3OT7A

Escherichia coli apo-manganese superoxide dismutase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
publication title Subunit dissociation and metal binding by Escherichia coli apo-manganese superoxide dismutase.
pubmed doi rcsb
source organism Escherichia coli
total genus 73
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ot7A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ot7A02
1GN2A 1GN4A 1AP5A 1VEWA 4E4EA 1IXBA 3MDSA 3AK2A 1Y67A 1ZLZA 3IC9A 1IX9A 3CEIA 3C3SA 4JYYA 5AG2A 4YIPA 1N0NA 2CE4A 1GN6A 2CDYA 4X9QA 1XDCA 1WB8A 1EN6A 1JA8A 4JZGA 1PL4A 1MA1A 1ZUQA 1XUQA 1SZXA 4YIOA 1BS3A 4JZ2A 2ADPA 1EM1A 1EN5A 4GUNA 2P4KA 1AP6A 1GN3A 3DC6A 1BT8A 1I08A 3KKYA 4F6EA 1JR9A 1I0HA 4C7UA 1QNMA 1PM9A 1ZTEA 2QKCA 1MNGA 3QVNA 1VARA 4FFKA 3OT7A 1LUVA 1LUWA 1MMMA 1AR4A 3RN4A 3LSUA 1XILA 2AW9A 1AVMA 1XREA 3AK3A 4BR6A 1B06A 3TJTA 1KKCA 1IDSA 2ADQB 3BFRA 2GDSA 1AR5A 2RCVA 1MSDA 1BSMA 1P7GA 5A9GA 1D5NA 3DC5A 3EVKA 3C3TA 3K9SA 1ZSPA 3AK1A 1WB7A 1N0JA 2QKAA 1EN4A
chains in the Genus database with same CATH superfamily
1Y76B 1YVWA 4O4IA 4TUYB 4DUYB 3I5DA 1XHXA 2BSKB 1KQSU 5JCOC 1Y67A 3DGEA 2UUCO 2Q0OC 3ABKB 5EBLC 3E8HA 3KDRA 4DR7B 1XNRO 4MVQA 1ZX3A 2F93B 3QNEA 2IJIA 2RDCA 2UUAB 2WLKA 4WF9V 2F95B 5KHIA 2YI8A 2OCHA 3OGIB 4LBEC 4AILC 5KMGA 3VQYA 4LF8B 5LMUB 1BE3H 3ABLB 1Q3EA 4YIOA 3KCYA 4EFEA 4LF5B 5GONB 3K0GA 2CUGA 2ZM6O 2Y4UA 5LA6A 4JI3B 1BQZA 4GUNA 3HKBB 1L0NH 4YXWG 1AP6A 2HFEC 2HKOA 3LNMB 4K0KO 1FAFA 3R66A 2EILB 2CGOA 2IW5A 1H2NA 4X8AA 1GM7A 5L3FA 3W7WA 3APQA 1MZEA 2XAHA 3JAWA 4UCVA 1M56B 1VARA 4LR3A 4CH4A 4YY3B 3CCRV 2V1DA 2ZXWB 5KA5A 2RQ6A 2WWWA 3UO2A 2P22C 4CC5A 3H1IH 2LGQA 3CCMV 4X88A 3X2QC 4CC6A 4WCEV 3B8MA 2JDIG 2BE3A 4LH6A 1FD9A 4FJCC 3WFVA 2LGWA 3OTOO 1B3QA 4GKKO 5K1XA 3J81N 3BAAA 4QGPA 2ODMA 1G4YB 4MTXA 2Q7EA 2F4VB 3C3TA 1QVFU 1SQQH 4IIJB 1SQVH 2XAJA 1D5AA 2Y69B 3OUSA 2E3CA 2QM8A 2OIGA 3RBZA 1FXKA 1Q7YW 3MDSA 3OUFA 4B3MO 3H9VA 2Q6AA 5B1NA 1XMQB 2JK5C 2ITDC 4MTGA 3F7YC 2FMLA 4GX0A 4FIPC 1N36O 1EZVH 2CE4A 1W0JG 3WB0A 2QTSA 5IJ0A 1FJGB 3H1KH 1Z5WA 5H2FZ 4YJ3A 3B8NA 3HKEA 2K9PA 1YJWV 3SJBC 3T1HO 4DR4B 2F1MA 4I4TA 1PNKA 1WLEA 5L3EA 1R6NA 3RWRD 2HEPA 4X89A 4B3SO 3E22A 1U96A 4NXNO 4DR1O 1F51A 3A0RA 4JI0O 3RYFB 2IU0A 2Q8VA 4FM2A 5C93A 1K97A 4DR3O 3SYAA 1K3EA 1Y74A 1YHQV 5H5NA 3OT7A 2QWQB 5IJ9B 3OD4A 5LOVA 2BTQA 1XNRB 4UB6Z 4WFHA 3CSXA 3ZMVA 2UXCO 1URFA 2X7RB 4H44B 4TOIA 4CZZA 1V9PA 2GHYA 3ETEA 1GM8A 4J80A 1D5NA 2F43G 4JI7B 3P32A 2LW1A 5KA6A 1S0VA 3DXRB 4MVMA 1VQKV 1TA8A 5EZYB 3JD0A 4PA7A 2OTLV 5DEDA 4K0KB 2ETNA 1N0JA 2C2AA 5LBQA 1GN2A 4YJ2A 1VEWA 4FLVA 5IE9A 2DYSB 4PA4A 1SERA 1H5WA 3C3SA 3WU2Z 2Q73A 4GCZA 4D7TA 1R3LC 4LF7O 3CC2V 5JH7B 1NVPB 1G8MA 2QA4V 1PPJH 3ABUA 3U11A 3IC7A 3MHSC 1VMGA 2P06A 4HNAA 4FLXA 2P5OA 2H3OA 1MSWD 1GAXA 5KAFZ 3RYHB 4O4JB 3J80N 5JJJB 3OTOB 2ZE6A 4KFMA 1RFYA 4LF6O 2JEXA 5KHHA 1QU7A 1E79G 2QWOB 4I50A 4YHHO 3KZIZ 4G27B 1Q6IA 3UT5B 4MT8A 2GUZB 3CCUV 1CEZA 4LP8A 3IAYA 3ZEDA 2P7TC 5CB4B 5H9CA 4ZBMA 1R3IC 1NU1H 3ABLC 3U10A 5IDJA 4DV5O 5FNVA 5CBFA 4KUMA 4JI5B 4UCOA 1N34O 1NH2D 1AI5A 5B1AB 2Q4PA 2EILC 4U3JB 3RVYA 3CC4V 1M57B 1ROPA 5LXTA 2B5UA 2NNUA 4ZOLB 3D36C 3OAAG 5ITZA 4XDJA 4NKGB 2YDEA 2ZXWC 2VWJA 3T1YO 1F4MA 1RPOA 2M7WA 2X6AA 1S5LZ 4LFAO 1GK9A 3EVKA 4LFBO 1JPXA 2IBZH 1NZ6A 4J42A 3M7MX 3Q4HB 5FL7G 2EULA 2CTWA 2JRIA 4B3SB 4K8ZA 2HVJC 3HKDB 1R3JC 4O4HA 1AP5A 1KP2A 3ZHRA 1Q81W 2JGDA 3CEIA 3ZCCA 3BA8A 1L1FA 2VQEB 2XAQA 2ZIMA 5AG2A 2BTOA 2UXXA 1H2KA 1VQ9V 3ZBHA 4PDVA 2VRZA 3FX7A 3CCSV 4AQYO 1IZ3A 3ASOC 1YTFB 3QO5A 1OZ0A 2AHYA 3OMNB 2ZR3A 2OT5A 4LCUC 4X62O 2PUSA 3CXHF 4DYLA 2EJ7A 1H2MA 3ZHQA 3STLC 3UCSC 2NN4A 4MW3A 2XASA 1H2LA 3K57A 2DWDC 3OMAB 4HAMA 1LUWA 4DR2B 1AR4A 2D3OW 4OX9O 3B2EE 3H1JH 4QIWF 4MS2A 1QR9A 3CB2A 3P3PA 3JCZA 3TJTA 2ZDIA 1ZWIC 2Y48A 4A5UB 1AJQA 3X2QB 3E83A 4AI8A 5J2TA 3QO7A 4E2LA 1ZL8B 5HFLA 4PDRA 4GX5A 3L70H 4UXNA 1YSCA 2OWOA 1THZA 4MVRA 4UFZA 4F6RB 4NVPA 4FFBB 4LF6B 4ASUG 1GMGA 4D6TH 5IYZB 3RW0A 1W0KG 1JFFA 3SPHA 2E5LO 4YHHB 1K9MW 3ICXA 2PZSA 5BR8O 1HNZO 4KHPB 1WB7A 4OPHA 1IBKO 1TUEB 3HPLC 3CCEV 3TXSA 4WFFA 3JSLA 4GLXA 4JAUA 4X1KB 1VQNV 1FXKC 4N21A 4J7ZA 1TUBA 1J5EB 3ABMC 3SJAC 1R3KC 2QSAA 3CRRA 4R8CA 4QPKA 2Q7GA 2CTRA 4X20A 1EN6A 3ZMUA 3SJQC 1V54C 4UV9A 4BAYA 1BS3A 5L3DA 3RYCB 4TV9B 3F5WC 4DV4B 4LFCB 5L3BA 4JV5O 3EFFK 4LFBB 1PKXA 4KXRA 4P2ZA 1IBLO 1SQBH 4O2BB 2W6JG 5LHIA 4LWSA 4DR5O 1JQ0A 1NR1A 5IWAB 1QNMA 4GKJO 3FYIB 5BXZA 4WFGA 4EKWA 1AI7A 4IYIA 2ARHA 4PHZA 4B3TO 4UCTA 3U0ZA 1Y76A 3BVOA 5CA1A 3H1HH 1N32O 3ZMZA 4TUYA 4UVCA 3G6EV 1KB9F 1PV0A 3CP1A 1HNWB 2UUBB 2R9IA 4PDLA 1SS3A 4R50A 1P84F 1AR5A 1AI6A 5GW7A 2ZINA 3MHHC 1QQCA 2GV9A 2YXHA 4BIZA 3CCVV 1M93A 2VQFO 2V4DA 3EHBB 3PN1A 4ZHQB 3K08A 1IXMA 4L8JA 4FLWA 3DSQA 3JAKB 3AEIA 3CPWU 3SJCC 4JI1O 4FZ0A 1EN4A 3C90A 4JASA 4OPAA 2YEVB 3ZHSA 5DM6V 2Q0AA 1NTZH 2CAZC 4I55A 5KHKA 1ZLZA 3IC9A 1A32A 5JVDB 1GO3F 3I56V 3K5OA 4IHJA 4B3RO 5L3GA 1TVKA 1B6QA 5TISZ 4DV0O 2OCCC 4X64O 3JATB 4X9QA 1BGYH 5IYBO 3W7XA 4OXSA 3N2GB 1CPYA 2YS8A 2DQ0A 2QE7G 1WN7A 5E79Z 1SRYA 1Q82W 3LDCA 2B1IA 1KC8W 1XNQB 1H8HG 2UXBB 1Q90D 2E5LB 2OTJV 1B04A 3SYQA 4HYOA 5EBWC 2E74B 3SPIA 1IBKB 2LP7A 1I0HA 5LP6B 2WA3A 1Q5OA 3FD9A 2L35A 1Y4MA 4UCSA 5HFMA 3QVNA 3HB3B 4NXMB 4RUFA 3N2KB 1KUQA 3QTCA 1XL4A 4J7KA 4PELA 1K33A 2JJ1G 2PI4A 1SA0B 2A7WA 1UFIA 1Q43A 4LH7A 4GX1A 5L3CA 5BMVA 3CJHB 3VOUA 2OIEA 1VQPV 1W2BU 1K73W 4JI4B 4PDMA 3DC5A 1G6UA 4JGSA 1XOUA 3G71V 4KP4A 4JI2O 4TQDA 1JX9A 2R9RB 1NBMG 3FB8C 1GKFA 3K3WA 4DO2A 2QKAA 3IJ4A 3G80A 5LMNO 3BCCH 1WP7A 4DRXB 3K03A 1NVPD 2KKWA 5EK0A 3K06A 2W0XA 4X1IB 1XMOO 1YITV 1IBMB 1Y6XA 5EYPB 4XDKA 3DTUB 1AJNA 3RYFA 3BHPA 1E1RG 3CWBH 4RQFA 4I0XB 4UUJC 1NTKH 3OR6C 3ASOB 4RUEA 5BY1A 5H6QA 5J2UB 2FB5A 3CCQV 1R6TA 3LSSA 4DW1A 1MA1A 1DLBA 1SZTA 2WLLA 5KMGB 1I94O 3K04A 1ORQC 1RSOB 4DK1A 4O2AA 3D3IA 3JYCA 1GH6A 2R72A 2DWEC 4IT5A 1K5QA 5LA6B 2HHHB 2D2CB 3AG3C 4MTOA 2CH7A 3RYIA 1AR1B 4J41A 4DV2O 3SDLA 3S3XA 1S76D 2EIMB 1SQPH 3JAWB 4DV0B 1AROP 4P9OA 3FB6C 4WFAV 1B06A 3M8AA 5CBGA 2XOKG 1SQGA 1FKAO 3MAQA 2Z3YA 3JD4A 4FMTA 4TV8A 5D5PA 1NKDA 4AHCA 4I7ZB 5JH7A 3RVZA 2UUCB 1S5JA 5B1OA 1XL6A 2NLJC 5EC2C 3W7UA 5H6RA 3ZRXA 5JQGB 3K9SA 3RYHA 4J9ZB 4CS4A 4LF4O 2B9ZA 2YIAA 1E1QG 4KL1A 4DV7O 4O4JA 3GB7C 1V55C 1FFXB 3VBBA 5CA0B 2QKSA 2ZT9B 3E86A 3NXSA 2EX3A 3ZN0A 2PI5A 4PI2A 3UT5A 1YTFD 1FXKB 2GUZA 2A3QA 2ZM6B 1HR0O 3ABMB 4G28B 1K4CC 1GN6A 4I5SA 2DW4A 4Q20A 1WNSA 5IYDO 3A0HZ 5J9PC 2F23A 5B3SC 3FAVB 4MSWC 3SPGA 4YJ3B 3HKEB 4JI6O 1V54B 3E2EA 4LC1A 2YI9A 1L8DA 3T4ZA 1H8EG 1LR1A 2EZPA 1EFRG 1O9GA 4JI2B 2GSMB 2P4KA 4ZOLA 1HNXO 2XTAA 3G4SV 2QJ1A 5LMNB 3W7SA 3ZMSA 4WFBV 1W59A 1YJNV 2EINC 2WPDG 2WAMA 1VQLV 2YC0A 2ZCEA 4RWUA 4GKKB 2FYUH 3OEEG 1Y74B 4RQEA 3CD6V 2DMXA 3VQVA 5LOVB 2LFSA 2BTQB 1N8RW 1K4DC 1WA8B 5CMUA 3ABTA 4O4LB 5JCOA 5LP6C 1IVSA 2H8PC 3QF7A 2YUAA 4DUZO 3FB5C 4DV3O 3E35A 4DR6O 1YZBA 1WAZA 1YI2V 4B3MB 1S77D 4OGQB 1XQ8A 1VQMV 3BA9A 3K5NA 2X0LA 1N36B 4X66O 4ICGA 4G2KA 3CRAA 4Q6GA 4LF9O 2M6YA 5BZBA 4FLTA 3UM7A 3ML0A 3L75H 3E8BA 3A0BZ 2XHBA 4H0LB 1ZAUA 5KX5A 2LFRA 3UQ8A 4YJ2B 4FVMA 1KP3A 3JAMN 3T1HB 1JJ2U 4I9WA 1GTOA 1N0NA 3A8TA 2RJZA 1MG1A 1FPOA 3JALA 3HKCB 1DF4A 1XI1A 2JEUA 1JOYA 2OCCB 2EZOA 2UU9O 2GTAA 3J7AU 3K0DA 4NXNB 4DR1B 5KUKA 1AILA 4JI0B 4DR3B 4HNAB 3RGBA 4K8XA 3S3WA 4XBFA 2DN9A 4MTFA 3STZC 1QLNA 5B5EZ 1PL0A 2AZ2A 4FPPA 1BHAA 3JD1A 1G1XB 2QWRB 2UXCB 2KB1A 1I5YA 2FL4A 2YSUB 3E89A 4F6RA 2HR3A 3G67A 3OR7C 4J11A 4FFBA 2EIKC 4FLZA 1DTOA 5KAIZ 1KD1W 1PM9A 2JGUA 1RM1C 1VIBA 1HR0B 5IY5C 1J95A 4QNHB 2Q7HA 3ZJZA 2BOBC 4NTYA 3P30A 5LXTB 5JWPA 2YIBD 2DQ3A 4P30A 2X6BA 2P4VA 2EIMC 1VQ7V 1VF6A 4TQFA 3F5TA 4N23A 3IGAC 5ITZB 4LF7B 1JNBA 4X65O 1I7FA 4B08A 3AK1A 1YEWA 4UCRA 3K79A 2ZNJA 3LDDA 2UXDO 1F23A 4ZI7B 2F66C 3BABA 3UO3A 2IJKA 3ZRSA 3RYCA 4XDLA 5FPRA 4TV9A 1IXBA 2N05A 2ATKC 2WLIA 3JASB 3L72H 3ETQA 4O4HB 4EEQA 3CYOA 1HP8A 2JGDB 1N33O 3SPCA 1HWYA 5LL6Y 3BY6A 3B40A 2CDYA 3GWOA 1WPBA 4CS2A 5DN6G 3IFXA 4DUZB 1GRJA 1ZUQA 4DR7O 2JS5A 2XUMA 3CX5F 4R7CA 4DV5B 4DXWA 4PV1B 1NR7A 2UUAO 1FFTB 4TWKA 3ASNC 2WLNA 2G38A 1YJ9V 1N34B 4EB6B 3W7TA 4LF9B 3B77A 1VQ4V 2EBOA 4LF8O 3AG3B 1JCHA 4JYCA 3E8FA 3D8CA 4ZHQA 4ZKIA 3OMIB 3I55V 2MW2B 4LF5O 1MNGA 1MMMA 2ZE7A 3CE2A 3JARA 4JI3O 1OJHA 1S5HC 4HZ3A 3T1YB 1BQ0A 4NR1A 4LFAB 2YEVA 4WBNA 4JYAO 1P49A 3SYPA 3KG2A 4TT3G 2XNDG 3RFRA 2ADQB 2JVDA 1OCRC 4J7JA 5LYJB 1BSMA 3BEHA 2ZIOA 5J2TB 4YY3O 3JATA 4DK0A 1AB3A 1RPRA 4JTDB 1KKDA 3F7VC 1ZSPA 3OTFA 4L87A 2BSKA 4AQYB 3K5MA 1O9HA 4MVZA 1D2DA 1V55B 3G6BA 4JTAB 2Q69A 3K9AA 4GX2A 1Z5VA 1MZFA 4X1YB 2EJRA 3AK2A 2LW7A 2AHZA 2IM9A 4X62B 3ZX6A 1R1BA 2YICA 2F4VO 4JYYA 2RNBA 1NS1A 4ABMA 1TUBB 4PA6A 2MK3A 1SESA 3N2KA 1K92A 2AXTZ 5GONA 4U3FH 2Q67A 2KG7B 2ZE8A 1SA0A 5B3SB 1XMQO 4JYBA 1RP3B 2KSDA 4MW8A 3HKBA 3SGIA 3OW2U 3OGCC 3APOA 2QTOA 5K1PA 4OX9B 4JAAA 4B7EA 1EN5A 4X65B 4NB5A 1JMKC 4FLYA 1FJGO 3CJHA 3N27A 2UXDB 4F6EA 4W4KA 3LNNA 2X6CA 3D36A 2BCCH 3ZMTA 4C7UA 1SF9A 2R70A 1R6KA 2EINB 1ZTEA 3ZHTA 5B1BC 1LUVA 1P4RA 3GWKC 4BWAA 3RT3C 1K34A 4WFEA 3LSUA 1XILA 4R6ZA 4BR6A 1QHTA 4H13B 5BR8B 1HNZB 4IGGA 4X1IA 2ITCC 2N74A 5CA1B 2YIDA 4FK5C 2Y0IA 3K5LA 3AG2C 5EYPA 5LHHA 4HBNA 4IIJA 4UVBA 4I0XA 4LNUB 5J2UA 3CRMA 1NQTA 2IU3A 2QM4A 5B66Z 2A06H 4FM1A 1PD3A 1OCOB 2UXNA 4PA3A 3CXCU 1RSOA 2LJ2A 4JI7O 3R65A 1IX9A 1M9NA 1JVMA 5KHGA 1CXZB 3ZRWB 4I55B 4K3AA 5C8YB 4IHJB 4JV5B 4JYAB 4TSFG 1T5EA 1TVKB 1IBLB 1KECA 3VQXA 1X4TA 4DR5B 2Q5ZA 3T4DA 4GKJB 3M99B 3L71H 3AG4C 5GTIZ 4O4IB 1VQ5V 3FYEB 3KCXA 2OYQA 1BL8A 1BHBA 3LDEA 3TGUH 4U7OA 4B3TB 2FKXA 1FXVA 5CBHA 1N32B 1SQXH 3JCUZ 1I08A 4QPJA 1IURA 5IJ9A 3QO8A 2IJHA 1DGSA 2EIKB 1NT2B 1H2GA 1YCIA 1Z2GA 5IYCO 3O9OA 2P90A 3LUTB 5JQGA 1RM1B 1FOUA 1PNLA 1CP9A 2VQFB 4DV6O 1FFXA 3TXQA 3TCUA 4J9YB 1AVMA 2HP8A 5CA0A 5LHGA 2A79B 5IY5B 4JI1B 1IDSA 3A2FA 3FKSG 2GDSA 2WLJA 3BPZA 4UV8A 3DXRA 2ZR2A 5EZYA 3FB7C 5BMVB 4JI5O 4B3RB 1M4UA 5EIBC 2EIJC 5EC1C 3CC7V 3L9DA 1HDJA 3H1LH 1VF6C 1LNQA 3FAVA 3ETDA 2XAFA 4X64B 1GN4A 2ZDIC 2DYRB 5LGNA 3ZHVA 3OE7G 4UB8Z 4QJFB 1H2SB 3WB2A 1VQ6V 1TGOA 3CMAV 1WJZA 2ZE5A 3LSQA 3O65A 4YIPA 2Z5UA 4JTCB 1XBLA 4UCUA 4GT1A 1F7YA 4NTXA 1UJWB 5EBMC 5FPOA 3EXAA 3ZHUA 1X59A 4GZRB 1PL4A 2VQEO 1I5XA 1WA8A 3L73H 2QM7A 1OCCB 3WG7C 4O4LA 1EM1A 5CB4A 4RO2A 2WLLB 3K58A 3ASNB 2QWNB 2VS0A 2HVKC 4O2AB 2XT9A 2DE0X 1VQOV 1JR9A 4D7SA 1AI4A 4JAVA 3T2MA 1N4CA 5IJ0B 1M1KW 2CH7B 3RYIB 3UKMA 4U3JA 4FM0A 1QLEC 5KLVH 5LGUA 4DV1O 2WLHA 3AK3A 5CA3A 1Q6UA 4FZ1A 3B4SA 2ZQMA 1YIJV 1XHZA 2QEXV 2CK3G 1GM9A 4I4TB 1BCCH 1MABG 1XEQA 4RAIA 1Q86W 3NR7A 3E22B 1OCRB 5A9GA 4TV8B 4DR2O 1XMOB 3HKCA 2E75B 3P3NA 3Q4HA 1KBHA 2WLMA 4ZIBA 5LGTA 3AG1C 3HKDA 2L6LA 2JJ2G 2R9AA 2NR5A 3ZRVA 1KYOF 4E4EA 2IJJA 1VF7A 4F4LA 3FFQA 4IYHA 2DOSA 3ABKC 3T1CA 5A2QN 4BIOA 1M5IA 1QR8A 1I94B 4DV6B 1DK1A 4KHPO 2V7QG 3ETGA 4Z1VA 2PYLA 1QVGU 1OCOC 1XDCA 1S3JA 3PJSK 1WB8A 1JA8A 1AJPA 4DV2B 4K35A 1SZXA 3THOA 2O57A 3VQWA 1J5EO 1FXHA 4NTWA 4H33A 5KUMA 1GN3A 4W4LA 3KKYA 1Q6HA 1U97A 5EIBD 1OCZB 3ZN1A 1M56C 2QKCA 2VWKA 4FLUA 2RMKB 5B1BB 4DV4O 4LFCO 2IH1C 4PA9A 3CCJV 1K5SA 4ZI7A 3SPJA 1P7BA 2AW9A 4J10A 1SETA 2WSSG 3H01A 1ZL8A 4I50B 4LF4B 4DV7B 3JASA 5IWAO 2HG5C 2Q68A 2WA4A 3BFRA 1SC5B 4UVAA 1MSDA 5IYZA 4IL6Z 1QCEA 4CBCA 3AG2B 3CMEV 4MVUA 4JF3A 4QE9A 2PTMA 4JI8O 3E8GA 5FNVB 2Y69C 1HNWO 2UUBO 1NI8A 2BOCC 4MVSA 4X1KA 2PGGA 1H38A 1FS0G 2LO1A 2JS3A 1JJOA 4CH3A 3QG5A 5F2VO 1YDXA 2W6IG 3HR0A 4EB6A 5KX5B 4JI6B 2HJFC 1EBOA 2P67A 1FYJA 3BRCA 3CS5A 4DV1B 1BMFG 3OFNG 1UPGA 2CGNA 1TAEA 2PF4E 1HNXB 2PY5A 1K8AW 2Y0PA 1R73A 3JALB 3MD0A 2DYRC 5JJEB 4JZGA 2ZNIA 1XUQA 4H37A 2XAGA 3CRQA 4JZ2A 3AG4B 4CH5A 2ADPA 4O2BA 2QGNA 1YXBA 1F4NA 2Z0AA 2GBOA 3DC6A 5LYJA 1WPXA 1KU9A 4JPRA 4B7KA 3K59A 4I9QA 1IJGA 4DUYO 1Q8IA 5FLXN 4BW5A 2B1GA 4CH6A 3CHXA 2AZ0A 1PNMA 4DV3B 5D5QA 4DR6B 5KHJA 1OCCC 1XNQO 4NYKA 2UXBO 1ENVA 2Q9LA 2A9HA 2CTQA 3WB1A 4X66B 1QBZA 4X1YA 1KKCA 1HW7A 1PP9H 4U7NA 1NH2B 5LMUO 4BIUA 2RCVA 4EFBA 4NXMO 2Y4TA 2RN9A 5DECA 3JAKA 4P9PA 2YIBA 4Z2WA 1L0LH 2A0LA 4MVOA 2EIJB 2FTKA 2KG7A 3OEHG 5JJNB 1SKVA 3B09A 2UU9B 5JVDA 1VF5B 1VQ8V 2PYJA 2DYSC 1NJIW 1WP8A 1K7DA 4JI4O 3CCLV 2YXLA 3TK1A 1Y66A 2DJVA 2WLIB 2W0FC 3N2GA 4PJ0Z 1JFFB 3SYCA 2KQXA 3AG7A 1M90W 3GVMA 3JD3A 4Z1MG 1IBMO 2K1EA 4GYCB 4QE7A 5GTHZ 4JI8B 1COWG 2GTSA 2P6JA 2E76B 3WG7B 2IH3C 5LP6A 1BT8A 2JIZG 4DW0A 2QWPB 1MOFA 4BW9A 5IT9N 5E1AC 4CS3A 4PD4F 1OV9A 2N04A 4LNUA 3L74H 3TETA 1SQFA 4FFKA 1BZKA 4X20B 2QDOA 3JSNA 1NTMH 2QR4A 5B1AC 3RN4A 2LQTA 1QLEB 1M57C 1XREA 3JARB 2HHHO 2ZD9A 3OM3B 2HLDG 3SR2C 2CTPA 3ZS8C 2HJDA 4WBNB 1S72V 2ZKOA 1OCZC 1YF2A 1OHHG 3ZRWA 1P7GA 5C8YA 4PI0A 4LWSB 2ILMA 3SYOA 3JD2A 4DR4O 1US6A 3ZIAG 1EZJA 1DF5A 3D3QA 1VP7A 5CN0A 2AGAA 1N33B 3CRCA 1KMIZ 2YXYA 4DRXA 2H94A 3AG1B
chains in the Genus database with same CATH topology
1GN2A 1GN4A 1AP5A 1VEWA 4E4EA 1IXBA 3MDSA 3AK2A 1Y67A 1ZLZA 3IC9A 1IX9A 3CEIA 3KDRA 3C3SA 4JYYA 5AG2A 4YIPA 1N0NA 2CE4A 1GN6A 2CDYA 4X9QA 1XDCA 1WB8A 1EN6A 1JA8A 4JZGA 1PL4A 1MA1A 1ZUQA 1XUQA 1SZXA 4YIOA 1BS3A 4JZ2A 2ADPA 1EM1A 1EN5A 4GUNA 2P4KA 1AP6A 1GN3A 3DC6A 1BT8A 1I08A 3KKYA 4F6EA 1JR9A 1I0HA 4C7UA 1QNMA 1PM9A 1ZTEA 2QKCA 1MNGA 3QVNA 1VARA 4FFKA 3OT7A 1LUVA 1LUWA 1MMMA 1AR4A 3RN4A 3LSUA 1XILA 2AW9A 1AVMA 1XREA 3AK3A 4BR6A 1B06A 3TJTA 1KKCA 1IDSA 2ADQB 3BFRA 2GDSA 1AR5A 2RCVA 1MSDA 1BSMA 1P7GA 5A9GA 1D5NA 3DC5A 3EVKA 3C3TA 3K9SA 1ZSPA 3AK1A 1WB7A 1N0JA 2QKAA 1EN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GN2 A;  1GN4 A;  1AP5 A;  1VEW A;  4E4E A;  1IXB A;  3MDS A;  3AK2 A;  1Y67 A;  1ZLZ A;  3IC9 A;  1IX9 A;  3CEI A;  3C3S A;  4JYY A;  5AG2 A;  4YIP A;  1N0N A;  2CE4 A;  1GN6 A;  2CDY A;  4X9Q A;  1XDC A;  1WB8 A;  1EN6 A;  1JA8 A;  4JZG A;  1PL4 A;  1MA1 A;  1ZUQ A;  1XUQ A;  1SZX A;  4YIO A;  1BS3 A;  4JZ2 A;  2ADP A;  1EM1 A;  1EN5 A;  4GUN A;  2P4K A;  1AP6 A;  1GN3 A;  3DC6 A;  1BT8 A;  1I08 A;  3KKY A;  4F6E A;  1JR9 A;  1I0H A;  4C7U A;  1QNM A;  1PM9 A;  1ZTE A;  2QKC A;  1MNG A;  3QVN A;  1VAR A;  4FFK A;  3OT7 A;  1LUV A;  1LUW A;  1MMM A;  1AR4 A;  3RN4 A;  3LSU A;  1XIL A;  2AW9 A;  1AVM A;  1XRE A;  3AK3 A;  4BR6 A;  1B06 A;  3TJT A;  1KKC A;  1IDS A;  2ADQ B;  3BFR A;  2GDS A;  1AR5 A;  2RCV A;  1MSD A;  1BSM A;  1P7G A;  5A9G A;  1D5N A;  3DC5 A;  3EVK A;  3C3T A;  3K9S A;  1ZSP A;  3AK1 A;  1WB7 A;  1N0J A;  2QKA A;  1EN4 A; 
#chains in the Genus database with same CATH topology
 1Y76 B;  1YVW A;  4O4I A;  4TUY B;  4DUY B;  3I5D A;  1XHX A;  2BSK B;  1KQS U;  5JCO C;  1Y67 A;  3DGE A;  2UUC O;  2Q0O C;  3ABK B;  5EBL C;  3E8H A;  3KDR A;  4DR7 B;  1XNR O;  4MVQ A;  1ZX3 A;  2F93 B;  3QNE A;  2IJI A;  2RDC A;  2UUA B;  2WLK A;  4WF9 V;  2F95 B;  5KHI A;  2YI8 A;  2OCH A;  3OGI B;  4LBE C;  4AIL C;  5KMG A;  3VQY A;  4LF8 B;  5LMU B;  1BE3 H;  3ABL B;  1Q3E A;  4YIO A;  3KCY A;  4EFE A;  4LF5 B;  5GON B;  3K0G A;  2CUG A;  2ZM6 O;  2Y4U A;  5LA6 A;  4JI3 B;  1BQZ A;  4GUN A;  3HKB B;  1L0N H;  4YXW G;  1AP6 A;  2HFE C;  2HKO A;  3LNM B;  4K0K O;  1FAF A;  3R66 A;  2EIL B;  2CGO A;  2IW5 A;  1H2N A;  4X8A A;  1GM7 A;  5L3F A;  3W7W A;  3APQ A;  1MZE A;  2XAH A;  3JAW A;  4UCV A;  1M56 B;  1VAR A;  4LR3 A;  4CH4 A;  4YY3 B;  3CCR V;  2V1D A;  2ZXW B;  5KA5 A;  2RQ6 A;  2WWW A;  3UO2 A;  2P22 C;  4CC5 A;  3H1I H;  2LGQ A;  3CCM V;  4X88 A;  3X2Q C;  4CC6 A;  4WCE V;  3B8M A;  2JDI G;  2BE3 A;  4LH6 A;  1FD9 A;  4FJC C;  3WFV A;  2LGW A;  3OTO O;  1B3Q A;  4GKK O;  5K1X A;  3J81 N;  3BAA A;  4QGP A;  2ODM A;  1G4Y B;  4MTX A;  2Q7E A;  2F4V B;  3C3T A;  1QVF U;  1SQQ H;  4IIJ B;  1SQV H;  2XAJ A;  1D5A A;  2Y69 B;  3OUS A;  2E3C A;  2QM8 A;  2OIG A;  3RBZ A;  1FXK A;  1Q7Y W;  3MDS A;  3OUF A;  4B3M O;  3H9V A;  2Q6A A;  5B1N A;  1XMQ B;  2JK5 C;  2ITD C;  4MTG A;  3F7Y C;  2FML A;  4GX0 A;  4FIP C;  1N36 O;  1EZV H;  2CE4 A;  1W0J G;  3WB0 A;  2QTS A;  5IJ0 A;  1FJG B;  3H1K H;  1Z5W A;  5H2F Z;  4YJ3 A;  3B8N A;  3HKE A;  2K9P A;  1YJW V;  3SJB C;  3T1H O;  4DR4 B;  2F1M A;  4I4T A;  1PNK A;  1WLE A;  5L3E A;  1R6N A;  3RWR D;  2HEP A;  4X89 A;  4B3S O;  3E22 A;  1U96 A;  4NXN O;  4DR1 O;  1F51 A;  3A0R A;  4JI0 O;  3RYF B;  2IU0 A;  2Q8V A;  4FM2 A;  5C93 A;  1K97 A;  4DR3 O;  3SYA A;  1K3E A;  1Y74 A;  1YHQ V;  5H5N A;  3OT7 A;  2QWQ B;  5IJ9 B;  3OD4 A;  5LOV A;  2BTQ A;  1XNR B;  4UB6 Z;  4WFH A;  3CSX A;  3ZMV A;  2UXC O;  1URF A;  2X7R B;  4H44 B;  4TOI A;  4CZZ A;  1V9P A;  2GHY A;  3ETE A;  1GM8 A;  4J80 A;  1D5N A;  2F43 G;  4JI7 B;  3P32 A;  2LW1 A;  5KA6 A;  1S0V A;  3DXR B;  4MVM A;  1VQK V;  1TA8 A;  5EZY B;  3JD0 A;  4PA7 A;  2OTL V;  5DED A;  4K0K B;  2ETN A;  1N0J A;  2C2A A;  5LBQ A;  1GN2 A;  4YJ2 A;  1VEW A;  4FLV A;  5IE9 A;  2DYS B;  4PA4 A;  1SER A;  1H5W A;  3C3S A;  3WU2 Z;  2Q73 A;  4GCZ A;  4D7T A;  1R3L C;  4LF7 O;  3CC2 V;  5JH7 B;  1NVP B;  1G8M A;  2QA4 V;  1PPJ H;  3ABU A;  3U11 A;  3IC7 A;  3MHS C;  1VMG A;  2P06 A;  4HNA A;  4FLX A;  2P5O A;  2H3O A;  1MSW D;  1GAX A;  5KAF Z;  3RYH B;  4O4J B;  3J80 N;  5JJJ B;  3OTO B;  2ZE6 A;  4KFM A;  1RFY A;  4LF6 O;  2JEX A;  5KHH A;  1QU7 A;  1E79 G;  2QWO B;  4I50 A;  4YHH O;  3KZI Z;  4G27 B;  1Q6I A;  3UT5 B;  4MT8 A;  2GUZ B;  3CCU V;  1CEZ A;  4LP8 A;  3IAY A;  3ZED A;  2P7T C;  5CB4 B;  5H9C A;  4ZBM A;  1R3I C;  1NU1 H;  3ABL C;  3U10 A;  5IDJ A;  4DV5 O;  5FNV A;  5CBF A;  4KUM A;  4JI5 B;  4UCO A;  1N34 O;  1NH2 D;  1AI5 A;  5B1A B;  2Q4P A;  2EIL C;  4U3J B;  3RVY A;  3CC4 V;  1M57 B;  1ROP A;  5LXT A;  2B5U A;  2NNU A;  4ZOL B;  3D36 C;  3OAA G;  5ITZ A;  4XDJ A;  4NKG B;  2YDE A;  2ZXW C;  2VWJ A;  3T1Y O;  1F4M A;  1RPO A;  2M7W A;  2X6A A;  1S5L Z;  4LFA O;  1GK9 A;  3EVK A;  4LFB O;  1JPX A;  2IBZ H;  1NZ6 A;  4J42 A;  3M7M X;  3Q4H B;  5FL7 G;  2EUL A;  2CTW A;  2JRI A;  4B3S B;  4K8Z A;  2HVJ C;  3HKD B;  1R3J C;  4O4H A;  1AP5 A;  1KP2 A;  3ZHR A;  1Q81 W;  2JGD A;  3CEI A;  3ZCC A;  3BA8 A;  1L1F A;  2VQE B;  2XAQ A;  2ZIM A;  5AG2 A;  2BTO A;  2UXX A;  1H2K A;  1VQ9 V;  3ZBH A;  4PDV A;  2VRZ A;  3FX7 A;  3CCS V;  4AQY O;  1IZ3 A;  3ASO C;  1YTF B;  3QO5 A;  1OZ0 A;  2AHY A;  3OMN B;  2ZR3 A;  2OT5 A;  4LCU C;  4X62 O;  2PUS A;  3CXH F;  4DYL A;  2EJ7 A;  1H2M A;  3ZHQ A;  3STL C;  3UCS C;  2NN4 A;  4MW3 A;  2XAS A;  1H2L A;  3K57 A;  2DWD C;  3OMA B;  4HAM A;  1LUW A;  4DR2 B;  1AR4 A;  2D3O W;  4OX9 O;  3B2E E;  3H1J H;  4QIW F;  4MS2 A;  1QR9 A;  3CB2 A;  3P3P A;  3JCZ A;  3TJT A;  2ZDI A;  1ZWI C;  2Y48 A;  4A5U B;  1AJQ A;  3X2Q B;  3E83 A;  4AI8 A;  5J2T A;  3QO7 A;  4E2L A;  1ZL8 B;  5HFL A;  4PDR A;  4GX5 A;  3L70 H;  4UXN A;  1YSC A;  2OWO A;  1THZ A;  4MVR A;  4UFZ A;  4F6R B;  4NVP A;  4FFB B;  4LF6 B;  4ASU G;  1GMG A;  4D6T H;  5IYZ B;  3RW0 A;  1W0K G;  1JFF A;  3SPH A;  2E5L O;  4YHH B;  1K9M W;  3ICX A;  2PZS A;  5BR8 O;  1HNZ O;  4KHP B;  1WB7 A;  4OPH A;  1IBK O;  1TUE B;  3HPL C;  3CCE V;  3TXS A;  4WFF A;  3JSL A;  4GLX A;  4JAU A;  4X1K B;  1VQN V;  1FXK C;  4N21 A;  4J7Z A;  1TUB A;  1J5E B;  3ABM C;  3SJA C;  1R3K C;  2QSA A;  3CRR A;  4R8C A;  4QPK A;  2Q7G A;  2CTR A;  4X20 A;  1EN6 A;  3ZMU A;  3SJQ C;  1V54 C;  4UV9 A;  4BAY A;  1BS3 A;  5L3D A;  3RYC B;  4TV9 B;  3F5W C;  4DV4 B;  4LFC B;  5L3B A;  4JV5 O;  3EFF K;  4LFB B;  1PKX A;  4KXR A;  4P2Z A;  1IBL O;  1SQB H;  4O2B B;  2W6J G;  5LHI A;  4LWS A;  4DR5 O;  1JQ0 A;  1NR1 A;  5IWA B;  1QNM A;  4GKJ O;  3FYI B;  5BXZ A;  4WFG A;  4EKW A;  1AI7 A;  4IYI A;  2ARH A;  4PHZ A;  4B3T O;  4UCT A;  3U0Z A;  1Y76 A;  3BVO A;  5CA1 A;  3H1H H;  1N32 O;  3ZMZ A;  4TUY A;  4UVC A;  3G6E V;  1KB9 F;  1PV0 A;  3CP1 A;  1HNW B;  2UUB B;  2R9I A;  4PDL A;  1SS3 A;  4R50 A;  1P84 F;  1AR5 A;  1AI6 A;  5GW7 A;  2ZIN A;  3MHH C;  1QQC A;  2GV9 A;  2YXH A;  4BIZ A;  3CCV V;  1M93 A;  2VQF O;  2V4D A;  3EHB B;  3PN1 A;  4ZHQ B;  3K08 A;  1IXM A;  4L8J A;  4FLW A;  3DSQ A;  3JAK B;  3AEI A;  3CPW U;  3SJC C;  4JI1 O;  4FZ0 A;  1EN4 A;  3C90 A;  4JAS A;  4OPA A;  2YEV B;  3ZHS A;  5DM6 V;  2Q0A A;  1NTZ H;  2CAZ C;  4I55 A;  5KHK A;  1ZLZ A;  3IC9 A;  1A32 A;  5JVD B;  1GO3 F;  3I56 V;  3K5O A;  4IHJ A;  4B3R O;  5L3G A;  1TVK A;  1B6Q A;  5TIS Z;  4DV0 O;  2OCC C;  4X64 O;  3JAT B;  4X9Q A;  1BGY H;  5IYB O;  3W7X A;  4OXS A;  3N2G B;  1CPY A;  2YS8 A;  2DQ0 A;  2QE7 G;  1WN7 A;  5E79 Z;  1SRY A;  1Q82 W;  3LDC A;  2B1I A;  1KC8 W;  1XNQ B;  1H8H G;  2UXB B;  1Q90 D;  2E5L B;  2OTJ V;  1B04 A;  3SYQ A;  4HYO A;  5EBW C;  2E74 B;  3SPI A;  1IBK B;  2LP7 A;  1I0H A;  5LP6 B;  2WA3 A;  1Q5O A;  3FD9 A;  2L35 A;  1Y4M A;  4UCS A;  5HFM A;  3QVN A;  3HB3 B;  4NXM B;  4RUF A;  3N2K B;  1KUQ A;  3QTC A;  1XL4 A;  4J7K A;  4PEL A;  1K33 A;  2JJ1 G;  2PI4 A;  1SA0 B;  2A7W A;  1UFI A;  1Q43 A;  4LH7 A;  4GX1 A;  5L3C A;  5BMV A;  3CJH B;  3VOU A;  2OIE A;  1VQP V;  1W2B U;  1K73 W;  4JI4 B;  4PDM A;  3DC5 A;  1G6U A;  4JGS A;  1XOU A;  3G71 V;  4KP4 A;  4JI2 O;  4TQD A;  1JX9 A;  2R9R B;  1NBM G;  3FB8 C;  1GKF A;  3K3W A;  4DO2 A;  2QKA A;  3IJ4 A;  3G80 A;  5LMN O;  3BCC H;  1WP7 A;  4DRX B;  3K03 A;  1NVP D;  2KKW A;  5EK0 A;  3K06 A;  2W0X A;  4X1I B;  1XMO O;  1YIT V;  1IBM B;  1Y6X A;  5EYP B;  4XDK A;  3DTU B;  1AJN A;  3RYF A;  3BHP A;  1E1R G;  3CWB H;  4RQF A;  4I0X B;  4UUJ C;  1NTK H;  3OR6 C;  3ASO B;  4RUE A;  5BY1 A;  5H6Q A;  5J2U B;  2FB5 A;  3CCQ V;  1R6T A;  3LSS A;  4DW1 A;  1MA1 A;  1DLB A;  1SZT A;  2WLL A;  5KMG B;  1I94 O;  3K04 A;  1ORQ C;  1RSO B;  4DK1 A;  4O2A A;  3D3I A;  3JYC A;  1GH6 A;  2R72 A;  2DWE C;  4IT5 A;  1K5Q A;  5LA6 B;  2HHH B;  2D2C B;  3AG3 C;  4MTO A;  2CH7 A;  3RYI A;  1AR1 B;  4J41 A;  4DV2 O;  3SDL A;  3S3X A;  1S76 D;  2EIM B;  1SQP H;  3JAW B;  4DV0 B;  1ARO P;  4P9O A;  3FB6 C;  4WFA V;  1B06 A;  3M8A A;  5CBG A;  2XOK G;  1SQG A;  1FKA O;  3MAQ A;  2Z3Y A;  3JD4 A;  4FMT A;  4TV8 A;  5D5P A;  1NKD A;  4AHC A;  4I7Z B;  5JH7 A;  3RVZ A;  2UUC B;  1S5J A;  5B1O A;  1XL6 A;  2NLJ C;  5EC2 C;  3W7U A;  5H6R A;  3ZRX A;  5JQG B;  3K9S A;  3RYH A;  4J9Z B;  4CS4 A;  4LF4 O;  2B9Z A;  2YIA A;  1E1Q G;  4KL1 A;  4DV7 O;  4O4J A;  3GB7 C;  1V55 C;  1FFX B;  3VBB A;  5CA0 B;  2QKS A;  2ZT9 B;  3E86 A;  3NXS A;  2EX3 A;  3ZN0 A;  2PI5 A;  4PI2 A;  3UT5 A;  1YTF D;  1FXK B;  2GUZ A;  2A3Q A;  2ZM6 B;  1HR0 O;  3ABM B;  4G28 B;  1K4C C;  1GN6 A;  4I5S A;  2DW4 A;  4Q20 A;  1WNS A;  5IYD O;  3A0H Z;  5J9P C;  2F23 A;  5B3S C;  3FAV B;  4MSW C;  3SPG A;  4YJ3 B;  3HKE B;  4JI6 O;  1V54 B;  3E2E A;  4LC1 A;  2YI9 A;  1L8D A;  3T4Z A;  1H8E G;  1LR1 A;  2EZP A;  1EFR G;  1O9G A;  4JI2 B;  2GSM B;  2P4K A;  4ZOL A;  1HNX O;  2XTA A;  3G4S V;  2QJ1 A;  5LMN B;  3W7S A;  3ZMS A;  4WFB V;  1W59 A;  1YJN V;  2EIN C;  2WPD G;  2WAM A;  1VQL V;  2YC0 A;  2ZCE A;  4RWU A;  4GKK B;  2FYU H;  3OEE G;  1Y74 B;  4RQE A;  3CD6 V;  2DMX A;  3VQV A;  5LOV B;  2LFS A;  2BTQ B;  1N8R W;  1K4D C;  1WA8 B;  5CMU A;  3ABT A;  4O4L B;  5JCO A;  5LP6 C;  1IVS A;  2H8P C;  3QF7 A;  2YUA A;  4DUZ O;  3FB5 C;  4DV3 O;  3E35 A;  4DR6 O;  1YZB A;  1WAZ A;  1YI2 V;  4B3M B;  1S77 D;  4OGQ B;  1XQ8 A;  1VQM V;  3BA9 A;  3K5N A;  2X0L A;  1N36 B;  4X66 O;  4ICG A;  4G2K A;  3CRA A;  4Q6G A;  4LF9 O;  2M6Y A;  5BZB A;  4FLT A;  3UM7 A;  3ML0 A;  3L75 H;  3E8B A;  3A0B Z;  2XHB A;  4H0L B;  1ZAU A;  5KX5 A;  2LFR A;  3UQ8 A;  4YJ2 B;  4FVM A;  1KP3 A;  3JAM N;  3T1H B;  1JJ2 U;  4I9W A;  1GTO A;  1N0N A;  3A8T A;  2RJZ A;  1MG1 A;  1FPO A;  3JAL A;  3HKC B;  1DF4 A;  1XI1 A;  2JEU A;  1JOY A;  2OCC B;  2EZO A;  2UU9 O;  2GTA A;  3J7A U;  3K0D A;  4NXN B;  4DR1 B;  5KUK A;  1AIL A;  4JI0 B;  4DR3 B;  4HNA B;  3RGB A;  4K8X A;  3S3W A;  4XBF A;  2DN9 A;  4MTF A;  3STZ C;  1QLN A;  5B5E Z;  1PL0 A;  2AZ2 A;  4FPP A;  1BHA A;  3JD1 A;  1G1X B;  2QWR B;  2UXC B;  2KB1 A;  1I5Y A;  2FL4 A;  2YSU B;  3E89 A;  4F6R A;  2HR3 A;  3G67 A;  3OR7 C;  4J11 A;  4FFB A;  2EIK C;  4FLZ A;  1DTO A;  5KAI Z;  1KD1 W;  1PM9 A;  2JGU A;  1RM1 C;  1VIB A;  1HR0 B;  5IY5 C;  1J95 A;  4QNH B;  2Q7H A;  3ZJZ A;  2BOB C;  4NTY A;  3P30 A;  5LXT B;  5JWP A;  2YIB D;  2DQ3 A;  4P30 A;  2X6B A;  2P4V A;  2EIM C;  1VQ7 V;  1VF6 A;  4TQF A;  3F5T A;  4N23 A;  3IGA C;  5ITZ B;  4LF7 B;  1JNB A;  4X65 O;  1I7F A;  4B08 A;  3AK1 A;  1YEW A;  4UCR A;  3K79 A;  2ZNJ A;  3LDD A;  2UXD O;  1F23 A;  4ZI7 B;  2F66 C;  3BAB A;  3UO3 A;  2IJK A;  3ZRS A;  3RYC A;  4XDL A;  5FPR A;  4TV9 A;  1IXB A;  2N05 A;  2ATK C;  2WLI A;  3JAS B;  3L72 H;  3ETQ A;  4O4H B;  4EEQ A;  3CYO A;  1HP8 A;  2JGD B;  1N33 O;  3SPC A;  1HWY A;  5LL6 Y;  3BY6 A;  3B40 A;  2CDY A;  3GWO A;  1WPB A;  4CS2 A;  5DN6 G;  3IFX A;  4DUZ B;  1GRJ A;  1ZUQ A;  4DR7 O;  2JS5 A;  2XUM A;  3CX5 F;  4R7C A;  4DV5 B;  4DXW A;  4PV1 B;  1NR7 A;  2UUA O;  1FFT B;  4TWK A;  3ASN C;  2WLN A;  2G38 A;  1YJ9 V;  1N34 B;  4EB6 B;  3W7T A;  4LF9 B;  3B77 A;  1VQ4 V;  2EBO A;  4LF8 O;  3AG3 B;  1JCH A;  4JYC A;  3E8F A;  3D8C A;  4ZHQ A;  4ZKI A;  3OMI B;  3I55 V;  2MW2 B;  4LF5 O;  1MNG A;  1MMM A;  2ZE7 A;  3CE2 A;  3JAR A;  4JI3 O;  1OJH A;  1S5H C;  4HZ3 A;  3T1Y B;  1BQ0 A;  4NR1 A;  4LFA B;  2YEV A;  4WBN A;  4JYA O;  1P49 A;  3SYP A;  3KG2 A;  4TT3 G;  2XND G;  3RFR A;  2ADQ B;  2JVD A;  1OCR C;  4J7J A;  5LYJ B;  1BSM A;  3BEH A;  2ZIO A;  5J2T B;  4YY3 O;  3JAT A;  4DK0 A;  1AB3 A;  1RPR A;  4JTD B;  1KKD A;  3F7V C;  1ZSP A;  3OTF A;  4L87 A;  2BSK A;  4AQY B;  3K5M A;  1O9H A;  4MVZ A;  1D2D A;  1V55 B;  3G6B A;  4JTA B;  2Q69 A;  3K9A A;  4GX2 A;  1Z5V A;  1MZF A;  4X1Y B;  2EJR A;  3AK2 A;  2LW7 A;  2AHZ A;  2IM9 A;  4X62 B;  3ZX6 A;  1R1B A;  2YIC A;  2F4V O;  4JYY A;  2RNB A;  1NS1 A;  4ABM A;  1TUB B;  4PA6 A;  2MK3 A;  1SES A;  3N2K A;  1K92 A;  2AXT Z;  5GON A;  4U3F H;  2Q67 A;  2KG7 B;  2ZE8 A;  1SA0 A;  5B3S B;  1XMQ O;  4JYB A;  1RP3 B;  2KSD A;  4MW8 A;  3HKB A;  3SGI A;  3OW2 U;  3OGC C;  3APO A;  2QTO A;  5K1P A;  4OX9 B;  4JAA A;  4B7E A;  1EN5 A;  4X65 B;  4NB5 A;  1JMK C;  4FLY A;  1FJG O;  3CJH A;  3N27 A;  2UXD B;  4F6E A;  4W4K A;  3LNN A;  2X6C A;  3D36 A;  2BCC H;  3ZMT A;  4C7U A;  1SF9 A;  2R70 A;  1R6K A;  2EIN B;  1ZTE A;  3ZHT A;  5B1B C;  1LUV A;  1P4R A;  3GWK C;  4BWA A;  3RT3 C;  1K34 A;  4WFE A;  3LSU A;  1XIL A;  4R6Z A;  4BR6 A;  1QHT A;  4H13 B;  5BR8 B;  1HNZ B;  4IGG A;  4X1I A;  2ITC C;  2N74 A;  5CA1 B;  2YID A;  4FK5 C;  2Y0I A;  3K5L A;  3AG2 C;  5EYP A;  5LHH A;  4HBN A;  4IIJ A;  4UVB A;  4I0X A;  4LNU B;  5J2U A;  3CRM A;  1NQT A;  2IU3 A;  2QM4 A;  5B66 Z;  2A06 H;  4FM1 A;  1PD3 A;  1OCO B;  2UXN A;  4PA3 A;  3CXC U;  1RSO A;  2LJ2 A;  4JI7 O;  3R65 A;  1IX9 A;  1M9N A;  1JVM A;  5KHG A;  1CXZ B;  3ZRW B;  4I55 B;  4K3A A;  5C8Y B;  4IHJ B;  4JV5 B;  4JYA B;  4TSF G;  1T5E A;  1TVK B;  1IBL B;  1KEC A;  3VQX A;  1X4T A;  4DR5 B;  2Q5Z A;  3T4D A;  4GKJ B;  3M99 B;  3L71 H;  3AG4 C;  5GTI Z;  4O4I B;  1VQ5 V;  3FYE B;  3KCX A;  2OYQ A;  1BL8 A;  1BHB A;  3LDE A;  3TGU H;  4U7O A;  4B3T B;  2FKX A;  1FXV A;  5CBH A;  1N32 B;  1SQX H;  3JCU Z;  1I08 A;  4QPJ A;  1IUR A;  5IJ9 A;  3QO8 A;  2IJH A;  1DGS A;  2EIK B;  1NT2 B;  1H2G A;  1YCI A;  1Z2G A;  5IYC O;  3O9O A;  2P90 A;  3LUT B;  5JQG A;  1RM1 B;  1FOU A;  1PNL A;  1CP9 A;  2VQF B;  4DV6 O;  1FFX A;  3TXQ A;  3TCU A;  4J9Y B;  1AVM A;  2HP8 A;  5CA0 A;  5LHG A;  2A79 B;  5IY5 B;  4JI1 B;  1IDS A;  3A2F A;  3FKS G;  2GDS A;  2WLJ A;  3BPZ A;  4UV8 A;  3DXR A;  2ZR2 A;  5EZY A;  3FB7 C;  5BMV B;  4JI5 O;  4B3R B;  1M4U A;  5EIB C;  2EIJ C;  5EC1 C;  3CC7 V;  3L9D A;  1HDJ A;  3H1L H;  1VF6 C;  1LNQ A;  3FAV A;  3ETD A;  2XAF A;  4X64 B;  1GN4 A;  2ZDI C;  2DYR B;  5LGN A;  3ZHV A;  3OE7 G;  4UB8 Z;  4QJF B;  1H2S B;  3WB2 A;  1VQ6 V;  1TGO A;  3CMA V;  1WJZ A;  2ZE5 A;  3LSQ A;  3O65 A;  4YIP A;  2Z5U A;  4JTC B;  1XBL A;  4UCU A;  4GT1 A;  1F7Y A;  4NTX A;  1UJW B;  5EBM C;  5FPO A;  3EXA A;  3ZHU A;  1X59 A;  4GZR B;  1PL4 A;  2VQE O;  1I5X A;  1WA8 A;  3L73 H;  2QM7 A;  1OCC B;  3WG7 C;  4O4L A;  1EM1 A;  5CB4 A;  4RO2 A;  2WLL B;  3K58 A;  3ASN B;  2QWN B;  2VS0 A;  2HVK C;  4O2A B;  2XT9 A;  2DE0 X;  1VQO V;  1JR9 A;  4D7S A;  1AI4 A;  4JAV A;  3T2M A;  1N4C A;  5IJ0 B;  1M1K W;  2CH7 B;  3RYI B;  3UKM A;  4U3J A;  4FM0 A;  1QLE C;  5KLV H;  5LGU A;  4DV1 O;  2WLH A;  3AK3 A;  5CA3 A;  1Q6U A;  4FZ1 A;  3B4S A;  2ZQM A;  1YIJ V;  1XHZ A;  2QEX V;  2CK3 G;  1GM9 A;  4I4T B;  1BCC H;  1MAB G;  1XEQ A;  4RAI A;  1Q86 W;  3NR7 A;  3E22 B;  1OCR B;  5A9G A;  4TV8 B;  4DR2 O;  1XMO B;  3HKC A;  2E75 B;  3P3N A;  3Q4H A;  1KBH A;  2WLM A;  4ZIB A;  5LGT A;  3AG1 C;  3HKD A;  2L6L A;  2JJ2 G;  2R9A A;  2NR5 A;  3ZRV A;  1KYO F;  4E4E A;  2IJJ A;  1VF7 A;  4F4L A;  3FFQ A;  4IYH A;  2DOS A;  3ABK C;  3T1C A;  5A2Q N;  4BIO A;  1M5I A;  1QR8 A;  1I94 B;  4DV6 B;  1DK1 A;  4KHP O;  2V7Q G;  3ETG A;  4Z1V A;  2PYL A;  1QVG U;  1OCO C;  1XDC A;  1S3J A;  3PJS K;  1WB8 A;  1JA8 A;  1AJP A;  4DV2 B;  4K35 A;  1SZX A;  3THO A;  2O57 A;  3VQW A;  1J5E O;  1FXH A;  4NTW A;  4H33 A;  5KUM A;  1GN3 A;  4W4L A;  3KKY A;  1Q6H A;  1U97 A;  5EIB D;  1OCZ B;  3ZN1 A;  1M56 C;  2QKC A;  2VWK A;  4FLU A;  2RMK B;  5B1B B;  4DV4 O;  4LFC O;  2IH1 C;  4PA9 A;  3CCJ V;  1K5S A;  4ZI7 A;  3SPJ A;  1P7B A;  2AW9 A;  4J10 A;  1SET A;  2WSS G;  3H01 A;  1ZL8 A;  4I50 B;  4LF4 B;  4DV7 B;  3JAS A;  5IWA O;  2HG5 C;  2Q68 A;  2WA4 A;  3BFR A;  1SC5 B;  4UVA A;  1MSD A;  5IYZ A;  4IL6 Z;  1QCE A;  4CBC A;  3AG2 B;  3CME V;  4MVU A;  4JF3 A;  4QE9 A;  2PTM A;  4JI8 O;  3E8G A;  5FNV B;  2Y69 C;  1HNW O;  2UUB O;  1NI8 A;  2BOC C;  4MVS A;  4X1K A;  2PGG A;  1H38 A;  1FS0 G;  2LO1 A;  2JS3 A;  1JJO A;  4CH3 A;  3QG5 A;  5F2V O;  1YDX A;  2W6I G;  3HR0 A;  4EB6 A;  5KX5 B;  4JI6 B;  2HJF C;  1EBO A;  2P67 A;  1FYJ A;  3BRC A;  3CS5 A;  4DV1 B;  1BMF G;  3OFN G;  1UPG A;  2CGN A;  1TAE A;  2PF4 E;  1HNX B;  2PY5 A;  1K8A W;  2Y0P A;  1R73 A;  3JAL B;  3MD0 A;  2DYR C;  5JJE B;  4JZG A;  2ZNI A;  1XUQ A;  4H37 A;  2XAG A;  3CRQ A;  4JZ2 A;  3AG4 B;  4CH5 A;  2ADP A;  4O2B A;  2QGN A;  1YXB A;  1F4N A;  2Z0A A;  2GBO A;  3DC6 A;  5LYJ A;  1WPX A;  1KU9 A;  4JPR A;  4B7K A;  3K59 A;  4I9Q A;  1IJG A;  4DUY O;  1Q8I A;  5FLX N;  4BW5 A;  2B1G A;  4CH6 A;  3CHX A;  2AZ0 A;  1PNM A;  4DV3 B;  5D5Q A;  4DR6 B;  5KHJ A;  1OCC C;  1XNQ O;  4NYK A;  2UXB O;  1ENV A;  2Q9L A;  2A9H A;  2CTQ A;  3WB1 A;  4X66 B;  1QBZ A;  4X1Y A;  1KKC A;  1HW7 A;  1PP9 H;  4U7N A;  1NH2 B;  5LMU O;  4BIU A;  2RCV A;  4EFB A;  4NXM O;  2Y4T A;  2RN9 A;  5DEC A;  3JAK A;  4P9P A;  2YIB A;  4Z2W A;  1L0L H;  2A0L A;  4MVO A;  2EIJ B;  2FTK A;  2KG7 A;  3OEH G;  5JJN B;  1SKV A;  3B09 A;  2UU9 B;  5JVD A;  1VF5 B;  1VQ8 V;  2PYJ A;  2DYS C;  1NJI W;  1WP8 A;  1K7D A;  4JI4 O;  3CCL V;  2YXL A;  3TK1 A;  1Y66 A;  2DJV A;  2WLI B;  2W0F C;  3N2G A;  4PJ0 Z;  1JFF B;  3SYC A;  2KQX A;  3AG7 A;  1M90 W;  3GVM A;  3JD3 A;  4Z1M G;  1IBM O;  2K1E A;  4GYC B;  4QE7 A;  5GTH Z;  4JI8 B;  1COW G;  2GTS A;  2P6J A;  2E76 B;  3WG7 B;  2IH3 C;  5LP6 A;  1BT8 A;  2JIZ G;  4DW0 A;  2QWP B;  1MOF A;  4BW9 A;  5IT9 N;  5E1A C;  4CS3 A;  4PD4 F;  1OV9 A;  2N04 A;  4LNU A;  3L74 H;  3TET A;  1SQF A;  4FFK A;  1BZK A;  4X20 B;  2QDO A;  3JSN A;  1NTM H;  2QR4 A;  5B1A C;  3RN4 A;  2LQT A;  1QLE B;  1M57 C;  1XRE A;  3JAR B;  2HHH O;  2ZD9 A;  3OM3 B;  2HLD G;  3SR2 C;  2CTP A;  3ZS8 C;  2HJD A;  4WBN B;  1S72 V;  2ZKO A;  1OCZ C;  1YF2 A;  1OHH G;  3ZRW A;  1P7G A;  5C8Y A;  4PI0 A;  4LWS B;  2ILM A;  3SYO A;  3JD2 A;  4DR4 O;  1US6 A;  3ZIA G;  1EZJ A;  1DF5 A;  3D3Q A;  1VP7 A;  5CN0 A;  2AGA A;  1N33 B;  3CRC A;  1KMI Z;  2YXY A;  4DRX A;  2H94 A;  3AG1 B; 
#chains in the Genus database with same CATH homology
 1GN2 A;  1GN4 A;  1AP5 A;  1VEW A;  4E4E A;  1IXB A;  3MDS A;  3AK2 A;  1Y67 A;  1ZLZ A;  3IC9 A;  1IX9 A;  3CEI A;  3KDR A;  3C3S A;  4JYY A;  5AG2 A;  4YIP A;  1N0N A;  2CE4 A;  1GN6 A;  2CDY A;  4X9Q A;  1XDC A;  1WB8 A;  1EN6 A;  1JA8 A;  4JZG A;  1PL4 A;  1MA1 A;  1ZUQ A;  1XUQ A;  1SZX A;  4YIO A;  1BS3 A;  4JZ2 A;  2ADP A;  1EM1 A;  1EN5 A;  4GUN A;  2P4K A;  1AP6 A;  1GN3 A;  3DC6 A;  1BT8 A;  1I08 A;  3KKY A;  4F6E A;  1JR9 A;  1I0H A;  4C7U A;  1QNM A;  1PM9 A;  1ZTE A;  2QKC A;  1MNG A;  3QVN A;  1VAR A;  4FFK A;  3OT7 A;  1LUV A;  1LUW A;  1MMM A;  1AR4 A;  3RN4 A;  3LSU A;  1XIL A;  2AW9 A;  1AVM A;  1XRE A;  3AK3 A;  4BR6 A;  1B06 A;  3TJT A;  1KKC A;  1IDS A;  2ADQ B;  3BFR A;  2GDS A;  1AR5 A;  2RCV A;  1MSD A;  1BSM A;  1P7G A;  5A9G A;  1D5N A;  3DC5 A;  3EVK A;  3C3T A;  3K9S A;  1ZSP A;  3AK1 A;  1WB7 A;  1N0J A;  2QKA A;  1EN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...