PA 4DO2A 3HKDB 4DV1B 3UCSC 2E5LB 4UCOA 2LO1A 4ZHQA 1K4DC 3S3XA 3CPWU 1Q5OA 5JQGA 1H2KA 3TCUA 1E1RG 5GTHZ 2PUSA 1M4UA 4DV0B 3JARA 2Q4PA 4X20A 4DV7B 5EIBC 4DRXA 2F23A 1LNQA 2XAFA 5EYPA 2BTOA 5LMUB 1WNSA 5IY5C 3ML0A 4U3FH 4TUYA 2XOKG 2WPDG 3LNNA 4ZHQB 1XNRB 4CH6A 2YIDA 5JJNB 4QE9A 3BVOA 2YC0A 3IJ4A 1HNWO 2HEPA 1EN4A 1G8MA 5B3SC 3CMAV 1AP6A 3X2QC 4MTOA 2ZINA 1CEZA 4PELA 2IH3C 3RYCB 4HZ3A 3ZCCA 3ZRVA 4DR5O 1JJ2U 4E2LA 2JEUA 3O9OA 4XDJA 3EHBB 3LDCA 3H9VA 4PHZA 1VQ8V 1KYOF 3L71H 3RYFB 1ENVA 1K97A 2DMXA 1VQ4V 1XREA 4MW8A 4I0XA 4FLZA 4N23A 1OCZB 1P84F 3MHSC 2JIZG 4YIPA 3A0BZ 3C3SA 1DTOA 4UXNA 3N2GB 1MZFA 4DR4B 1GM7A 4UCVA 1WPBA 4AHCA 2WA3A 1J5EB 5KHHA 4G28B 5IE9A 1Y74A 1NU1H 1OCCB 5LMNO 4MS2A 4FZ0A 4GUNA 4JTDB 4DV3B 1SA0A 4B3MO 5CA0A 4QPJA 2EZOA 4DR3B 5BMVA 3ABLC 1HNZO 3OW2U 1JCHA 1W0JG 1FD9A 4FM0A 1N0JA 4AQYO 5KA5A 1E1QG 2HFEC 3K58A 3CRCA 1WAZA 4UV9A 5EIBD 3CJHB 2XAGA 4LF7B 4BR6A 1XMOO 1CXZB 2IH1C 3E83A 3W7UA 3CEIA 1CP9A 1K3EA 2X6AA 3HKDA 3FAVB 4U7NA 4LH6A 1ZL8A 1M56C 2VRZA 2XTAA 4X62O 4J9YB 4DV5O 3BCCH 1Y74B 2B1GA 2R70A 3OUSA 1OHHG 5GONA 3ZRWB 1KB9F 4FFBA 4IYIA 3X2QB 1YITV 2YI9A 4X9QA 4MVRA 4X20B 1ZAUA 3JAWA 1Q90D 3CE2A 3RYFA 1FOUA 2DYSC 2JGUA 3F5WC 4JI2B 4K3AA 1OCRC 1YJNV 3DXRB 5KAFZ 2HVJC 1GH6A 2QWPB 1Y6XA 4PDMA 4B3TO 4NTWA 4BW9A 2WSSG 1XNRO 3QO8A 3VQXA 5C8YB 1S5JA 5BXZA 5IY5B 4YJ3A 4JI0O 4WBNB 5LOVA 1LUVA 2OCCB 1XMQO 4DR1B 1K8AW 1K5SA 1XDCA 4DV6O 1I94O 3LSUA 3PN1A 4CC5A 3FAVA 2CTWA 2DN9A 4DK1A 3K08A 5E79Z 2CH7A 4CS4A 2LGWA 3K0GA 3D8CA 1YTFD 4DV6B 3U11A 4FMTA 3SJCC 2LQTA 1DF5A 1Y4MA 5BR8B 2VQFB 4UVAA 3SPIA 1H5WA 2ZE8A 3JD3A 4B7EA 2UUBO 3L9DA 1S76D 2GV9A 3EFFK 2WA4A 3F5TA 1R3KC 2HJDA 4FK5C 3ZN1A 5L3CA 2WLLB 1W2BU 1PKXA 2QWRB 4TQDA 3CCJV 1RM1B 1G1XB 4XBFA 1W0KG 3WB1A 3M7MX 1NTMH 3UO3A 2QM4A 1TUBB 1D5AA 4J7KA 2EILB 2XNDG 4J10A 3FYEB 2IJKA 3OR6C 2X6CA 4FJCC 2YSUB 4JYBA 1K33A 5IT9N 2QKCA 5B1OA 4JI8O 3JASA 5EZYA 1HNXO 4I5SA 1TAEA 2PF4E 3P3PA 4I4TA 2P4KA 3G67A 3TETA 2YIBA 3LSSA 1P4RA 3OTOB 2Q7GA 5JCOC 5J2TB 2P06A 3T1HB 1X4TA 3CP1A 1OCRB 2Z0AA 3LDEA 2QDOA 3IC7A 1HR0B 3B77A 2DOSA 1S77D 2WLHA 1NKDA 2QJ1A 3OTFA 1FYJA 1XL6A 2D2CB 4OPHA 5KHKA 3CX5F 2UXXA 1XMQB 1BQZA 4X65B 4O4IA 3OGIB 3FB8C 5JWPA 1PL4A 4LP8A 4DR3O 1ZL8B 3G71V 3C90A 3EXAA 2Q7HA 2EIMC 2UUBB 4PDVA 2EIMB 1EFRG 2W0XA 2BOBC 4FFBB 3ABMC 2UXCO 4JI4B 2JJ2G 4J42A 4CS2A 1P7GA 2QSAA 4ZOLB 1H2GA 1H8EG 5KHIA 2YXLA 1KKCA 1ZSPA 1ZLZA 1JX9A 1YJ9V 2PI4A 3NR7A 4CZZA 3ASOC 5BMVB 3OEEG 1I94B 3I5DA 3P32A 3EVKA 2CE4A 1HDJA 5JH7B 3DC5A 3D36A 2Y69B 1H2SB 2ILMA 3BRCA 2XHBA 3RN4A 4JI8B 1M90W 2KQXA 1L1FA 4LFBB 4HBNA 4KL1A 1Y67A 4ABMA 2XT9A 2EILC 4QGPA 3JD1A 1N33B 2RCVA 4H13B 4GX5A 4U3JA 2GSMB 2UXBB 3JAKA 1RPRA 4OXSA 3ZX6A 3N2KA 4GX2A 4X1KA 2OTJV 2UXNA 4OPAA 2FKXA 2Y48A 4DV3O 3SYOA 2YICA 4YJ2B 3RGBA 3TGUH 1EZVH 1VF5B 4LF4B 4LF8B 3ETDA 3QF7A 4U7OA 3ZHVA 2N04A 4D6TH 5LL6Y 2YDEA 3AG7A 2ZXWC 4J7ZA 2AZ0A 5A9GA 5KMGB 3BABA 1B3QA 2Q0AA 1AB3A 1HW7A 4NTXA 4B7KA 2PY5A 2HR3A 1RP3B 3H1JH 4I7ZB 2QWNB 3JALB 3C3TA 1PV0A 3MDSA 2XAJA 3AK3A 1V55C 3K5OA 4X66B 2QM8A 3M99B 3TXSA 3ZMUA 1KD1W 2A9HA 2F4VB 2VQEO 4R6ZA 2QWQB 4O4HA 4J80A 5K1PA 4O4HB 4LWSB 3AK2A 1FXVA 2F43G 3E8FA 1F7YA 3JYCA 4PA4A 3G6EV 1VQ5V 1B04A 1HWYA 4DRXB 4I50B 4BWAA 4QE7A 4NXMB 5KLVH 3VOUA 3ZHQA 4JI2O 5H9CA 4JZGA 3IGAC 1BZKA 4TT3G 1DLBA 2EIKC 3LSQA 5LHHA 4UCRA 3AG1C 3CSXA 5KAIZ 4IL6Z 2GUZB 3K0DA 1YJWV 1IZ3A 3E35A 4O4JB 4X89A 5KMGA 3CRAA 1Q6HA 1AILA 1PNLA 2LW1A 4PI2A 1KP3A 3KCYA 1AJNA 3FKSG 1V54B 1SRYA 3K3WA 3JD4A 3HB3B 2WLIA 4DUZB 2HJFC 3R66A 1SC5B 3TXQA 4PI0A 3N2KB 4DV1O 2E5LO 2P5OA 2Q6AA 3FD9A 1FPOA 1XI1A 2ADQB 4Z1MG 1VQMV 2YEVB 2DE0X 4UCTA 1M56B 1VIBA 3CCUV 3HPLC 3ZMZA 3ASNB 1MA1A 4TOIA 1OJHA 5FL7G 1PM9A 2IJIA 4F6EA 3E8GA 3OT7A 4G2KA 2C2AA 3E22A 5TISZ 2ZE5A 2HLDG 4FLWA 4PJ0Z 1UFIA 4DW0A 1AP5A 2WLMA 4JTAB 1MSDA 2ZIOA 4GT1A 2EJRA 3I55V 3FFQA 1TUEB 3LNMB 3RYHB 4NVPA 4PDRA 5LXTB 3B2EE 3UKMA 4GCZA 1I0HA 2KKWA 4DR2O 2BSKB 2LGQA 1R6KA 4UB8Z 5L3EA 1US6A 2AW9A 2W6JG 1JQ0A 4JI7O 2ZKOA 2DQ0A 4J9ZB 3G80A 2DWDC 1GRJA 3ZHUA 3UT5A 1NR7A 2QTOA 4JI3B 4WBNA 4R8CA 2OIGA 3ZHRA 2R9IA 4MSWC 1J5EO 4X64B 3AG1B 2DWEC 1SERA 3CCQV 3A0RA 4OX9O 2QR4A 4MVMA 1OCOC 5J2TA 3T1YO 1PNKA 3W7XA 3JAKB 3JAWB 3WB0A 3HKCA 1Q6UA 3OTOO 3G6BA 5IWAB 2CTRA 1TVKB 4TV8B 1NBMG 3KG2A 2B5UA 2M6YA 1H8HG 5IJ0B 3SPJA 4I9QA 1SF9A 1K9MW 1Y76B 1FKAO 4TUYB 2OCHA 1QLNA 1A32A 1N33O 4RQFA 1UPGA 1NI8A 4DR6B 3F7YC 4BIZA 3ETEA 1I5YA 1NVPD 4LNUB 4EKWA 1F51A 2E76B 5LYJA 1QVFU 1QHTA 3RW0A 4FM1A 2LP7A 5EBMC 4P9PA 2FL4A 4MTXA 2KG7A 1GMGA 2PI5A 2FMLA 4O2AA 5IYCO 3K57A 3T2MA 1PL0A 1D2DA 3SJBC 4TV9A 4F6RA 2CH7B 1GN3A 1AR4A 5C93A 2RNBA 3AEIA 1R73A 1WJZA 4X1YB 2A3QA 4ZIBA 4GZRB 3GB7C 2DYRB 5H6RA 1J95A 5EBLC 1K92A 1SQXH 4FFKA 4FLUA 4KHPB 3QG5A 2LFSA 4B3RB 3STZC 3BFRA 1NJIW 4YIOA 2OT5A 4JI0B 4WFAV 1Q86W 3KKYA 4O4JA 5BZBA 3OMAB 2HKOA 1Q82W 3Q4HA 2IW5A 4GX1A 3SJAC 3E8BA 3AG3B 2O57A 4YJ2A 1S0VA 3H01A 5EZYB 4YXWG 2UUAB 1H2NA 3CRRA 5ITZB 2WLIB 1AI6A 1NS1A 2QGNA 2YXHA 3DTUB 4MVQA 1ZWIC 2ETNA 4LF9B 1SZTA 1B06A 1QR9A 2RMKB 1SQVH 4LF8O 3STLC 1VQNV 1QNMA 2JGDA 4LH7A 4F6RB 4JI5O 3OGCC 4UUJC 4DW1A 3W7WA 2LJ2A 1IURA 4TSFG 2XUMA 3SPCA 1PD3A 1OCOB 2WLLA 2E3CA 3SYCA 1SS3A 2RDCA 2CTPA 3WFVA 4E4EA 3HKBB 1XOUA 3RBZA 1JR9A 3E22B 5KUMA 4X64O 4Q20A 2WLKA 4KP4A 4I9WA 3IC9A 3TK1A 1MNGA 2QKAA 3ZHSA 3GWOA 4QIWF 2PYJA 5FLXN 4JYAO 2ODMA 4EB6A 1MMMA 5LXTA 1NH2D 5EBWC 3K79A 4NR1A 3O65A 4JV5O 3T4ZA 4UV8A 3BA8A 4KHPO 5L3FA 2JK5C 5FNVB 3APOA 1OCCC 2UUCO 2KSDA 3UM7A 1Z2GA 1NTZH 4JI6O 3CMEV 3OM3B 3OR7C 1Z5VA 1N32O 5LA6B 2UUAO 1AI5A 4JI6B 4NXMO 3E89A 1ZX3A 1WB7A 2JS3A 4LF5B 4LFAO 3RYCA 4X88A 3KDRA 4A5UB 2ZNIA 2AHZA 2ZCEA 2WAMA 3ZRWA 2P90A 2OYQA 1GK9A 1E79G 5DECA 3QVNA 1GTOA 2EJ7A 3J80N 1Z5WA 2JEXA 4X65O 4X1YA 2Q7EA 5H5NA 2F4VO 4GKKB 3CYOA 2P67A 2RQ6A 4IIJA 4PA7A 1AI7A 1QVGU 2GUZA 1SQBH 1F23A 2Q73A 4EEQA 4DR7B 3RT3C 1VQ7V 5LMUO 5J2UB 3B40A 3K59A 4NXNB 1DGSA 2ZE6A 1XL4A 4JYYA 4LF7O 1SA0B 4UVBA 1Q8IA 2IBZH 4B08A 4DV0O 5FPRA 4YY3B 4RO2A 4KUMA 4BW5A 2EINC
chains in the Genus database with same CATH topology
1EN6A 2AW9A 4JZGA 1AR4A 3CEIA 1EN4A 1BSMA 3RN4A 1ZTEA 1IX9A 1AP6A 1D5NA 1SZXA 4JZ2A 1ZUQA 5AG2A 1Y67A 1XILA 4FFKA 2RCVA 2QKCA 4X9QA 3BFRA 1VEWA 4YIOA 2P4KA 3KKYA 1JA8A 1WB7A 1BS3A 1XREA 3KDRA 1GN6A 1IDSA 1AR5A 3TJTA 4YIPA 1GN4A 2ADQB 3C3SA 1B06A 1LUVA 3QVNA 5A9GA 1EM1A 1XDCA 2ADPA 1PL4A 4C7UA 2GDSA 1IXBA 1QNMA 3LSUA 3C3TA 3MDSA 1MA1A 3AK3A 3DC6A 4GUNA 1PM9A 4F6EA 3OT7A 1LUWA 1GN2A 2CDYA 1N0NA 1BT8A 1I08A 1P7GA 1AP5A 1VARA 1KKCA 3AK2A 1MSDA 1ZSPA 4E4EA 1EN5A 1ZLZA 1JR9A 3K9SA 1XUQA 1N0JA 3IC9A 4JYYA 1MNGA 2QKAA 3EVKA 2CE4A 1I0HA 3DC5A 3AK1A 1WB8A 1AVMA 1MMMA 4BR6A 1GN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EN6 A;  2AW9 A;  4JZG A;  1AR4 A;  3CEI A;  1EN4 A;  1BSM A;  3RN4 A;  1ZTE A;  1IX9 A;  1AP6 A;  1D5N A;  1SZX A;  4JZ2 A;  1ZUQ A;  5AG2 A;  1Y67 A;  1XIL A;  4FFK A;  2RCV A;  2QKC A;  4X9Q A;  3BFR A;  1VEW A;  4YIO A;  2P4K A;  3KKY A;  1JA8 A;  1WB7 A;  1BS3 A;  1XRE A;  1GN6 A;  1IDS A;  1AR5 A;  3TJT A;  4YIP A;  1GN4 A;  2ADQ B;  3C3S A;  1B06 A;  1LUV A;  3QVN A;  5A9G A;  1EM1 A;  1XDC A;  2ADP A;  1PL4 A;  4C7U A;  2GDS A;  1IXB A;  1QNM A;  3LSU A;  3C3T A;  3MDS A;  1MA1 A;  3AK3 A;  3DC6 A;  4GUN A;  1PM9 A;  4F6E A;  3OT7 A;  1LUW A;  1GN2 A;  2CDY A;  1N0N A;  1BT8 A;  1I08 A;  1P7G A;  1AP5 A;  1VAR A;  1KKC A;  3AK2 A;  1MSD A;  1ZSP A;  4E4E A;  1EN5 A;  1ZLZ A;  1JR9 A;  3K9S A;  1XUQ A;  1N0J A;  3IC9 A;  4JYY A;  1MNG A;  2QKA A;  3EVK A;  2CE4 A;  1I0H A;  3DC5 A;  3AK1 A;  1WB8 A;  1AVM A;  1MMM A;  4BR6 A;  1GN3 A; 
#chains in the Genus database with same CATH topology
 3SYQ A;  2EUL A;  5B1B B;  1GM8 A;  1NTK H;  2Q68 A;  2ZR3 A;  3CHX A;  3JSL A;  1RSO A;  1IX9 A;  1FXK A;  2NLJ C;  2EIN B;  4GKK O;  1PNM A;  1P7B A;  3DGE A;  4RQE A;  1IJG A;  2FB5 A;  3K03 A;  3CCS V;  4K0K B;  2N74 A;  4IIJ B;  4Z1V A;  5LOV B;  3L75 H;  3JCZ A;  1XEQ A;  1FFX A;  4X62 B;  5IJ9 B;  3FB6 C;  3T1Y B;  4MVZ A;  2GTA A;  2HHH B;  3GWK C;  4DV2 B;  2CTQ A;  4IHJ B;  2MK3 A;  1QLE B;  1T5E A;  4D7T A;  4OX9 B;  1MSW D;  4CH3 A;  4WFE A;  4X1K B;  1AR5 A;  3A2F A;  1N32 B;  3Q4H B;  3BAA A;  3W7T A;  4DK0 A;  4O2B B;  2ZDI C;  3CCE V;  4LBE C;  3CCR V;  3QO7 A;  3JAM N;  2BSK A;  5L3G A;  5FNV A;  3IAY A;  4XDK A;  3CXH F;  4FLX A;  4TV9 B;  1N34 B;  1IBK O;  4WFB V;  2ZT9 B;  4B3T B;  3P3N A;  3R65 A;  4WFG A;  3BHP A;  2IM9 A;  2GBO A;  2WWW A;  1Q81 W;  3D3Q A;  1IBL B;  5CBF A;  1SQF A;  4MTG A;  1AJP A;  3L74 H;  5JVD A;  1OCZ C;  4KXR A;  3ZN0 A;  2EIJ B;  1XUQ A;  2FYU H;  4B3S B;  5IYD O;  4LNU A;  1HP8 A;  4LFC B;  4FLT A;  3AK1 A;  5JJJ B;  5B66 Z;  3ZED A;  2ZR2 A;  3ZRS A;  4ASU G;  1BGY H;  4ICG A;  5JQG B;  5A2Q N;  3SYP A;  3H1K H;  1ZTE A;  5BY1 A;  2Y69 C;  4LFC O;  1FAF A;  1VQK V;  5CA0 B;  4I0X B;  4AQY B;  2NNU A;  5KHG A;  5LHG A;  3ZRX A;  5B3S B;  5LP6 C;  2OTL V;  2B9Z A;  4JYC A;  2VWJ A;  3FX7 A;  2XAH A;  3DSQ A;  3CWB H;  4HAM A;  4I55 B;  1EBO A;  5KX5 A;  4JAV A;  2G38 A;  2V7Q G;  1VQ9 V;  1YXB A;  4YY3 O;  5F2V O;  4JGS A;  4PA3 A;  4GLX A;  1EZJ A;  5CB4 B;  1UJW B;  3TJT A;  3SDL A;  2HG5 C;  1N4C A;  4I4T B;  1TA8 A;  4XDL A;  3JAS B;  1VP7 A;  2QA4 V;  3WB2 A;  1N36 B;  4L8J A;  3OUF A;  4LR3 A;  4MVO A;  2VQF O;  4DR2 B;  1SET A;  2ADP A;  2UXD B;  2ZIM A;  2JRI A;  4C7U A;  1F4M A;  5CA3 A;  4UCU A;  1RSO B;  4PA6 A;  2DYR C;  4X66 O;  1IXB A;  3MAQ A;  1FJG B;  5EC2 C;  2Y0P A;  1NQT A;  2AZ2 A;  2ZD9 A;  4BAY A;  4DV4 B;  2KB1 A;  1VQL V;  2ZNJ A;  4GKJ B;  4EFB A;  1Q3E A;  1YIJ V;  1I08 A;  4HNA A;  2IU0 A;  2LW7 A;  3VBB A;  2PTM A;  2F66 C;  2ZE7 A;  3HKB A;  4W4K A;  3MD0 A;  1Q7Y W;  1O9H A;  3JAT B;  3FB5 C;  4MT8 A;  1PPJ H;  4JF3 A;  2BOC C;  3ZS8 C;  4DR5 B;  4QPK A;  1Y76 A;  2W0F C;  2Q0O C;  3ABK B;  2YI8 A;  2QKS A;  5B1A C;  3RVY A;  1AR1 B;  3CS5 A;  4JPR A;  3RYI A;  4ZOL A;  4YHH O;  2W6I G;  3I56 V;  4TQF A;  3RFR A;  3D36 C;  3H1L H;  1YI2 V;  1MG1 A;  1YZB A;  3CCM V;  1D5N A;  1SZX A;  2AHY A;  4CH4 A;  4UCS A;  4CS3 A;  3WU2 Z;  4DV5 B;  1JNB A;  2M7W A;  1BHB A;  3K5N A;  4MVU A;  2BTQ A;  4QJF B;  2N05 A;  3A0H Z;  4RUE A;  1Q43 A;  5LA6 A;  2CUG A;  1M1K W;  1L8D A;  5CA1 A;  3QO5 A;  3K5M A;  1NT2 B;  3JD0 A;  3L70 H;  1FFT B;  2EX3 A;  1TUB A;  4JTC B;  4X1I A;  4H44 B;  1SQP H;  1FXH A;  1YVW A;  1NH2 B;  4MTF A;  5D5Q A;  4RUF A;  1JOY A;  2DYS B;  4LF6 O;  2Z5U A;  4G27 B;  2BCC H;  4I50 A;  2A7W A;  1L0L H;  1BCC H;  4EFE A;  2QE7 G;  3K04 A;  1URF A;  4JI3 O;  3ABM B;  1JFF A;  4AIL C;  2P4V A;  5EYP B;  1LUW A;  2CDY A;  5B1N A;  3B4S A;  3B8N A;  5JH7 A;  1S72 V;  2JDI G;  2BTQ B;  5DN6 G;  1QBZ A;  1ORQ C;  3RWR D;  2PZS A;  5CBH A;  3LUT B;  1KBH A;  3A8T A;  4QNH B;  4LCU C;  3G4S V;  2ZQM A;  4WFH A;  2OWO A;  3AG4 B;  2YXY A;  1W59 A;  3B8M A;  3AG3 C;  3ABL B;  3E8H A;  4H0L B;  2CK3 G;  1SES A;  3U0Z A;  1AVM A;  1K7D A;  1KQS U;  3PJS K;  2DW4 A;  1DF4 A;  2UUC B;  1WN7 A;  3BY6 A;  4DYL A;  1IBM O;  1HNX B;  2JVD A;  5KUK A;  1BSM A;  3ZMV A;  1R3L C;  4JI7 B;  5EK0 A;  4JZ2 A;  5IYZ A;  1ZUQ A;  1VQP V;  4FPP A;  4Z2W A;  4ZI7 A;  1M57 C;  3SPH A;  4YJ3 B;  4HYO A;  2P7T C;  2DQ3 A;  4HNA B;  2RJZ A;  1HR0 O;  1G6U A;  1RM1 C;  1R3J C;  5JCO A;  1IXM A;  2F93 B;  4J41 A;  3SPG A;  1BL8 A;  1R3I C;  2IJH A;  5L3D A;  4NTY A;  4K8Z A;  3T1H O;  5C8Y A;  1BS3 A;  4IHJ A;  3UT5 B;  2X6B A;  4ZBM A;  1DK1 A;  4JI5 B;  4NXN O;  1IDS A;  2ARH A;  5FPO A;  3UO2 A;  4GYC B;  2EZP A;  3OMI B;  2D3O W;  1Q6I A;  3ASN C;  4DR4 O;  1XMO B;  1H38 A;  4IYH A;  1G4Y B;  4DUY B;  3CCL V;  1Y66 A;  2GDS A;  5H6Q A;  1RPO A;  3CB2 A;  3SJQ C;  1THZ A;  3VQY A;  1LR1 A;  4J11 A;  2RN9 A;  1MOF A;  5IYZ B;  3VQW A;  1AI4 A;  2X7R B;  4JAA A;  2UU9 O;  2E74 B;  4DV2 O;  5B1B C;  2L35 A;  3N27 A;  3ABK C;  3SGI A;  3CC2 V;  4K8X A;  3ZJZ A;  4DXW A;  1U97 A;  2ATK C;  2QTS A;  1V54 C;  1XNQ O;  1KKD A;  3JSN A;  1XQ8 A;  1R6T A;  1QCE A;  1K34 A;  4B3R O;  1JPX A;  1JMK C;  1I5X A;  3HKE B;  3D3I A;  1BQ0 A;  1WB8 A;  2CAZ C;  3ZIA G;  2ZDI A;  5J2U A;  1EN6 A;  1HNW B;  1OV9 A;  4LF6 B;  1MAB G;  4DV4 O;  4RAI A;  4PD4 F;  3OFN G;  3UQ8 A;  5JJE B;  5D5P A;  3JCU Z;  1B6Q A;  3HKC B;  4O2B A;  1JFF B;  4DR1 O;  2OCC C;  5AG2 A;  4R50 A;  4WFF A;  2VWK A;  1N36 O;  2F1M A;  2P22 C;  5HFM A;  4TV8 A;  5LGN A;  3L73 H;  2YIA A;  3N2G A;  4LF4 O;  1VQO V;  2LFR A;  5CBG A;  5IJ0 A;  1JA8 A;  4DR6 O;  2GHY A;  4X8A A;  4JI1 O;  5GON B;  2VQE B;  4I55 A;  1YDX A;  3K9A A;  1WPX A;  5CB4 A;  1BMF G;  3WG7 C;  2Q69 A;  2X0L A;  2E75 B;  3CCV V;  3J7A U;  1IBL O;  4U3J B;  4RWU A;  5IJ9 A;  5ITZ A;  4UVC A;  2CGO A;  4P2Z A;  4B3M B;  5IYB O;  1CPY A;  5LYJ B;  5IWA O;  4LFB O;  3DC6 A;  3RYI B;  2F95 B;  2QM7 A;  1I7F A;  2FTK A;  1SQG A;  4MVS A;  1H2M A;  4O2A B;  1IBM B;  1BT8 A;  2Y4T A;  1GKF A;  4P30 A;  3THO A;  1K73 W;  1ARO P;  4OGQ B;  1WA8 A;  4DV7 O;  1VAR A;  1WA8 B;  3AG2 C;  4L87 A;  4B3S O;  4FLY A;  4FIP C;  1EN5 A;  3WG7 B;  1YCI A;  3HR0 A;  3K9S A;  3CD6 V;  1SKV A;  2XAS A;  3U10 A;  2Q5Z A;  1QLE C;  3MHH C;  3B09 A;  3VQV A;  5B5E Z;  1HNZ B;  5J9P C;  3APQ A;  1M57 B;  2ITC C;  4GX0 A;  2UXC B;  4JV5 B;  4DUZ O;  3FYI B;  4JAU A;  1YF2 A;  5E1A C;  3OEH G;  5GTI Z;  4JI4 O;  1NR1 A;  2Q8V A;  3M8A A;  1XNQ B;  3BA9 A;  3JAR B;  1QQC A;  1KEC A;  2MW2 B;  2V1D A;  2PYL A;  5LMN B;  1P49 A;  3ETQ A;  1S3J A;  2H3O A;  2YS8 A;  3CC7 V;  1X59 A;  1XIL A;  1YTF B;  4Q6G A;  1KP2 A;  4BIO A;  2ZM6 O;  3AG4 C;  2UU9 B;  3J81 N;  2JGD B;  5DM6 V;  1YHQ V;  4FLV A;  5CA1 B;  1VQ6 V;  1TVK A;  2Z3Y A;  1NZ6 A;  1RFY A;  3OAA G;  2YIB D;  1GN6 A;  1QU7 A;  4AI8 A;  4WF9 V;  3KCX A;  4O4L B;  3QNE A;  2AGA A;  5LGU A;  1GN4 A;  1YSC A;  5KA6 A;  1O9G A;  4UFZ A;  2R72 A;  1GO3 F;  3E86 A;  2WLN A;  1EM1 A;  4NB5 A;  1IVS A;  4K0K O;  4LF9 O;  4JAS A;  5LGT A;  1K5Q A;  2ITD C;  2Q9L A;  3SYA A;  4J7J A;  1KUQ A;  3RYH A;  2EIK B;  4FM2 A;  5LHI A;  5JVD B;  3CRQ A;  4ZI7 B;  1S5H C;  2GTS A;  3CC4 V;  1VMG A;  2EBO A;  1N0N A;  4YHH B;  2R9R B;  1FS0 G;  1KMI Z;  2BE3 A;  2B1I A;  3LDD A;  1YEW A;  3JD2 A;  4IT5 A;  2Y4U A;  3FB7 C;  4DR7 O;  1N8R W;  3OMN B;  1R6N A;  5BR8 O;  1L0N H;  3ZMT A;  4NKG B;  2XAQ A;  2H94 A;  1S5L Z;  1SQQ H;  2A79 B;  2L6L A;  1KC8 W;  2P6J A;  1V55 B;  1U96 A;  2A0L A;  1GAX A;  3GVM A;  2IJJ A;  1VF6 C;  2ZXW B;  1M93 A;  5B1A B;  1K4C C;  5CN0 A;  3W7S A;  1ROP A;  3OE7 G;  4NYK A;  3DXR A;  4KFM A;  1WLE A;  3H1H H;  4TWK A;  3K5L A;  4IGG A;  3ZMS A;  1XBL A;  2PGG A;  2Y0I A;  4MW3 A;  1M9N A;  4P9O A;  3K06 A;  3KZI Z;  4PA9 A;  4LFA B;  1FXK B;  2NN4 A;  5L3B A;  4O4I B;  2VS0 A;  3RVZ A;  5KX5 B;  4GKJ O;  2YEV A;  3NXS A;  4CH5 A;  1JVM A;  4BIU A;  1JJO A;  4DUY O;  1BHA A;  1M5I A;  5LP6 B;  2R9A A;  1FFX B;  4H33 A;  4CC6 A;  4D7S A;  2HHH O;  3CXC U;  2DJV A;  4FZ1 A;  2HVK C;  3H1I H;  4X1I B;  3JAT A;  1AJQ A;  3ZBH A;  4LWS A;  2QWO B;  1PP9 H;  1COW G;  1GN2 A;  2KG7 B;  3T1C A;  4JYA B;  3ETG A;  1XHX A;  1WP8 A;  4W4L A;  1XHZ A;  4EB6 B;  3IFX A;  4PDL A;  3ASO B;  4N21 A;  1BE3 H;  1NVP B;  3CRM A;  2UXB O;  1VF7 A;  3E2E A;  2K9P A;  2ZM6 B;  2WLJ A;  2CGN A;  5LBQ A;  2IU3 A;  2K1E A;  2EIJ C;  5KHJ A;  4JI1 B;  2A06 H;  3BEH A;  3S3W A;  2QEX V;  4PV1 B;  4WCE V;  3ABT A;  5EC1 C;  5DED A;  3AG2 B;  1H2L A;  1KU9 A;  1MZE A;  1F4N A;  1R1B A;  3ICX A;  3JAL A;  4FVM A;  1N34 O;  3HKE A;  3SR2 C;  1IBK B;  5HFL A;  1TGO A;  1WP7 A;  4ZKI A;  1VF6 A;  3ZHT A;  5LP6 A;  4R7C A;  2JS5 A;  5GW7 A;  2OIE A;  3L72 H;  3P30 A;  1VEW A;  5K1X A;  4CBC A;  1OZ0 A;  3BPZ A;  1QR8 A;  1FXK C;  1FJG O;  2V4D A;  3F7V C;  2UXD O;  2YUA A;  4F4L A;  5IDJ A;  5CMU A;  5H2F Z;  2NR5 A;  3OD4 A;  3ABU A;  3T4D A;  2JJ1 G;  2H8P C;  2AXT Z;  4H37 A;  4LC1 A;  3CJH A;  3QTC A;  4UB6 Z;  4LF5 O;  1GM9 A;  4K35 A;  2Q67 A;  4O4L A;  2HP8 A;  1V9P A;  4DO2 A;  3HKD B;  4DV1 B;  3UCS C;  2E5L B;  4UCO A;  2LO1 A;  4ZHQ A;  1K4D C;  3S3X A;  3CPW U;  1Q5O A;  5JQG A;  1H2K A;  3TCU A;  1E1R G;  5GTH Z;  2PUS A;  1M4U A;  4DV0 B;  3JAR A;  2Q4P A;  4X20 A;  4DV7 B;  5EIB C;  4DRX A;  2F23 A;  1LNQ A;  2XAF A;  5EYP A;  2BTO A;  5LMU B;  1WNS A;  5IY5 C;  3ML0 A;  4U3F H;  4TUY A;  2XOK G;  2WPD G;  3LNN A;  4ZHQ B;  1XNR B;  4CH6 A;  2YID A;  5JJN B;  4QE9 A;  3BVO A;  2YC0 A;  3IJ4 A;  1HNW O;  2HEP A;  1EN4 A;  1G8M A;  5B3S C;  3CMA V;  1AP6 A;  3X2Q C;  4MTO A;  2ZIN A;  1CEZ A;  4PEL A;  2IH3 C;  3RYC B;  4HZ3 A;  3ZCC A;  3ZRV A;  4DR5 O;  1JJ2 U;  4E2L A;  2JEU A;  3O9O A;  4XDJ A;  3EHB B;  3LDC A;  3H9V A;  4PHZ A;  1VQ8 V;  1KYO F;  3L71 H;  3RYF B;  1ENV A;  1K97 A;  2DMX A;  1VQ4 V;  1XRE A;  4MW8 A;  4I0X A;  4FLZ A;  4N23 A;  1OCZ B;  1P84 F;  3MHS C;  2JIZ G;  4YIP A;  3A0B Z;  3C3S A;  1DTO A;  4UXN A;  3N2G B;  1MZF A;  4DR4 B;  1GM7 A;  4UCV A;  1WPB A;  4AHC A;  2WA3 A;  1J5E B;  5KHH A;  4G28 B;  5IE9 A;  1Y74 A;  1NU1 H;  1OCC B;  5LMN O;  4MS2 A;  4FZ0 A;  4GUN A;  4JTD B;  4DV3 B;  1SA0 A;  4B3M O;  5CA0 A;  4QPJ A;  2EZO A;  4DR3 B;  5BMV A;  3ABL C;  1HNZ O;  3OW2 U;  1JCH A;  1W0J G;  1FD9 A;  4FM0 A;  1N0J A;  4AQY O;  5KA5 A;  1E1Q G;  2HFE C;  3K58 A;  3CRC A;  1WAZ A;  4UV9 A;  5EIB D;  3CJH B;  2XAG A;  4LF7 B;  4BR6 A;  1XMO O;  1CXZ B;  2IH1 C;  3E83 A;  3W7U A;  3CEI A;  1CP9 A;  1K3E A;  2X6A A;  3HKD A;  3FAV B;  4U7N A;  4LH6 A;  1ZL8 A;  1M56 C;  2VRZ A;  2XTA A;  4X62 O;  4J9Y B;  4DV5 O;  3BCC H;  1Y74 B;  2B1G A;  2R70 A;  3OUS A;  1OHH G;  5GON A;  3ZRW B;  1KB9 F;  4FFB A;  4IYI A;  3X2Q B;  1YIT V;  2YI9 A;  4X9Q A;  4MVR A;  4X20 B;  1ZAU A;  3JAW A;  1Q90 D;  3CE2 A;  3RYF A;  1FOU A;  2DYS C;  2JGU A;  3F5W C;  4JI2 B;  4K3A A;  1OCR C;  1YJN V;  3DXR B;  5KAF Z;  2HVJ C;  1GH6 A;  2QWP B;  1Y6X A;  4PDM A;  4B3T O;  4NTW A;  4BW9 A;  2WSS G;  1XNR O;  3QO8 A;  3VQX A;  5C8Y B;  1S5J A;  5BXZ A;  5IY5 B;  4YJ3 A;  4JI0 O;  4WBN B;  5LOV A;  1LUV A;  2OCC B;  1XMQ O;  4DR1 B;  1K8A W;  1K5S A;  1XDC A;  4DV6 O;  1I94 O;  3LSU A;  3PN1 A;  4CC5 A;  3FAV A;  2CTW A;  2DN9 A;  4DK1 A;  3K08 A;  5E79 Z;  2CH7 A;  4CS4 A;  2LGW A;  3K0G A;  3D8C A;  1YTF D;  4DV6 B;  3U11 A;  4FMT A;  3SJC C;  2LQT A;  1DF5 A;  1Y4M A;  5BR8 B;  2VQF B;  4UVA A;  3SPI A;  1H5W A;  2ZE8 A;  3JD3 A;  4B7E A;  2UUB O;  3L9D A;  1S76 D;  2GV9 A;  3EFF K;  2WA4 A;  3F5T A;  1R3K C;  2HJD A;  4FK5 C;  3ZN1 A;  5L3C A;  2WLL B;  1W2B U;  1PKX A;  2QWR B;  4TQD A;  3CCJ V;  1RM1 B;  1G1X B;  4XBF A;  1W0K G;  3WB1 A;  3M7M X;  1NTM H;  3UO3 A;  2QM4 A;  1TUB B;  1D5A A;  4J7K A;  2EIL B;  2XND G;  4J10 A;  3FYE B;  2IJK A;  3OR6 C;  2X6C A;  4FJC C;  2YSU B;  4JYB A;  1K33 A;  5IT9 N;  2QKC A;  5B1O A;  4JI8 O;  3JAS A;  5EZY A;  1HNX O;  4I5S A;  1TAE A;  2PF4 E;  3P3P A;  4I4T A;  2P4K A;  3G67 A;  3TET A;  2YIB A;  3LSS A;  1P4R A;  3OTO B;  2Q7G A;  5JCO C;  5J2T B;  2P06 A;  3T1H B;  1X4T A;  3CP1 A;  1OCR B;  2Z0A A;  3LDE A;  2QDO A;  3IC7 A;  1HR0 B;  3B77 A;  2DOS A;  1S77 D;  2WLH A;  1NKD A;  2QJ1 A;  3OTF A;  1FYJ A;  1XL6 A;  2D2C B;  4OPH A;  5KHK A;  3CX5 F;  2UXX A;  1XMQ B;  1BQZ A;  4X65 B;  4O4I A;  3OGI B;  3FB8 C;  5JWP A;  1PL4 A;  4LP8 A;  4DR3 O;  1ZL8 B;  3G71 V;  3C90 A;  3EXA A;  2Q7H A;  2EIM C;  2UUB B;  4PDV A;  2EIM B;  1EFR G;  2W0X A;  2BOB C;  4FFB B;  3ABM C;  2UXC O;  4JI4 B;  2JJ2 G;  4J42 A;  4CS2 A;  1P7G A;  2QSA A;  4ZOL B;  1H2G A;  1H8E G;  5KHI A;  2YXL A;  1KKC A;  1ZSP A;  1ZLZ A;  1JX9 A;  1YJ9 V;  2PI4 A;  3NR7 A;  4CZZ A;  3ASO C;  5BMV B;  3OEE G;  1I94 B;  3I5D A;  3P32 A;  3EVK A;  2CE4 A;  1HDJ A;  5JH7 B;  3DC5 A;  3D36 A;  2Y69 B;  1H2S B;  2ILM A;  3BRC A;  2XHB A;  3RN4 A;  4JI8 B;  1M90 W;  2KQX A;  1L1F A;  4LFB B;  4HBN A;  4KL1 A;  1Y67 A;  4ABM A;  2XT9 A;  2EIL C;  4QGP A;  3JD1 A;  1N33 B;  2RCV A;  4H13 B;  4GX5 A;  4U3J A;  2GSM B;  2UXB B;  3JAK A;  1RPR A;  4OXS A;  3ZX6 A;  3N2K A;  4GX2 A;  4X1K A;  2OTJ V;  2UXN A;  4OPA A;  2FKX A;  2Y48 A;  4DV3 O;  3SYO A;  2YIC A;  4YJ2 B;  3RGB A;  3TGU H;  1EZV H;  1VF5 B;  4LF4 B;  4LF8 B;  3ETD A;  3QF7 A;  4U7O A;  3ZHV A;  2N04 A;  4D6T H;  5LL6 Y;  2YDE A;  3AG7 A;  2ZXW C;  4J7Z A;  2AZ0 A;  5A9G A;  5KMG B;  3BAB A;  1B3Q A;  2Q0A A;  1AB3 A;  1HW7 A;  4NTX A;  4B7K A;  2PY5 A;  2HR3 A;  1RP3 B;  3H1J H;  4I7Z B;  2QWN B;  3JAL B;  3C3T A;  1PV0 A;  3MDS A;  2XAJ A;  3AK3 A;  1V55 C;  3K5O A;  4X66 B;  2QM8 A;  3M99 B;  3TXS A;  3ZMU A;  1KD1 W;  2A9H A;  2F4V B;  2VQE O;  4R6Z A;  2QWQ B;  4O4H A;  4J80 A;  5K1P A;  4O4H B;  4LWS B;  3AK2 A;  1FXV A;  2F43 G;  3E8F A;  1F7Y A;  3JYC A;  4PA4 A;  3G6E V;  1VQ5 V;  1B04 A;  1HWY A;  4DRX B;  4I50 B;  4BWA A;  4QE7 A;  4NXM B;  5KLV H;  3VOU A;  3ZHQ A;  4JI2 O;  5H9C A;  4JZG A;  3IGA C;  1BZK A;  4TT3 G;  1DLB A;  2EIK C;  3LSQ A;  5LHH A;  4UCR A;  3AG1 C;  3CSX A;  5KAI Z;  4IL6 Z;  2GUZ B;  3K0D A;  1YJW V;  1IZ3 A;  3E35 A;  4O4J B;  4X89 A;  5KMG A;  3CRA A;  1Q6H A;  1AIL A;  1PNL A;  2LW1 A;  4PI2 A;  1KP3 A;  3KCY A;  1AJN A;  3FKS G;  1V54 B;  1SRY A;  3K3W A;  3JD4 A;  3HB3 B;  2WLI A;  4DUZ B;  2HJF C;  3R66 A;  1SC5 B;  3TXQ A;  4PI0 A;  3N2K B;  4DV1 O;  2E5L O;  2P5O A;  2Q6A A;  3FD9 A;  1FPO A;  1XI1 A;  2ADQ B;  4Z1M G;  1VQM V;  2YEV B;  2DE0 X;  4UCT A;  1M56 B;  1VIB A;  3CCU V;  3HPL C;  3ZMZ A;  3ASN B;  1MA1 A;  4TOI A;  1OJH A;  5FL7 G;  1PM9 A;  2IJI A;  4F6E A;  3E8G A;  3OT7 A;  4G2K A;  2C2A A;  3E22 A;  5TIS Z;  2ZE5 A;  2HLD G;  4FLW A;  4PJ0 Z;  1UFI A;  4DW0 A;  1AP5 A;  2WLM A;  4JTA B;  1MSD A;  2ZIO A;  4GT1 A;  2EJR A;  3I55 V;  3FFQ A;  1TUE B;  3LNM B;  3RYH B;  4NVP A;  4PDR A;  5LXT B;  3B2E E;  3UKM A;  4GCZ A;  1I0H A;  2KKW A;  4DR2 O;  2BSK B;  2LGQ A;  1R6K A;  4UB8 Z;  5L3E A;  1US6 A;  2AW9 A;  2W6J G;  1JQ0 A;  4JI7 O;  2ZKO A;  2DQ0 A;  4J9Z B;  3G80 A;  2DWD C;  1GRJ A;  3ZHU A;  3UT5 A;  1NR7 A;  2QTO A;  4JI3 B;  4WBN A;  4R8C A;  2OIG A;  3ZHR A;  2R9I A;  4MSW C;  1J5E O;  4X64 B;  3AG1 B;  2DWE C;  1SER A;  3CCQ V;  3A0R A;  4OX9 O;  2QR4 A;  4MVM A;  1OCO C;  5J2T A;  3T1Y O;  1PNK A;  3W7X A;  3JAK B;  3JAW B;  3WB0 A;  3HKC A;  1Q6U A;  3OTO O;  3G6B A;  5IWA B;  2CTR A;  1TVK B;  4TV8 B;  1NBM G;  3KG2 A;  2B5U A;  2M6Y A;  1H8H G;  5IJ0 B;  3SPJ A;  4I9Q A;  1SF9 A;  1K9M W;  1Y76 B;  1FKA O;  4TUY B;  2OCH A;  1QLN A;  1A32 A;  1N33 O;  4RQF A;  1UPG A;  1NI8 A;  4DR6 B;  3F7Y C;  4BIZ A;  3ETE A;  1I5Y A;  1NVP D;  4LNU B;  4EKW A;  1F51 A;  2E76 B;  5LYJ A;  1QVF U;  1QHT A;  3RW0 A;  4FM1 A;  2LP7 A;  5EBM C;  4P9P A;  2FL4 A;  4MTX A;  2KG7 A;  1GMG A;  2PI5 A;  2FML A;  4O2A A;  5IYC O;  3K57 A;  3T2M A;  1PL0 A;  1D2D A;  3SJB C;  4TV9 A;  4F6R A;  2CH7 B;  1GN3 A;  1AR4 A;  5C93 A;  2RNB A;  3AEI A;  1R73 A;  1WJZ A;  4X1Y B;  2A3Q A;  4ZIB A;  4GZR B;  3GB7 C;  2DYR B;  5H6R A;  1J95 A;  5EBL C;  1K92 A;  1SQX H;  4FFK A;  4FLU A;  4KHP B;  3QG5 A;  2LFS A;  4B3R B;  3STZ C;  3BFR A;  1NJI W;  4YIO A;  2OT5 A;  4JI0 B;  4WFA V;  1Q86 W;  3KKY A;  4O4J A;  5BZB A;  3OMA B;  2HKO A;  1Q82 W;  3Q4H A;  2IW5 A;  4GX1 A;  3SJA C;  3E8B A;  3AG3 B;  2O57 A;  4YJ2 A;  1S0V A;  3H01 A;  5EZY B;  4YXW G;  2UUA B;  1H2N A;  3CRR A;  5ITZ B;  2WLI B;  1AI6 A;  1NS1 A;  2QGN A;  2YXH A;  3DTU B;  4MVQ A;  1ZWI C;  2ETN A;  4LF9 B;  1SZT A;  1B06 A;  1QR9 A;  2RMK B;  1SQV H;  4LF8 O;  3STL C;  1VQN V;  1QNM A;  2JGD A;  4LH7 A;  4F6R B;  4JI5 O;  3OGC C;  4UUJ C;  4DW1 A;  3W7W A;  2LJ2 A;  1IUR A;  4TSF G;  2XUM A;  3SPC A;  1PD3 A;  1OCO B;  2WLL A;  2E3C A;  3SYC A;  1SS3 A;  2RDC A;  2CTP A;  3WFV A;  4E4E A;  3HKB B;  1XOU A;  3RBZ A;  1JR9 A;  3E22 B;  5KUM A;  4X64 O;  4Q20 A;  2WLK A;  4KP4 A;  4I9W A;  3IC9 A;  3TK1 A;  1MNG A;  2QKA A;  3ZHS A;  3GWO A;  4QIW F;  2PYJ A;  5FLX N;  4JYA O;  2ODM A;  4EB6 A;  1MMM A;  5LXT A;  1NH2 D;  5EBW C;  3K79 A;  4NR1 A;  3O65 A;  4JV5 O;  3T4Z A;  4UV8 A;  3BA8 A;  4KHP O;  5L3F A;  2JK5 C;  5FNV B;  3APO A;  1OCC C;  2UUC O;  2KSD A;  3UM7 A;  1Z2G A;  1NTZ H;  4JI6 O;  3CME V;  3OM3 B;  3OR7 C;  1Z5V A;  1N32 O;  5LA6 B;  2UUA O;  1AI5 A;  4JI6 B;  4NXM O;  3E89 A;  1ZX3 A;  1WB7 A;  2JS3 A;  4LF5 B;  4LFA O;  3RYC A;  4X88 A;  3KDR A;  4A5U B;  2ZNI A;  2AHZ A;  2ZCE A;  2WAM A;  3ZRW A;  2P90 A;  2OYQ A;  1GK9 A;  1E79 G;  5DEC A;  3QVN A;  1GTO A;  2EJ7 A;  3J80 N;  1Z5W A;  2JEX A;  4X65 O;  4X1Y A;  2Q7E A;  5H5N A;  2F4V O;  4GKK B;  3CYO A;  2P67 A;  2RQ6 A;  4IIJ A;  4PA7 A;  1AI7 A;  1QVG U;  2GUZ A;  1SQB H;  1F23 A;  2Q73 A;  4EEQ A;  4DR7 B;  3RT3 C;  1VQ7 V;  5LMU O;  5J2U B;  3B40 A;  3K59 A;  4NXN B;  1DGS A;  2ZE6 A;  1XL4 A;  4JYY A;  4LF7 O;  1SA0 B;  4UVB A;  1Q8I A;  2IBZ H;  4B08 A;  4DV0 O;  5FPR A;  4YY3 B;  4RO2 A;  4KUM A;  4BW5 A;  2EIN C; 
#chains in the Genus database with same CATH homology
 1EN6 A;  2AW9 A;  4JZG A;  1AR4 A;  3CEI A;  1EN4 A;  1BSM A;  3RN4 A;  1ZTE A;  1IX9 A;  1AP6 A;  1D5N A;  1SZX A;  4JZ2 A;  1ZUQ A;  5AG2 A;  1Y67 A;  1XIL A;  4FFK A;  2RCV A;  2QKC A;  4X9Q A;  3BFR A;  1VEW A;  4YIO A;  2P4K A;  3KKY A;  1JA8 A;  1WB7 A;  1BS3 A;  1XRE A;  3KDR A;  1GN6 A;  1IDS A;  1AR5 A;  3TJT A;  4YIP A;  1GN4 A;  2ADQ B;  3C3S A;  1B06 A;  1LUV A;  3QVN A;  5A9G A;  1EM1 A;  1XDC A;  2ADP A;  1PL4 A;  4C7U A;  2GDS A;  1IXB A;  1QNM A;  3LSU A;  3C3T A;  3MDS A;  1MA1 A;  3AK3 A;  3DC6 A;  4GUN A;  1PM9 A;  4F6E A;  3OT7 A;  1LUW A;  1GN2 A;  2CDY A;  1N0N A;  1BT8 A;  1I08 A;  1P7G A;  1AP5 A;  1VAR A;  1KKC A;  3AK2 A;  1MSD A;  1ZSP A;  4E4E A;  1EN5 A;  1ZLZ A;  1JR9 A;  3K9S A;  1XUQ A;  1N0J A;  3IC9 A;  4JYY A;  1MNG A;  2QKA A;  3EVK A;  2CE4 A;  1I0H A;  3DC5 A;  3AK1 A;  1WB8 A;  1AVM A;  1MMM A;  4BR6 A;  1GN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...