3OT7A

Escherichia coli apo-manganese superoxide dismutase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
b'SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Subunit dissociation and metal binding by Escherichia coli apo-manganese superoxide dismutase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 73
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ot7A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ot7A02
1QNMA 1LUWA 1BSMA 2AW9A 1Y67A 3RN4A 4BR6A 1P7GA 2QKCA 1VEWA 4JYYA 4YIPA 4YIOA 1LUVA 3IC9A 1PM9A 3QVNA 1BT8A 3DC6A 2QKAA 3AK2A 1EN4A 1XREA 1XILA 3CEIA 1SZXA 4GUNA 3DC5A 1B06A 3AK3A 1ZSPA 1XUQA 1JA8A 1GN3A 1GN4A 3C3TA 3OT7A 1N0NA 1AR4A 1GN2A 1GN6A 3TJTA 2CE4A 1I0HA 5A9GA 4X9QA 1IX9A 4F6EA 3BFRA 1IDSA 1MNGA 3LSUA 4C7UA 1BS3A 2ADPA 1IXBA 1XDCA 1ZLZA 4JZGA 1ZUQA 1PL4A 1MSDA 3K9SA 1AR5A 1D5NA 2CDYA 1AP5A 1KKCA 2ADQB 1WB7A 1AVMA 5AG2A 1WB8A 3EVKA 1EN5A 3KKYA 1EN6A 1JR9A 1EM1A 1N0JA 1ZTEA 1AP6A 1MMMA 4JZ2A 4FFKA 1VARA 3MDSA 2P4KA 3AK1A 2GDSA 2RCVA 1MA1A 3C3SA 1I08A 4E4EA
chains in the Genus database with same CATH superfamily
2ZXWB 4GYCB 1ZL8B 4HYOA 2O57A 5GW7A 5JCOC 2GSMB 3JD1A 1YITV 1IBLO 1VF6C 4FLUA 2ZIMA 1MG1A 2C2AA 4LF9O 3RYFB 2V7QG 4CH5A 4LF4O 4FLWA 3AG4C 1SZXA 3SPHA 4DXWA 4GUNA 4H33A 2PZSA 1G6UA 4P2ZA 1HNZB 2PI4A 3BHPA 2PI5A 3GB7C 5LA6B 2OCCB 1JFFA 4O4LA 5CBGA 1JA8A 4CZZA 3E8FA 1YXBA 5H2FZ 4DYLA 2YSUB 5J2TB 3E2EA 5IY5B 2Y69B 3RYIB 3L71H 3E83A 2EINB 2W6IG 1RP3B 2PY5A 3M99B 4U3FH 4DV0B 1K97A 5EIBC 1LNQA 3ABMB 3J7AU 1SQGA 1W0JG 3ZMVA 1ZLZA 4JZGA 2UXBB 1QQCA 3CXCU 2GV9A 1GO3F 3WB0A 4J7KA 4F6RA 4BAYA 1Z5WA 2D3OW 4DV4O 5B66Z 1AP5A 2N04A 3CC2V 1KKCA 4UCUA 1WB7A 3BRCA 4TOIA 1Q6UA 1N32B 4NTYA 5L3EA 5IE9A 1A32A 3OUSA 2B1IA 4PI2A 1NKDA 4LF5B 3OW2U 2WLJA 4FFBB 4JAAA 1JPXA 1W59A 2WLIA 5B1OA 4UFZA 3VQYA 3RW0A 5KMGB 1DGSA 2ATKC 3R65A 1HNXO 4PA4A 4CBCA 2AZ0A 4BIUA 2YXHA 2JEUA 2GTAA 5LYJB 2CUGA 1F51A 1Q5OA 3ZMUA 1S5LZ 5JQGA 1DF5A 1RM1C 2FL4A 4MVOA 4GKJB 4J9ZB 1XNRB 2H3OA 4PA6A 4ZOLB 5TISZ 3T4ZA 4LC1A 5KA5A 2LO1A 1M4UA 3HKDB 1E1QG 4X65B 4G2KA 2N05A 3F7VC 1HW7A 3KCYA 5EBLC 4X9QA 3JSNA 3BAAA 4NVPA 3SR2C 3OGIB 4MT8A 1MNGA 1NU1H 5HFMA 5IYCO 1XDCA 2PTMA 3CP1A 2GUZB 2EJ7A 1ZUQA 1PL4A 4GX5A 1FXHA 2Q69A 4UB6Z 4J42A 1VQLV 2AHYA 2F93B 2L6LA 3UT5B 2NLJC 2YEVA 5KHGA 2CDYA 1QLEB 2JGUA 3ASNB 1V55B 3CRAA 5IJ0B 1YTFD 2CH7A 3CMAV 1GK9A 1GAXA 2DYSB 2HHHO 4UCSA 1KD1W 5LHIA 3ABLB 3CX5F 3G6BA 3ZN1A 3EVKA 2CAZC 3STLC 1G8MA 1KB9F 2UU9O 2EULA 2Z3YA 1EM1A 2UXCB 1AB3A 1Z5VA 3RYFA 1Y4MA 3ASOB 1M93A 3FYIB 3A0HZ 4W4LA 4JI1B 1R1BA 1I08A 4DW1A 1GM9A 2P4VA 3K3WA 5EBWC 4JYBA 4JYYA 4EB6A 2QWRB 4MTFA 1M57B 5J2TA 3B09A 3E89A 3QVNA 2UXDB 1L0LH 4PA9A 3RYIA 3ZHSA 2A3QA 5IT9N 5LHHA 5LXTB 3D8CA 3DC5A 1ENVA 4XDLA 4FJCC 2ZINA 2WLKA 2UUCO 3ABTA 5IWAO 2ZD9A 1YTFB 3RFRA 3SYAA 5LMUB 4PDLA 1NBMG 2F95B 1P7BA 2H8PC 1N36B 2JS5A 2VQEB 3RT3C 4YJ3B 2QR4A 1ZAUA 4JTDB 2LFSA 3X2QC 1AROP 1K92A 4P9PA 3TETA 2AZ2A 1K8AW 2W0XA 3OE7G 3OTFA 2A79B 3K9SA 2UXXA 1AR5A 2EIMC 5LL6Y 1OCOB 5CA1B 1Q86W 2EJRA 5LMNB 4FFBA 4XDJA 4FM0A 3EHBB 5EIBD 1E1RG 4QE7A 4B3MO 4NXNO 4X20B 3W7WA 3SJCC 2ZQMA 1YZBA 1WB8A 4JI8B 1OCCC 2QM8A 1Q6HA 1ZTEA 3CXHF 3K0GA 2E76B 3W7TA 4J7JA 5LYJA 1VARA 1YJWV 4AHCA 1B3QA 1CXZB 4I55B 4LNUB 2EZOA 2IH1C 2N74A 3C3SA 5GTHZ 1X4TA 2HEPA 3BVOA 3K04A 2QWQB 1O9HA 1M1KW 2WAMA 4ZOLA 4QNHB 4DV6O 4U3JB 1AJPA 5H6RA 3AG4B 1GM8A 4QPKA 2XUMA 1R6TA 2JJ2G 3JATB 3NXSA 5LGTA 1H2GA 1Q8IA 1AR1B 2XTAA 4KUMA 2QDOA 5KAIZ 2EILB 1K5QA 2F43G 5K1PA 3CCLV 3GWOA 2ZDIC 1ZX3A 3W7XA 3AG2C 3LUTB 2EX3A 2LW7A 1SA0B 4DR5B 2A7WA 1KECA 2CTRA 2DQ0A 3D3QA 3N2KB 3GVMA 1HNWO 1GKFA 1Y66A 2H94A 2ITDC 3ABUA 4WFGA 4K8ZA 3CC7V 2LJ2A 1R3LC 2LW1A 3CWBH 3VQWA 5KHIA 4UB8Z 1S77D 4PJ0Z 2IW5A 4C7UA 2YDEA 2HVJC 4UVAA 1K73W 4JGSA 5IJ0A 3JCZA 3K58A 1YHQV 3KCXA 1XL4A 4IIJA 1H38A 2NR5A 2IJJA 3FB6C 1YI2V 3HKEA 1IVSA 3THOA 1F4NA 3O9OA 4DR3B 2P6JA 4YXWG 3OGCC 1H8EG 4JAVA 3A2FA 2QWNB 1S5JA 3ML0A 4CC5A 3ZRXA 5AG2A 3WFVA 4TUYB 2P22C 4JAUA 1WNSA 3VQVA 1EN5A 1OZ0A 2Q5ZA 2QA4V 3U0ZA 2VWJA 1I7FA 4EEQA 3EXAA 2JK5C 2CGNA 4L8JA 5EYPB 2PYLA 1AP6A 1TA8A 5JVDA 3SYPA 4G28B 3ETEA 3ABKC 1QHTA 2ZNJA 4LCUC 4MTOA 4OPAA 4FM1A 2OTLV 1MA1A 3ZHRA 3T1YB 4J80A 1RM1B 4U7NA 2JJ1G 4DR7O 3R66A 3HR0A 5FL7G 4NYKA 2CTPA 3ABLC 4FLZA 2RNBA 4HAMA 4LF8O 3DC6A 1K7DA 5DM6V 5LP6C 4DR6O 5JWPA 1QVFU 3JARB 4D7TA 1FJGO 4YJ3A 2IM9A 1H2LA 1TVKB 1V54C 2NNUA 5CN0A 4JI7O 1T5EA 1IX9A 3LDCA 2XOKG 3CRMA 3JCUZ 3D36A 1UFIA 4O2AB 1JJOA 2IJHA 3FD9A 5CA1A 4JYAO 4K0KO 4N23A 4PA7A 1SZTA 4DV5B 4TWKA 5JH7B 1IBLB 4X20A 3E22A 3G71V 3LNMB 5JQGB 4QIWF 2OTJV 3APOA 4LF4B 2ZE6A 5KHJA 3VBBA 1D5NA 3CCMV 3TK1A 3CJHB 1S3JA 2HJDA 5E79Z 1YDXA 3CRCA 3ZBHA 3FYEB 4I55A 4LNUA 5JCOA 4IYHA 5J2UB 3J81N 1VF6A 1YEWA 1VQ8V 2MK3A 3SYOA 4U3JA 3CRRA 4WFBV 2Q7HA 3JATA 1H2NA 1GRJA 2XAJA 3L72H 3OMAB 3WG7C 3OR7C 4O4HB 3D3IA 5JJNB 1ORQC 3APQA 2X6AA 1KMIZ 3AK1A 2QE7G 2XAFA 2RCVA 1IJGA 1SRYA 2BTOA 1RFYA 3O65A 1Y67A 1DK1A 4DR1O 1VEWA 2YS8A 1SKVA 3SJBC 4IGGA 2QKAA 4UVCA 3A0RA 4DV4B 3N2KA 2DJVA 2CH7B 1QR8A 1YF2A 4GX1A 5B3SC 2KQXA 4WCEV 3MD0A 3LDEA 1PNKA 2BE3A 3E8BA 1FOUA 3CYOA 3AG3C 3OT7A 4FLXA 3UCSC 4DV5O 4FVMA 3DSQA 1K9MW 3G80A 2WA3A 2LFRA 1KQSU 3X2QB 3RYCB 1FXKC 2E3CA 1EBOA 3LSUA 1NJIW 4NKGB 4O4IB 1SS3A 4X1YA 1G4YB 2ZKOA 5EK0A 2DQ3A 1HNXB 4YJ2B 4EB6B 2EILC 2EIMB 1Q81W 2EBOA 4TUYA 2F23A 2UUAO 4UXNA 3JAMN 1J5EO 1JJ2U 2EIJC 2ARHA 4MVSA 5EYPA 1PPJH 3K59A 3BCCH 5KX5A 3IFXA 3CCUV 2ADQB 1QR9A 1OCCB 4X89A 2K9PA 1I94O 1KYOF 4UCTA 4LF6O 1JR9A 2HVKC 1N0JA 5BY1A 4O2BB 3OM3B 1BL8A 4JZ2A 2XHBA 2PYJA 4J10A 3AEIA 4F4LA 1IZ3A 3E86A 4MVRA 4FLVA 4RQFA 3JARA 1Q7YW 2FKXA 5K1XA 1DF4A 3WB2A 4B3RO 2RN9A 1TVKA 5LHGA 4RWUA 1XREA 1M9NA 2LGWA 3DGEA 3AG2B 1XMOO 4QGPA 2HHHB 3C90A 4O2AA 4WBNB 4IYIA 1XL6A 2WLMA 1Q90D 2Q68A 3I56V 3CC4V 3KDRA 3W7UA 2UU9B 1N0NA 1IBKO 3TJTA 5JH7A 2CK3G 2DOSA 4AQYO 2E5LO 3DTUB 4ZHQA 2IBZH 2AXTZ 3CCVV 2PUSA 1R6NA 1S5HC 1I5XA 1M56C 3CJHA 3FB5C 4OX9O 1AI5A 1SC5B 1YVWA 1MSWD 2W6JG 1BMFG 1Z2GA 5J2UA 2ITCC 4PHZA 3RVYA 4FZ0A 4TSFG 2Z0AA 2ZR2A 1NT2B 1VQ5V 2W0FC 3MHHC 2M7WA 1SQFA 5CB4A 1XMQO 1RPOA 4O4HA 4LR3A 4R6ZA 1OJHA 2UUCB 3K5OA 5IWAB 3ABKB 1NTKH 3F5WC 3DXRB 2RJZA 2DWEC 4PD4F 3CCJV 2OCHA 3HPLC 4D6TH 1K4DC 3ETGA 3SJQC 5BR8O 2RQ6A 3TCUA 2P7TC 3UO2A 2JIZG 2HP8A 1EZVH 3L9DA 2HFEC 5LBQA 1TAEA 4IIJB 3WB1A 4I50A 1Y6XA 4B08A 1FFXB 5LP6B 3HKEB 1GH6A 2VQFO 3B8MA 5J9PC 3I5DA 5GONA 1K34A 1V54B 3RYCA 4B3MB 3CSXA 4NXNB 3JD0A 2Q0OC 4O4IA 2FB5A 1CP9A 2FTKA 4MVMA 4YJ2A 2BTQB 5JVDB 3RGBA 3CCEV 3CRQA 2ETNA 4TQDA 2YC0A 1QBZA 4JI5O 3PN1A 3QO7A 3ZRSA 2ADPA 1ZWIC 1R3JC 3ZIAG 4DV6B 3HB3B 5DECA 5JJEB 3HKBB 4OPHA 3ZEDA 4DV7O 5KA6A 2E75B 3OTOO 1TUEB 3CCRV 1MSDA 1DTOA 2IU0A 3IAYA 3TGUH 4I4TB 1FD9A 3SPIA 4O2BA 5GTIZ 4JV5O 1H2SB 1Q6IA 4YHHO 3JALB 1OCRC 3RBZA 1FAFA 1L0NH 1NTZH 3OMNB 3CB2A 4HNAB 3WG7B 4YY3O 1XOUA 1QU7A 3GWKC 1URFA 1NI8A 5IDJA 1HNWB 3QG5A 4TQFA 5CA3A 1NTMH 1IXMA 4FFKA 4L87A 2F66C 2ZDIA 4JF3A 3CHXA 4LF7O 2Y4TA 3ZJZA 1JVMA 3E22B 3CCSV 1WJZA 2YIBD 4WBNA 3UM7A 5L3DA 2GTSA 4TV8B 4YIPA 5B3SB 1H2KA 3F7YC 2B5UA 1RSOB 2EIKC 3ZMTA 3AG3B 1RPRA 5B5EZ 2QEXV 5KHHA 3B4SA 2Z5UA 1YIJV 1GN4A 1BZKA 5B1BC 3JD2A 1FXKB 4FZ1A 4NTWA 1NZ6A 4WFEA 4UV9A 2HJFC 3B77A 5C93A 2OIEA 4AI8A 4LFBO 4R8CA 3K08A 1AI7A 2CTWA 1KP2A 1M5IA 4P9OA 2EIJB 3OFNG 5IYBO 4DR7B 3KZIZ 2DE0X 4ABMA 4X66O 5LOVB 4DK1A 1L1FA 4LF8B 2EZPA 3G6EV 1VF5B 3DXRA 1WP8A 1PNMA 4W4KA 1JOYA 4DR6B 1DLBA 2QSAA 5ITZB 4JTCB 1AVMA 3SGIA 1GMGA 1FJGB 3FAVA 2UUBO 4GKKO 3LDDA 2JDIG 4K3AA 2M6YA 4I0XB 4LH6A 4JI7B 4J9YB 1FFXA 5LP6A 4B3TO 4K8XA 3H1KH 1N33O 2CGOA 4B3SO 2BCCH 1AI6A 1OV9A 3ZHUA 4X1YB 2BOBC 4JYAB 4K0KB 5IYZB 1XI1A 3ZX6A 4MTXA 1KUQA 1QNMA 5DEDA 1K4CC 1N4CA 4YIOA 3K03A 1QVGU 3E8GA 4BIOA 2BTQA 1NR7A 3K79A 5KX5B 3CEIA 3H1JH 3OMIB 1COWG 2XAHA 1OCZC 4ZBMA 4QPJA 2ZM6O 5CA0A 2PGGA 1ZSPA 4I7ZB 1XUQA 3AG7A 3T2MA 4MW3A 3H1HH 1FYJA 3HKBA 1M56B 4XBFA 1PD3A 1S0VA 2QGNA 4JI0O 4MTGA 4CC6A 1SQPH 5IYDO 4I4TA 1NVPD 2KKWA 4LH7A 2Y48A 4I9WA 1TUBA 3H9VA 1IXBA 2RDCA 3P30A 3JALA 1R73A 4DR1B 2XT9A 1FS0G 4KHPO 1BE3H 4HNAA 4JI4O 1H2MA 4UCOA 4JPRA 4N21A 4GX0A 2A9HA 4JASA 1I5YA 1W2BU 1AJQA 3JD4A 1XNQO 2WSSG 4J11A 1N8RW 5BZBA 2YI8A 4PV1B 4DV3O 3IJ4A 2Q6AA 1VQMV 4XDKA 4DV1O 4BW9A 5H6QA 1OHHG 4ZKIA 1U96A 1HDJA 2FYUH 4X1IB 4ZHQB 4TV8A 3T4DA 4MVQA 1R3KC 3JSLA 3BEHA 3UO3A 1Q82W 2WLLB 1RSOA 3SJAC 4CS4A 1JMKC 5FPRA 3BABA 4E4EA 4WFAV 4LFAO 3P32A 4PDMA 2AW9A 1H5WA 1XEQA 1VQ9V 3K5LA 2QKCA 2UUAB 3Q4HA 2YXYA 1J5EB 1AILA 1NVPB 5B1NA 5L3GA 1IBMO 4DW0A 1FXKA 3FKSG 3T1HO 1SF9A 1VQ6V 5CB4B 3U11A 4TV9B 4NXMO 5LGUA 3UQ8A 1L8DA 5EC2C 3AK3A 3ZS8C 1NR1A 4R50A 1I94B 4LF6B 4A5UB 2R70A 2JVDA 2VWKA 1BQZA 4BWAA 5A9GA 3NR7A 1Q43A 5LOVA 3VOUA 1SQXH 3ETQA 3RYHA 3FFQA 1K3EA 4X62O 4JI6O 2P5OA 4KFMA 4CS2A 4H0LB 2VS0A 2YIBA 5EBMC 1GTOA 4DR4O 3M7MX 2R9IA 4I50B 5ITZA 2HR3A 4IL6Z 4B7KA 1Y74B 1E79G 4CH4A 4B3RB 4LFCO 1OCRB 4I0XA 4UCVA 5KAFZ 3BA9A 5GONB 3QO5A 4UV8A 1XMOB 4BW5A 3BY6A 1NS1A 3PJSK 2OYQA 5CMUA 5EZYB 5IYZA 2DYRC 1IBKB 1BQ0A 4FPPA 1EN6A 4AQYB 2RMKB 2E5LB 2ODMA 3N2GA 2OWOA 3SPGA 2QTSA 2AGAA 4IHJB 2DWDC 3OD4A 4GZRB 1WLEA 4RQEA 4OX9B 2KG7B 4MW8A 4FM2A 4ZI7A 4D7SA 3HKCB 4LP8A 2WLNA 2X0LA 3IC7A 2EIKB 3AG1C 2NN4A 5DN6G 4MVUA 1KU9A 1PNLA 3VQXA 4DUZO 3CPWU 4NR1A 1U97A 5BXZA 1WPBA 2F1MA 3MAQA 5B1BB 1XMQB 3EFFK 4O4JB 1PL0A 2HLDG 2ZT9B 1GN6A 3K57A 2CE4A 1F7YA 3CE2A 4JI2O 4EKWA 5BR8B 4UCRA 2WPDG 3N27A 2GBOA 4LWSA 2YUAA 4RUEA 4Z2WA 4I5SA 5IJ9B 1UPGA 1GM7A 3A8TA 3E35A 2VQFB 5H9CA 3IGAC 2QTOA 1VQKV 1JCHA 2XAGA 2JGDB 4X1IA 5B1AC 1WPXA 2KSDA 4FMTA 5E1AC 2XNDG 2PF4E 1F23A 1CEZA 1SQQH 3FB7C 3QNEA 1HNZO 2CTQA 1AI4A 2X6BA 2WLLA 3STZC 2QM4A 4DO2A 2F4VB 1CPYA 2E74B 4QJFB 1SETA 1WA8B 3OUFA 4MS2A 4MSWC 1Y76B 2JEXA 1FFTB 1V9PA 2B9ZA 4RAIA 2LQTA 4FLTA 2ZIOA 4JI5B 3RVZA 4DV0O 2K1EA 5F2VO 4PA3A 2ILMA 4TV9A 2YIAA 3OAAG 2V1DA 3ZRWB 4BR6A 4DV7B 3S3WA 4Z1MG 1WAZA 3OTOB 2UXBO 1OCZB 4HBNA 4G27B 3P3NA 1VQOV 1J95A 2ZNIA 1EN4A 1NQTA 1XILA 1QLNA 3JAKB 4JV5B 4YHHB 4X88A 3FAVB 1B06A 1US6A 4KXRA 4BIZA 3A0BZ 2Q9LA 3ZN0A 5CBFA 3LSSA 2Y0IA 1N32O 4MVZA 4YY3B 2ZE5A 4QE9A 1GN2A 4TT3G 4B7EA 4LF5O 4F6EA 1FKAO 1Y74A 3K5MA 1SQBH 1IDSA 3FX7A 3JAWB 1Q3EA 5BMVA 1VQNV 2Y0PA 1MABG 2B1GA 3ZCCA 5FLXN 3ZHTA 4LF7B 1MZEA 5LGNA 4Z1VA 1P4RA 5EZYA 2P06A 4UVBA 2F4VO 1KKDA 1ZL8A 4E2LA 3W7SA 2QWOB 4CH6A 3U10A 2DMXA 3H1IH 4I9QA 4J7ZA 1EZJA 4GKJO 1NH2D 5CA0B 1HWYA 1M90W 2A0LA 4IHJA 2QJ1A 1XNRO 3JYCA 1WN7A 3OEEG 5LA6A 2HG5C 2KG7A 2VRZA 3KKYA 3HKCA 4X65O 2QM7A 3QF7A 5KLVH 4DR2B 1VMGA 1PP9H 3MDSA 1TUBB 4LFBB 2Y4UA 1S76D 3ETDA 2P90A 4X1KB 2OIGA 3P3PA 4WFFA 3OEHG 4O4JA 4KP4A 1KP3A 1K5SA 4X66B 4DV2B 5HFLA 1UJWB 2MW2B 3IC9A 1K33A 1THZA 4RUFA 2P67A 1PM9A 2ZXWC 2IJIA 2Q67A 1BCCH 2ZCEA 5EC1C 1BT8A 3AK2A 4GLXA 3L74H 2DN9A 4DK0A 2YICA 1AJNA 1F4MA 2UUBB 1GN3A 2QKSA 3C3TA 3LNNA 2OT5A 4RO2A 4GKKB 5IJ9A 1AR4A 1NH2B 4HZ3A 3ZRVA 3S3XA 2OCCC 2UXCO 1I0HA 3SYQA 4B3TB 1WP7A 2X6CA 1XHZA 1R3IC 1N33B 4U7OA 4B3SB 5IY5C 2JGDA 2Y69C 4UUJC 2XASA 2EINC 4PDRA 4JI1O 1BS3A 5L3BA 1HR0B 5L3FA 5FNVB 5KMGA 3Q4HB 4EFEA 4CH3A 3K0DA 1B04A 3ABMC 4Q20A 1WA8A 3L70H 4JYCA 4OGQB 2G38A 4DR2O 1Y76A 3BPZA 2UXDO 1XBLA 2V4DA 5D5QA 2DYRB 2ZM6B 5C8YB 5L3CA 4PELA 2Q73A 1X59A 3JD3A 3H1LH 1BHAA 3TXQA 4WFHA 1O9GA 3L75H 4GT1A 2YXLA 3ZRWA 3HKDA 4DV2O 1YJ9V 3I55V 4JI0B 5KHKA 4LBEC 2FMLA 2HKOA 4ASUG 5LMUO 4ICGA 3RYHB 1VQ4V 3JASB 5H5NA 1H8HG 2P4KA 1JQ0A 5KUKA 1N36O 2Q0AA 1SESA 3E8HA 2VQEO 3JAKA 3AG1B 2BSKB 1LUWA 1BSMA 3CMEV 3QTCA 3ZMSA 4KHPB 2Q7EA 1P7GA 1IURA 2GUZA 4JI3B 4JI4B 2Q4PA 2JRIA 5A2QN 2UXNA 3KG2A 4AILC 1XNQB 4DRXB 3UT5A 4DV3B 4IT5A 4NB5A 3B8NA 5LMNO 4ZIBA 2IH3C 3JAWA 2YI9A 2WA4A 4DV1B 3K5NA 3K06A 4H44B 1HR0O 4R7CA 3MHSC 4GCZA 4JI8O 3N2GB 2LGQA 1YJNV 3ZMZA 3UKMA 1YSCA 1XQ8A 3BFRA 5JJJB 1VQPV 4KL1A 1JFFB 4X64B 4O4LB 2WLHA 4ZI7B 4WF9V 3SDLA 4EFBA 4LFAB 4PI0A 4CS3A 5B1AB 3ZHVA 2LP7A 2IU3A 2YIDA 2GHYA 2XAQA 2AHZA 3CS5A 1IBMB 4FK5C 3T1HB 2R9AA 5D5PA 4DUYB 3B2EE 1MZFA 4NXMB 2A06H 3QO8A 4H13B 5LXTA 1QLEC 3ASNC 1KC8W 1V55C 1D5AA 4X1KA 3K9AA 4F6RB 4DR5O 2DYSC 4JI3O 3M8AA 3SPCA 1S72V 3BA8A 2X7RB 2IJKA 1MMMA 4OXSA 4P30A 4LWSB 4X62B 4JI6B 3ZHQA 3ICXA 1D2DA 2GDSA 1EFRG 1VIBA 4DR4B 4X8AA 3J80N 1P84F 3RN4A 3ASOC 3FB8C 1LUVA 4LFCB 3H01A 1KBHA 1JNBA 4K35A 1FXVA 2KB1A 1VQ7V 2WLIB 3SYCA 1N34B 2ZE8A 2ZE7A 2DW4A 1M57C 2WWWA 4DR3O 2R72A 2BOCC 4J41A 1PKXA 4X64O 3G4SV 1BGYH 3WU2Z 2QWPB 1BHBA 5FNVA 4LF9B 2L35A 3F5TA 3G67A 1MOFA 4GX2A 4NTXA 4H37A 3L73H 1XHXA 4DUYO 1VF7A 1QCEA 3TXSA 5C8YA 1ROPA 2Q7GA 1PV0A 1YCIA 3T1YO 3SPJA 5FPOA 4PDVA 4FLYA 1FPOA 3CCQV 2ZR3A 1P49A 4DUZB 1HP8A 4JTAB 1LR1A 3CD6V 5KUMA 3T1CA 2D2CB 3D36C 3JASA 3RWRD 2Q8VA 1OCOC 1TGOA 3LSQA 2BSKA 1SERA 5CBHA 1SA0A 3B40A 2YEVB 4JI2B 1SQVH 5BMVB 1JX9A 4Q6GA 1R6KA 1VP7A 1N34O 1W0KG 1G1XB 2JS3A 4DRXA 2R9RB 1B6QA 3OR6C 4FIPC
chains in the Genus database with same CATH topology
1QNMA 1LUWA 1BSMA 2AW9A 1Y67A 3RN4A 4BR6A 1P7GA 2QKCA 1VEWA 4JYYA 4YIPA 4YIOA 1LUVA 3IC9A 1PM9A 3QVNA 1BT8A 3DC6A 2QKAA 3AK2A 1EN4A 1XREA 1XILA 3CEIA 1SZXA 4GUNA 3DC5A 1B06A 3AK3A 1ZSPA 1XUQA 1JA8A 1GN3A 1GN4A 3C3TA 3OT7A 3KDRA 1N0NA 1AR4A 1GN2A 1GN6A 3TJTA 2CE4A 1I0HA 5A9GA 4X9QA 1IX9A 4F6EA 3BFRA 1IDSA 1MNGA 3LSUA 4C7UA 1BS3A 2ADPA 1IXBA 1XDCA 1ZLZA 4JZGA 1ZUQA 1PL4A 1MSDA 3K9SA 1AR5A 1D5NA 2CDYA 1AP5A 1KKCA 2ADQB 1WB7A 1AVMA 5AG2A 1WB8A 3EVKA 1EN5A 3KKYA 1EN6A 1JR9A 1EM1A 1N0JA 1ZTEA 1AP6A 1MMMA 4JZ2A 4FFKA 1VARA 3MDSA 2P4KA 3AK1A 2GDSA 2RCVA 1MA1A 3C3SA 1I08A 4E4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNM A;  1LUW A;  1BSM A;  2AW9 A;  1Y67 A;  3RN4 A;  4BR6 A;  1P7G A;  2QKC A;  1VEW A;  4JYY A;  4YIP A;  4YIO A;  1LUV A;  3IC9 A;  1PM9 A;  3QVN A;  1BT8 A;  3DC6 A;  2QKA A;  3AK2 A;  1EN4 A;  1XRE A;  1XIL A;  3CEI A;  1SZX A;  4GUN A;  3DC5 A;  1B06 A;  3AK3 A;  1ZSP A;  1XUQ A;  1JA8 A;  1GN3 A;  1GN4 A;  3C3T A;  3OT7 A;  1N0N A;  1AR4 A;  1GN2 A;  1GN6 A;  3TJT A;  2CE4 A;  1I0H A;  5A9G A;  4X9Q A;  1IX9 A;  4F6E A;  3BFR A;  1IDS A;  1MNG A;  3LSU A;  4C7U A;  1BS3 A;  2ADP A;  1IXB A;  1XDC A;  1ZLZ A;  4JZG A;  1ZUQ A;  1PL4 A;  1MSD A;  3K9S A;  1AR5 A;  1D5N A;  2CDY A;  1AP5 A;  1KKC A;  2ADQ B;  1WB7 A;  1AVM A;  5AG2 A;  1WB8 A;  3EVK A;  1EN5 A;  3KKY A;  1EN6 A;  1JR9 A;  1EM1 A;  1N0J A;  1ZTE A;  1AP6 A;  1MMM A;  4JZ2 A;  4FFK A;  1VAR A;  3MDS A;  2P4K A;  3AK1 A;  2GDS A;  2RCV A;  1MA1 A;  3C3S A;  1I08 A;  4E4E A; 
#chains in the Genus database with same CATH topology
 2ZXW B;  4GYC B;  1ZL8 B;  4HYO A;  2O57 A;  5GW7 A;  5JCO C;  2GSM B;  3JD1 A;  1YIT V;  1IBL O;  1VF6 C;  4FLU A;  2ZIM A;  1MG1 A;  2C2A A;  4LF9 O;  3RYF B;  2V7Q G;  4CH5 A;  4LF4 O;  4FLW A;  3AG4 C;  1SZX A;  3SPH A;  4DXW A;  4GUN A;  4H33 A;  2PZS A;  1G6U A;  4P2Z A;  1HNZ B;  2PI4 A;  3BHP A;  2PI5 A;  3GB7 C;  5LA6 B;  2OCC B;  1JFF A;  4O4L A;  5CBG A;  1JA8 A;  4CZZ A;  3E8F A;  1YXB A;  5H2F Z;  4DYL A;  2YSU B;  5J2T B;  3E2E A;  5IY5 B;  2Y69 B;  3RYI B;  3L71 H;  3E83 A;  2EIN B;  2W6I G;  1RP3 B;  2PY5 A;  3M99 B;  4U3F H;  4DV0 B;  1K97 A;  5EIB C;  1LNQ A;  3ABM B;  3J7A U;  1SQG A;  1W0J G;  3ZMV A;  1ZLZ A;  4JZG A;  2UXB B;  1QQC A;  3CXC U;  2GV9 A;  1GO3 F;  3WB0 A;  4J7K A;  4F6R A;  4BAY A;  1Z5W A;  2D3O W;  4DV4 O;  5B66 Z;  1AP5 A;  2N04 A;  3CC2 V;  1KKC A;  4UCU A;  1WB7 A;  3BRC A;  4TOI A;  1Q6U A;  1N32 B;  4NTY A;  5L3E A;  5IE9 A;  1A32 A;  3OUS A;  2B1I A;  4PI2 A;  1NKD A;  4LF5 B;  3OW2 U;  2WLJ A;  4FFB B;  4JAA A;  1JPX A;  1W59 A;  2WLI A;  5B1O A;  4UFZ A;  3VQY A;  3RW0 A;  5KMG B;  1DGS A;  2ATK C;  3R65 A;  1HNX O;  4PA4 A;  4CBC A;  2AZ0 A;  4BIU A;  2YXH A;  2JEU A;  2GTA A;  5LYJ B;  2CUG A;  1F51 A;  1Q5O A;  3ZMU A;  1S5L Z;  5JQG A;  1DF5 A;  1RM1 C;  2FL4 A;  4MVO A;  4GKJ B;  4J9Z B;  1XNR B;  2H3O A;  4PA6 A;  4ZOL B;  5TIS Z;  3T4Z A;  4LC1 A;  5KA5 A;  2LO1 A;  1M4U A;  3HKD B;  1E1Q G;  4X65 B;  4G2K A;  2N05 A;  3F7V C;  1HW7 A;  3KCY A;  5EBL C;  4X9Q A;  3JSN A;  3BAA A;  4NVP A;  3SR2 C;  3OGI B;  4MT8 A;  1MNG A;  1NU1 H;  5HFM A;  5IYC O;  1XDC A;  2PTM A;  3CP1 A;  2GUZ B;  2EJ7 A;  1ZUQ A;  1PL4 A;  4GX5 A;  1FXH A;  2Q69 A;  4UB6 Z;  4J42 A;  1VQL V;  2AHY A;  2F93 B;  2L6L A;  3UT5 B;  2NLJ C;  2YEV A;  5KHG A;  2CDY A;  1QLE B;  2JGU A;  3ASN B;  1V55 B;  3CRA A;  5IJ0 B;  1YTF D;  2CH7 A;  3CMA V;  1GK9 A;  1GAX A;  2DYS B;  2HHH O;  4UCS A;  1KD1 W;  5LHI A;  3ABL B;  3CX5 F;  3G6B A;  3ZN1 A;  3EVK A;  2CAZ C;  3STL C;  1G8M A;  1KB9 F;  2UU9 O;  2EUL A;  2Z3Y A;  1EM1 A;  2UXC B;  1AB3 A;  1Z5V A;  3RYF A;  1Y4M A;  3ASO B;  1M93 A;  3FYI B;  3A0H Z;  4W4L A;  4JI1 B;  1R1B A;  1I08 A;  4DW1 A;  1GM9 A;  2P4V A;  3K3W A;  5EBW C;  4JYB A;  4JYY A;  4EB6 A;  2QWR B;  4MTF A;  1M57 B;  5J2T A;  3B09 A;  3E89 A;  3QVN A;  2UXD B;  1L0L H;  4PA9 A;  3RYI A;  3ZHS A;  2A3Q A;  5IT9 N;  5LHH A;  5LXT B;  3D8C A;  3DC5 A;  1ENV A;  4XDL A;  4FJC C;  2ZIN A;  2WLK A;  2UUC O;  3ABT A;  5IWA O;  2ZD9 A;  1YTF B;  3RFR A;  3SYA A;  5LMU B;  4PDL A;  1NBM G;  2F95 B;  1P7B A;  2H8P C;  1N36 B;  2JS5 A;  2VQE B;  3RT3 C;  4YJ3 B;  2QR4 A;  1ZAU A;  4JTD B;  2LFS A;  3X2Q C;  1ARO P;  1K92 A;  4P9P A;  3TET A;  2AZ2 A;  1K8A W;  2W0X A;  3OE7 G;  3OTF A;  2A79 B;  3K9S A;  2UXX A;  1AR5 A;  2EIM C;  5LL6 Y;  1OCO B;  5CA1 B;  1Q86 W;  2EJR A;  5LMN B;  4FFB A;  4XDJ A;  4FM0 A;  3EHB B;  5EIB D;  1E1R G;  4QE7 A;  4B3M O;  4NXN O;  4X20 B;  3W7W A;  3SJC C;  2ZQM A;  1YZB A;  1WB8 A;  4JI8 B;  1OCC C;  2QM8 A;  1Q6H A;  1ZTE A;  3CXH F;  3K0G A;  2E76 B;  3W7T A;  4J7J A;  5LYJ A;  1VAR A;  1YJW V;  4AHC A;  1B3Q A;  1CXZ B;  4I55 B;  4LNU B;  2EZO A;  2IH1 C;  2N74 A;  3C3S A;  5GTH Z;  1X4T A;  2HEP A;  3BVO A;  3K04 A;  2QWQ B;  1O9H A;  1M1K W;  2WAM A;  4ZOL A;  4QNH B;  4DV6 O;  4U3J B;  1AJP A;  5H6R A;  3AG4 B;  1GM8 A;  4QPK A;  2XUM A;  1R6T A;  2JJ2 G;  3JAT B;  3NXS A;  5LGT A;  1H2G A;  1Q8I A;  1AR1 B;  2XTA A;  4KUM A;  2QDO A;  5KAI Z;  2EIL B;  1K5Q A;  2F43 G;  5K1P A;  3CCL V;  3GWO A;  2ZDI C;  1ZX3 A;  3W7X A;  3AG2 C;  3LUT B;  2EX3 A;  2LW7 A;  1SA0 B;  4DR5 B;  2A7W A;  1KEC A;  2CTR A;  2DQ0 A;  3D3Q A;  3N2K B;  3GVM A;  1HNW O;  1GKF A;  1Y66 A;  2H94 A;  2ITD C;  3ABU A;  4WFG A;  4K8Z A;  3CC7 V;  2LJ2 A;  1R3L C;  2LW1 A;  3CWB H;  3VQW A;  5KHI A;  4UB8 Z;  1S77 D;  4PJ0 Z;  2IW5 A;  4C7U A;  2YDE A;  2HVJ C;  4UVA A;  1K73 W;  4JGS A;  5IJ0 A;  3JCZ A;  3K58 A;  1YHQ V;  3KCX A;  1XL4 A;  4IIJ A;  1H38 A;  2NR5 A;  2IJJ A;  3FB6 C;  1YI2 V;  3HKE A;  1IVS A;  3THO A;  1F4N A;  3O9O A;  4DR3 B;  2P6J A;  4YXW G;  3OGC C;  1H8E G;  4JAV A;  3A2F A;  2QWN B;  1S5J A;  3ML0 A;  4CC5 A;  3ZRX A;  5AG2 A;  3WFV A;  4TUY B;  2P22 C;  4JAU A;  1WNS A;  3VQV A;  1EN5 A;  1OZ0 A;  2Q5Z A;  2QA4 V;  3U0Z A;  2VWJ A;  1I7F A;  4EEQ A;  3EXA A;  2JK5 C;  2CGN A;  4L8J A;  5EYP B;  2PYL A;  1AP6 A;  1TA8 A;  5JVD A;  3SYP A;  4G28 B;  3ETE A;  3ABK C;  1QHT A;  2ZNJ A;  4LCU C;  4MTO A;  4OPA A;  4FM1 A;  2OTL V;  1MA1 A;  3ZHR A;  3T1Y B;  4J80 A;  1RM1 B;  4U7N A;  2JJ1 G;  4DR7 O;  3R66 A;  3HR0 A;  5FL7 G;  4NYK A;  2CTP A;  3ABL C;  4FLZ A;  2RNB A;  4HAM A;  4LF8 O;  3DC6 A;  1K7D A;  5DM6 V;  5LP6 C;  4DR6 O;  5JWP A;  1QVF U;  3JAR B;  4D7T A;  1FJG O;  4YJ3 A;  2IM9 A;  1H2L A;  1TVK B;  1V54 C;  2NNU A;  5CN0 A;  4JI7 O;  1T5E A;  1IX9 A;  3LDC A;  2XOK G;  3CRM A;  3JCU Z;  3D36 A;  1UFI A;  4O2A B;  1JJO A;  2IJH A;  3FD9 A;  5CA1 A;  4JYA O;  4K0K O;  4N23 A;  4PA7 A;  1SZT A;  4DV5 B;  4TWK A;  5JH7 B;  1IBL B;  4X20 A;  3E22 A;  3G71 V;  3LNM B;  5JQG B;  4QIW F;  2OTJ V;  3APO A;  4LF4 B;  2ZE6 A;  5KHJ A;  3VBB A;  1D5N A;  3CCM V;  3TK1 A;  3CJH B;  1S3J A;  2HJD A;  5E79 Z;  1YDX A;  3CRC A;  3ZBH A;  3FYE B;  4I55 A;  4LNU A;  5JCO A;  4IYH A;  5J2U B;  3J81 N;  1VF6 A;  1YEW A;  1VQ8 V;  2MK3 A;  3SYO A;  4U3J A;  3CRR A;  4WFB V;  2Q7H A;  3JAT A;  1H2N A;  1GRJ A;  2XAJ A;  3L72 H;  3OMA B;  3WG7 C;  3OR7 C;  4O4H B;  3D3I A;  5JJN B;  1ORQ C;  3APQ A;  2X6A A;  1KMI Z;  3AK1 A;  2QE7 G;  2XAF A;  2RCV A;  1IJG A;  1SRY A;  2BTO A;  1RFY A;  3O65 A;  1Y67 A;  1DK1 A;  4DR1 O;  1VEW A;  2YS8 A;  1SKV A;  3SJB C;  4IGG A;  2QKA A;  4UVC A;  3A0R A;  4DV4 B;  3N2K A;  2DJV A;  2CH7 B;  1QR8 A;  1YF2 A;  4GX1 A;  5B3S C;  2KQX A;  4WCE V;  3MD0 A;  3LDE A;  1PNK A;  2BE3 A;  3E8B A;  1FOU A;  3CYO A;  3AG3 C;  3OT7 A;  4FLX A;  3UCS C;  4DV5 O;  4FVM A;  3DSQ A;  1K9M W;  3G80 A;  2WA3 A;  2LFR A;  1KQS U;  3X2Q B;  3RYC B;  1FXK C;  2E3C A;  1EBO A;  3LSU A;  1NJI W;  4NKG B;  4O4I B;  1SS3 A;  4X1Y A;  1G4Y B;  2ZKO A;  5EK0 A;  2DQ3 A;  1HNX B;  4YJ2 B;  4EB6 B;  2EIL C;  2EIM B;  1Q81 W;  2EBO A;  4TUY A;  2F23 A;  2UUA O;  4UXN A;  3JAM N;  1J5E O;  1JJ2 U;  2EIJ C;  2ARH A;  4MVS A;  5EYP A;  1PPJ H;  3K59 A;  3BCC H;  5KX5 A;  3IFX A;  3CCU V;  2ADQ B;  1QR9 A;  1OCC B;  4X89 A;  2K9P A;  1I94 O;  1KYO F;  4UCT A;  4LF6 O;  1JR9 A;  2HVK C;  1N0J A;  5BY1 A;  4O2B B;  3OM3 B;  1BL8 A;  4JZ2 A;  2XHB A;  2PYJ A;  4J10 A;  3AEI A;  4F4L A;  1IZ3 A;  3E86 A;  4MVR A;  4FLV A;  4RQF A;  3JAR A;  1Q7Y W;  2FKX A;  5K1X A;  1DF4 A;  3WB2 A;  4B3R O;  2RN9 A;  1TVK A;  5LHG A;  4RWU A;  1XRE A;  1M9N A;  2LGW A;  3DGE A;  3AG2 B;  1XMO O;  4QGP A;  2HHH B;  3C90 A;  4O2A A;  4WBN B;  4IYI A;  1XL6 A;  2WLM A;  1Q90 D;  2Q68 A;  3I56 V;  3CC4 V;  3KDR A;  3W7U A;  2UU9 B;  1N0N A;  1IBK O;  3TJT A;  5JH7 A;  2CK3 G;  2DOS A;  4AQY O;  2E5L O;  3DTU B;  4ZHQ A;  2IBZ H;  2AXT Z;  3CCV V;  2PUS A;  1R6N A;  1S5H C;  1I5X A;  1M56 C;  3CJH A;  3FB5 C;  4OX9 O;  1AI5 A;  1SC5 B;  1YVW A;  1MSW D;  2W6J G;  1BMF G;  1Z2G A;  5J2U A;  2ITC C;  4PHZ A;  3RVY A;  4FZ0 A;  4TSF G;  2Z0A A;  2ZR2 A;  1NT2 B;  1VQ5 V;  2W0F C;  3MHH C;  2M7W A;  1SQF A;  5CB4 A;  1XMQ O;  1RPO A;  4O4H A;  4LR3 A;  4R6Z A;  1OJH A;  2UUC B;  3K5O A;  5IWA B;  3ABK B;  1NTK H;  3F5W C;  3DXR B;  2RJZ A;  2DWE C;  4PD4 F;  3CCJ V;  2OCH A;  3HPL C;  4D6T H;  1K4D C;  3ETG A;  3SJQ C;  5BR8 O;  2RQ6 A;  3TCU A;  2P7T C;  3UO2 A;  2JIZ G;  2HP8 A;  1EZV H;  3L9D A;  2HFE C;  5LBQ A;  1TAE A;  4IIJ B;  3WB1 A;  4I50 A;  1Y6X A;  4B08 A;  1FFX B;  5LP6 B;  3HKE B;  1GH6 A;  2VQF O;  3B8M A;  5J9P C;  3I5D A;  5GON A;  1K34 A;  1V54 B;  3RYC A;  4B3M B;  3CSX A;  4NXN B;  3JD0 A;  2Q0O C;  4O4I A;  2FB5 A;  1CP9 A;  2FTK A;  4MVM A;  4YJ2 A;  2BTQ B;  5JVD B;  3RGB A;  3CCE V;  3CRQ A;  2ETN A;  4TQD A;  2YC0 A;  1QBZ A;  4JI5 O;  3PN1 A;  3QO7 A;  3ZRS A;  2ADP A;  1ZWI C;  1R3J C;  3ZIA G;  4DV6 B;  3HB3 B;  5DEC A;  5JJE B;  3HKB B;  4OPH A;  3ZED A;  4DV7 O;  5KA6 A;  2E75 B;  3OTO O;  1TUE B;  3CCR V;  1MSD A;  1DTO A;  2IU0 A;  3IAY A;  3TGU H;  4I4T B;  1FD9 A;  3SPI A;  4O2B A;  5GTI Z;  4JV5 O;  1H2S B;  1Q6I A;  4YHH O;  3JAL B;  1OCR C;  3RBZ A;  1FAF A;  1L0N H;  1NTZ H;  3OMN B;  3CB2 A;  4HNA B;  3WG7 B;  4YY3 O;  1XOU A;  1QU7 A;  3GWK C;  1URF A;  1NI8 A;  5IDJ A;  1HNW B;  3QG5 A;  4TQF A;  5CA3 A;  1NTM H;  1IXM A;  4FFK A;  4L87 A;  2F66 C;  2ZDI A;  4JF3 A;  3CHX A;  4LF7 O;  2Y4T A;  3ZJZ A;  1JVM A;  3E22 B;  3CCS V;  1WJZ A;  2YIB D;  4WBN A;  3UM7 A;  5L3D A;  2GTS A;  4TV8 B;  4YIP A;  5B3S B;  1H2K A;  3F7Y C;  2B5U A;  1RSO B;  2EIK C;  3ZMT A;  3AG3 B;  1RPR A;  5B5E Z;  2QEX V;  5KHH A;  3B4S A;  2Z5U A;  1YIJ V;  1GN4 A;  1BZK A;  5B1B C;  3JD2 A;  1FXK B;  4FZ1 A;  4NTW A;  1NZ6 A;  4WFE A;  4UV9 A;  2HJF C;  3B77 A;  5C93 A;  2OIE A;  4AI8 A;  4LFB O;  4R8C A;  3K08 A;  1AI7 A;  2CTW A;  1KP2 A;  1M5I A;  4P9O A;  2EIJ B;  3OFN G;  5IYB O;  4DR7 B;  3KZI Z;  2DE0 X;  4ABM A;  4X66 O;  5LOV B;  4DK1 A;  1L1F A;  4LF8 B;  2EZP A;  3G6E V;  1VF5 B;  3DXR A;  1WP8 A;  1PNM A;  4W4K A;  1JOY A;  4DR6 B;  1DLB A;  2QSA A;  5ITZ B;  4JTC B;  1AVM A;  3SGI A;  1GMG A;  1FJG B;  3FAV A;  2UUB O;  4GKK O;  3LDD A;  2JDI G;  4K3A A;  2M6Y A;  4I0X B;  4LH6 A;  4JI7 B;  4J9Y B;  1FFX A;  5LP6 A;  4B3T O;  4K8X A;  3H1K H;  1N33 O;  2CGO A;  4B3S O;  2BCC H;  1AI6 A;  1OV9 A;  3ZHU A;  4X1Y B;  2BOB C;  4JYA B;  4K0K B;  5IYZ B;  1XI1 A;  3ZX6 A;  4MTX A;  1KUQ A;  1QNM A;  5DED A;  1K4C C;  1N4C A;  4YIO A;  3K03 A;  1QVG U;  3E8G A;  4BIO A;  2BTQ A;  1NR7 A;  3K79 A;  5KX5 B;  3CEI A;  3H1J H;  3OMI B;  1COW G;  2XAH A;  1OCZ C;  4ZBM A;  4QPJ A;  2ZM6 O;  5CA0 A;  2PGG A;  1ZSP A;  4I7Z B;  1XUQ A;  3AG7 A;  3T2M A;  4MW3 A;  3H1H H;  1FYJ A;  3HKB A;  1M56 B;  4XBF A;  1PD3 A;  1S0V A;  2QGN A;  4JI0 O;  4MTG A;  4CC6 A;  1SQP H;  5IYD O;  4I4T A;  1NVP D;  2KKW A;  4LH7 A;  2Y48 A;  4I9W A;  1TUB A;  3H9V A;  1IXB A;  2RDC A;  3P30 A;  3JAL A;  1R73 A;  4DR1 B;  2XT9 A;  1FS0 G;  4KHP O;  1BE3 H;  4HNA A;  4JI4 O;  1H2M A;  4UCO A;  4JPR A;  4N21 A;  4GX0 A;  2A9H A;  4JAS A;  1I5Y A;  1W2B U;  1AJQ A;  3JD4 A;  1XNQ O;  2WSS G;  4J11 A;  1N8R W;  5BZB A;  2YI8 A;  4PV1 B;  4DV3 O;  3IJ4 A;  2Q6A A;  1VQM V;  4XDK A;  4DV1 O;  4BW9 A;  5H6Q A;  1OHH G;  4ZKI A;  1U96 A;  1HDJ A;  2FYU H;  4X1I B;  4ZHQ B;  4TV8 A;  3T4D A;  4MVQ A;  1R3K C;  3JSL A;  3BEH A;  3UO3 A;  1Q82 W;  2WLL B;  1RSO A;  3SJA C;  4CS4 A;  1JMK C;  5FPR A;  3BAB A;  4E4E A;  4WFA V;  4LFA O;  3P32 A;  4PDM A;  2AW9 A;  1H5W A;  1XEQ A;  1VQ9 V;  3K5L A;  2QKC A;  2UUA B;  3Q4H A;  2YXY A;  1J5E B;  1AIL A;  1NVP B;  5B1N A;  5L3G A;  1IBM O;  4DW0 A;  1FXK A;  3FKS G;  3T1H O;  1SF9 A;  1VQ6 V;  5CB4 B;  3U11 A;  4TV9 B;  4NXM O;  5LGU A;  3UQ8 A;  1L8D A;  5EC2 C;  3AK3 A;  3ZS8 C;  1NR1 A;  4R50 A;  1I94 B;  4LF6 B;  4A5U B;  2R70 A;  2JVD A;  2VWK A;  1BQZ A;  4BWA A;  5A9G A;  3NR7 A;  1Q43 A;  5LOV A;  3VOU A;  1SQX H;  3ETQ A;  3RYH A;  3FFQ A;  1K3E A;  4X62 O;  4JI6 O;  2P5O A;  4KFM A;  4CS2 A;  4H0L B;  2VS0 A;  2YIB A;  5EBM C;  1GTO A;  4DR4 O;  3M7M X;  2R9I A;  4I50 B;  5ITZ A;  2HR3 A;  4IL6 Z;  4B7K A;  1Y74 B;  1E79 G;  4CH4 A;  4B3R B;  4LFC O;  1OCR B;  4I0X A;  4UCV A;  5KAF Z;  3BA9 A;  5GON B;  3QO5 A;  4UV8 A;  1XMO B;  4BW5 A;  3BY6 A;  1NS1 A;  3PJS K;  2OYQ A;  5CMU A;  5EZY B;  5IYZ A;  2DYR C;  1IBK B;  1BQ0 A;  4FPP A;  1EN6 A;  4AQY B;  2RMK B;  2E5L B;  2ODM A;  3N2G A;  2OWO A;  3SPG A;  2QTS A;  2AGA A;  4IHJ B;  2DWD C;  3OD4 A;  4GZR B;  1WLE A;  4RQE A;  4OX9 B;  2KG7 B;  4MW8 A;  4FM2 A;  4ZI7 A;  4D7S A;  3HKC B;  4LP8 A;  2WLN A;  2X0L A;  3IC7 A;  2EIK B;  3AG1 C;  2NN4 A;  5DN6 G;  4MVU A;  1KU9 A;  1PNL A;  3VQX A;  4DUZ O;  3CPW U;  4NR1 A;  1U97 A;  5BXZ A;  1WPB A;  2F1M A;  3MAQ A;  5B1B B;  1XMQ B;  3EFF K;  4O4J B;  1PL0 A;  2HLD G;  2ZT9 B;  1GN6 A;  3K57 A;  2CE4 A;  1F7Y A;  3CE2 A;  4JI2 O;  4EKW A;  5BR8 B;  4UCR A;  2WPD G;  3N27 A;  2GBO A;  4LWS A;  2YUA A;  4RUE A;  4Z2W A;  4I5S A;  5IJ9 B;  1UPG A;  1GM7 A;  3A8T A;  3E35 A;  2VQF B;  5H9C A;  3IGA C;  2QTO A;  1VQK V;  1JCH A;  2XAG A;  2JGD B;  4X1I A;  5B1A C;  1WPX A;  2KSD A;  4FMT A;  5E1A C;  2XND G;  2PF4 E;  1F23 A;  1CEZ A;  1SQQ H;  3FB7 C;  3QNE A;  1HNZ O;  2CTQ A;  1AI4 A;  2X6B A;  2WLL A;  3STZ C;  2QM4 A;  4DO2 A;  2F4V B;  1CPY A;  2E74 B;  4QJF B;  1SET A;  1WA8 B;  3OUF A;  4MS2 A;  4MSW C;  1Y76 B;  2JEX A;  1FFT B;  1V9P A;  2B9Z A;  4RAI A;  2LQT A;  4FLT A;  2ZIO A;  4JI5 B;  3RVZ A;  4DV0 O;  2K1E A;  5F2V O;  4PA3 A;  2ILM A;  4TV9 A;  2YIA A;  3OAA G;  2V1D A;  3ZRW B;  4BR6 A;  4DV7 B;  3S3W A;  4Z1M G;  1WAZ A;  3OTO B;  2UXB O;  1OCZ B;  4HBN A;  4G27 B;  3P3N A;  1VQO V;  1J95 A;  2ZNI A;  1EN4 A;  1NQT A;  1XIL A;  1QLN A;  3JAK B;  4JV5 B;  4YHH B;  4X88 A;  3FAV B;  1B06 A;  1US6 A;  4KXR A;  4BIZ A;  3A0B Z;  2Q9L A;  3ZN0 A;  5CBF A;  3LSS A;  2Y0I A;  1N32 O;  4MVZ A;  4YY3 B;  2ZE5 A;  4QE9 A;  1GN2 A;  4TT3 G;  4B7E A;  4LF5 O;  4F6E A;  1FKA O;  1Y74 A;  3K5M A;  1SQB H;  1IDS A;  3FX7 A;  3JAW B;  1Q3E A;  5BMV A;  1VQN V;  2Y0P A;  1MAB G;  2B1G A;  3ZCC A;  5FLX N;  3ZHT A;  4LF7 B;  1MZE A;  5LGN A;  4Z1V A;  1P4R A;  5EZY A;  2P06 A;  4UVB A;  2F4V O;  1KKD A;  1ZL8 A;  4E2L A;  3W7S A;  2QWO B;  4CH6 A;  3U10 A;  2DMX A;  3H1I H;  4I9Q A;  4J7Z A;  1EZJ A;  4GKJ O;  1NH2 D;  5CA0 B;  1HWY A;  1M90 W;  2A0L A;  4IHJ A;  2QJ1 A;  1XNR O;  3JYC A;  1WN7 A;  3OEE G;  5LA6 A;  2HG5 C;  2KG7 A;  2VRZ A;  3KKY A;  3HKC A;  4X65 O;  2QM7 A;  3QF7 A;  5KLV H;  4DR2 B;  1VMG A;  1PP9 H;  3MDS A;  1TUB B;  4LFB B;  2Y4U A;  1S76 D;  3ETD A;  2P90 A;  4X1K B;  2OIG A;  3P3P A;  4WFF A;  3OEH G;  4O4J A;  4KP4 A;  1KP3 A;  1K5S A;  4X66 B;  4DV2 B;  5HFL A;  1UJW B;  2MW2 B;  3IC9 A;  1K33 A;  1THZ A;  4RUF A;  2P67 A;  1PM9 A;  2ZXW C;  2IJI A;  2Q67 A;  1BCC H;  2ZCE A;  5EC1 C;  1BT8 A;  3AK2 A;  4GLX A;  3L74 H;  2DN9 A;  4DK0 A;  2YIC A;  1AJN A;  1F4M A;  2UUB B;  1GN3 A;  2QKS A;  3C3T A;  3LNN A;  2OT5 A;  4RO2 A;  4GKK B;  5IJ9 A;  1AR4 A;  1NH2 B;  4HZ3 A;  3ZRV A;  3S3X A;  2OCC C;  2UXC O;  1I0H A;  3SYQ A;  4B3T B;  1WP7 A;  2X6C A;  1XHZ A;  1R3I C;  1N33 B;  4U7O A;  4B3S B;  5IY5 C;  2JGD A;  2Y69 C;  4UUJ C;  2XAS A;  2EIN C;  4PDR A;  4JI1 O;  1BS3 A;  5L3B A;  1HR0 B;  5L3F A;  5FNV B;  5KMG A;  3Q4H B;  4EFE A;  4CH3 A;  3K0D A;  1B04 A;  3ABM C;  4Q20 A;  1WA8 A;  3L70 H;  4JYC A;  4OGQ B;  2G38 A;  4DR2 O;  1Y76 A;  3BPZ A;  2UXD O;  1XBL A;  2V4D A;  5D5Q A;  2DYR B;  2ZM6 B;  5C8Y B;  5L3C A;  4PEL A;  2Q73 A;  1X59 A;  3JD3 A;  3H1L H;  1BHA A;  3TXQ A;  4WFH A;  1O9G A;  3L75 H;  4GT1 A;  2YXL A;  3ZRW A;  3HKD A;  4DV2 O;  1YJ9 V;  3I55 V;  4JI0 B;  5KHK A;  4LBE C;  2FML A;  2HKO A;  4ASU G;  5LMU O;  4ICG A;  3RYH B;  1VQ4 V;  3JAS B;  5H5N A;  1H8H G;  2P4K A;  1JQ0 A;  5KUK A;  1N36 O;  2Q0A A;  1SES A;  3E8H A;  2VQE O;  3JAK A;  3AG1 B;  2BSK B;  1LUW A;  1BSM A;  3CME V;  3QTC A;  3ZMS A;  4KHP B;  2Q7E A;  1P7G A;  1IUR A;  2GUZ A;  4JI3 B;  4JI4 B;  2Q4P A;  2JRI A;  5A2Q N;  2UXN A;  3KG2 A;  4AIL C;  1XNQ B;  4DRX B;  3UT5 A;  4DV3 B;  4IT5 A;  4NB5 A;  3B8N A;  5LMN O;  4ZIB A;  2IH3 C;  3JAW A;  2YI9 A;  2WA4 A;  4DV1 B;  3K5N A;  3K06 A;  4H44 B;  1HR0 O;  4R7C A;  3MHS C;  4GCZ A;  4JI8 O;  3N2G B;  2LGQ A;  1YJN V;  3ZMZ A;  3UKM A;  1YSC A;  1XQ8 A;  3BFR A;  5JJJ B;  1VQP V;  4KL1 A;  1JFF B;  4X64 B;  4O4L B;  2WLH A;  4ZI7 B;  4WF9 V;  3SDL A;  4EFB A;  4LFA B;  4PI0 A;  4CS3 A;  5B1A B;  3ZHV A;  2LP7 A;  2IU3 A;  2YID A;  2GHY A;  2XAQ A;  2AHZ A;  3CS5 A;  1IBM B;  4FK5 C;  3T1H B;  2R9A A;  5D5P A;  4DUY B;  3B2E E;  1MZF A;  4NXM B;  2A06 H;  3QO8 A;  4H13 B;  5LXT A;  1QLE C;  3ASN C;  1KC8 W;  1V55 C;  1D5A A;  4X1K A;  3K9A A;  4F6R B;  4DR5 O;  2DYS C;  4JI3 O;  3M8A A;  3SPC A;  1S72 V;  3BA8 A;  2X7R B;  2IJK A;  1MMM A;  4OXS A;  4P30 A;  4LWS B;  4X62 B;  4JI6 B;  3ZHQ A;  3ICX A;  1D2D A;  2GDS A;  1EFR G;  1VIB A;  4DR4 B;  4X8A A;  3J80 N;  1P84 F;  3RN4 A;  3ASO C;  3FB8 C;  1LUV A;  4LFC B;  3H01 A;  1KBH A;  1JNB A;  4K35 A;  1FXV A;  2KB1 A;  1VQ7 V;  2WLI B;  3SYC A;  1N34 B;  2ZE8 A;  2ZE7 A;  2DW4 A;  1M57 C;  2WWW A;  4DR3 O;  2R72 A;  2BOC C;  4J41 A;  1PKX A;  4X64 O;  3G4S V;  1BGY H;  3WU2 Z;  2QWP B;  1BHB A;  5FNV A;  4LF9 B;  2L35 A;  3F5T A;  3G67 A;  1MOF A;  4GX2 A;  4NTX A;  4H37 A;  3L73 H;  1XHX A;  4DUY O;  1VF7 A;  1QCE A;  3TXS A;  5C8Y A;  1ROP A;  2Q7G A;  1PV0 A;  1YCI A;  3T1Y O;  3SPJ A;  5FPO A;  4PDV A;  4FLY A;  1FPO A;  3CCQ V;  2ZR3 A;  1P49 A;  4DUZ B;  1HP8 A;  4JTA B;  1LR1 A;  3CD6 V;  5KUM A;  3T1C A;  2D2C B;  3D36 C;  3JAS A;  3RWR D;  2Q8V A;  1OCO C;  1TGO A;  3LSQ A;  2BSK A;  1SER A;  5CBH A;  1SA0 A;  3B40 A;  2YEV B;  4JI2 B;  1SQV H;  5BMV B;  1JX9 A;  4Q6G A;  1R6K A;  1VP7 A;  1N34 O;  1W0K G;  1G1X B;  2JS3 A;  4DRX A;  2R9R B;  1B6Q A;  3OR6 C;  4FIP C; 
#chains in the Genus database with same CATH homology
 1QNM A;  1LUW A;  1BSM A;  2AW9 A;  1Y67 A;  3RN4 A;  4BR6 A;  1P7G A;  2QKC A;  1VEW A;  4JYY A;  4YIP A;  4YIO A;  1LUV A;  3IC9 A;  1PM9 A;  3QVN A;  1BT8 A;  3DC6 A;  2QKA A;  3AK2 A;  1EN4 A;  1XRE A;  1XIL A;  3CEI A;  1SZX A;  4GUN A;  3DC5 A;  1B06 A;  3AK3 A;  1ZSP A;  1XUQ A;  1JA8 A;  1GN3 A;  1GN4 A;  3C3T A;  3OT7 A;  3KDR A;  1N0N A;  1AR4 A;  1GN2 A;  1GN6 A;  3TJT A;  2CE4 A;  1I0H A;  5A9G A;  4X9Q A;  1IX9 A;  4F6E A;  3BFR A;  1IDS A;  1MNG A;  3LSU A;  4C7U A;  1BS3 A;  2ADP A;  1IXB A;  1XDC A;  1ZLZ A;  4JZG A;  1ZUQ A;  1PL4 A;  1MSD A;  3K9S A;  1AR5 A;  1D5N A;  2CDY A;  1AP5 A;  1KKC A;  2ADQ B;  1WB7 A;  1AVM A;  5AG2 A;  1WB8 A;  3EVK A;  1EN5 A;  3KKY A;  1EN6 A;  1JR9 A;  1EM1 A;  1N0J A;  1ZTE A;  1AP6 A;  1MMM A;  4JZ2 A;  4FFK A;  1VAR A;  3MDS A;  2P4K A;  3AK1 A;  2GDS A;  2RCV A;  1MA1 A;  3C3S A;  1I08 A;  4E4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...