1ZLZA

Re-evaluation of the low-temperature azide in mn-dependent superoxide dismutase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azide Adduct of the Y174F mutant of Manganese superoxide dismutase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
total genus 74
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zlzA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zlzA02
1IXBA 4E4EA 2QKCA 1AR4A 1IX9A 1I0HA 4YIPA 1ZTEA 1MMMA 2ADQB 1IDSA 1GN2A 1EN6A 3KKYA 4BR6A 2RCVA 1AP6A 1KKCA 3DC6A 1EN4A 3TJTA 1B06A 1EN5A 1JR9A 1WB7A 4F6EA 2GDSA 1Y67A 3MDSA 3C3SA 5A9GA 1GN3A 3K9SA 3AK2A 1N0NA 3EVKA 2ADPA 1GN4A 1AP5A 3QVNA 4X9QA 4JZ2A 1QNMA 2CDYA 1XDCA 1LUWA 1MNGA 4GUNA 1D5NA 1GN6A 2P4KA 1ZSPA 1SZXA 3AK1A 3DC5A 1ZLZA 1LUVA 1BS3A 3AK3A 4C7UA 2QKAA 3IC9A 3RN4A 3C3TA 4JZGA 1WB8A 1XILA 1BT8A 3BFRA 2CE4A 3OT7A 1AVMA 1AR5A 1VARA 1PM9A 1PL4A 1ZUQA 4FFKA 4YIOA 1XREA 3CEIA 2AW9A 1XUQA 1MSDA 1BSMA 5AG2A 1JA8A 1P7GA 1N0JA 3LSUA 1I08A 1EM1A 1MA1A 1VEWA 4JYYA
chains in the Genus database with same CATH superfamily
3T1CA 2IW5A 5LOVB 2DOSA 1JMKC 2H3OA 4MVSA 5BR8B 3ABUA 1N33B 2YXLA 2ZCEA 1MOFA 4PDMA 3Q4HA 4LP8A 5IY5B 5L3BA 2OWOA 5EYPA 2WLIA 4TV8B 3KKYA 1D2DA 2FYUH 1XNRB 4AI8A 2ZE6A 2A9HA 2QDOA 3CMEV 4JAUA 3MAQA 1K9MW 3KCYA 3ZHSA 5GTIZ 4JI6O 2IH3C 5LXTA 5H6RA 4XDJA 1YDXA 2EJ7A 2MK3A 2ADPA 3UKMA 1J5EB 4DR7O 1XI1A 3E89A 5LP6B 1K4DC 2OYQA 4EEQA 3H01A 1XDCA 4GUNA 5BZBA 1BCCH 2EJRA 3E8HA 2FB5A 1ZSPA 3K06A 2QA4V 5GW7A 5CMUA 4B7KA 4X88A 1TA8A 1W0KG 1TAEA 4LF9O 2X6AA 1WB8A 3SYAA 1NVPB 3OTOB 1OCRB 5BY1A 4TV9B 3ZX6A 3OMNB 3VBBA 4DR6B 2WPDG 1PL4A 5CA1B 1ZWIC 3RYHB 2GBOA 4EB6A 4MS2A 4UCSA 2ZR3A 3OR7C 4DV2O 5ITZA 1LNQA 2E76B 5CA0A 1R6TA 4IT5A 4AHCA 3GWKC 1TUBA 1H2LA 2DYRC 3JCUZ 4GT1A 5FNVB 1IXBA 4X1YB 4I7ZB 3JAMN 3DSQA 4WBNB 4QPKA 1KB9F 1SC5B 4OX9O 2XOKG 3ZMUA 5CBHA 3ASNC 4PHZA 1NTZH 4HNAB 1EN6A 4U3FH 5TISZ 1SRYA 4YXWG 2WLNA 4DV0O 3K79A 4RAIA 3VQXA 5HFMA 5E79Z 5JCOA 2Y0PA 4CH4A 2QM8A 5L3EA 4FLWA 4OX9B 3LSQA 4RUFA 1B06A 2FL4A 2IJKA 4LWSA 4PA7A 3HKBB 3UT5B 2AHYA 2PYLA 4XDKA 2RJZA 4K3AA 3T1HB 1XHZA 2IBZH 1W59A 1XEQA 1F7YA 4DW0A 4BW9A 4TQFA 3AG3C 3UQ8A 1YHQV 3ABKB 1VIBA 3P3NA 1MNGA 1NH2D 4ZKIA 1GN6A 3L71H 2P4KA 4DW1A 2A7WA 1R73A 4MTFA 1G1XB 3J81N 2YDEA 3JD3A 2ZNJA 1R1BA 1V9PA 2YEVB 1K7DA 1WJZA 4FK5C 4H0LB 3IC9A 1NZ6A 3CSXA 1YSCA 4X64B 3X2QB 4NVPA 2BOBC 2VQEB 3L9DA 4DUZO 2QTSA 1BQZA 4WCEV 1WA8B 2KG7A 3ZRWA 2EIJB 3EFFK 1YF2A 4PA4A 5KHGA 3HKDA 1IBMO 4I50A 2EILC 2A79B 3STLC 4LF4B 1CXZB 1BSMA 1SQBH 1HNZB 4PV1B 3TCUA 1K3EA 5BMVA 2OT5A 3ICXA 2ZD9A 2ZE7A 3VQVA 4JYAB 2PI4A 1NTMH 2BCCH 3SPCA 4YJ2A 4D7SA 4FLVA 1Y4MA 3QO7A 1Q90D 3UO2A 2LGWA 3APOA 4GX0A 3ZHVA 2E5LO 4J7JA 2IJHA 1RSOB 5KHKA 4QGPA 1KC8W 3OR6C 4FLTA 4DV6O 4LFBB 4BR6A 2RCVA 3WU2Z 2CH7B 3DC6A 1BZKA 4MVOA 2OCCC 2E5LB 1WB7A 2LJ2A 4PDRA 4CS3A 3THOA 1AJQA 3CJHB 2DW4A 4DV6B 1NU1H 4UUJC 3AG4C 2VWJA 3APQA 5FL7G 1XNQO 2XAJA 3H1LH 5EIBD 5JVDA 1X59A 2ZIOA 1XNRO 2VQFB 3ZHTA 4JTAB 2QEXV 2LO1A 3OM3B 4JPRA 1HR0B 1I5XA 2D2CB 4JZGA 4JAAA 2OTLV 4UV9A 1SQQH 4QE9A 1SQFA 4I55A 1N8RW 3FFQA 4Z1VA 4IHJB 2B9ZA 5IJ0B 2XAQA 4X64O 3OT7A 3JATA 4FFBA 3G67A 2HEPA 2L6LA 1BHAA 1WLEA 1P7GA 1G4YB 1N0JA 1QR9A 2EX3A 3W7SA 4JI1B 2EIMB 2CTQA 1I08A 1L0NH 2YIBA 4B3TO 4LF4O 4DR4O 1J5EO 4AQYO 2UXBB 4MVUA 4MT8A 5LA6A 4DRXB 4ZHQB 2WSSG 1Q8IA 2HR3A 1VQKV 1KYOF 1AILA 4AILC 4X1IB 1SF9A 4FM0A 1IDSA 3CC7V 3K3WA 1HP8A 4GZRB 1I5YA 4JI8O 2DJVA 2A06H 3W7XA 1M1KW 2WLJA 4X1KA 2Z3YA 3ZRWB 2GSMB 3OGIB 4F6EA 1NI8A 4YHHB 1U97A 5KX5A 3MHSC 1VQLV 4LFAB 4ZOLA 3CCMV 1Y74A 3MHHC 3CXHF 1LUWA 4N21A 1WNSA 5H5NA 3CYOA 2QWPB 1LUVA 1R3LC 4YJ3A 2LFRA 3AK3A 2QKAA 3LDCA 3K0GA 2R9AA 3QF7A 1JJOA 4CC5A 1YITV 3SDLA 4LF6B 2DMXA 1KP2A 3JAWA 2UUAB 1Z5WA 2HP8A 3A0RA 4BWAA 3U0ZA 1O9HA 1R3JC 2P06A 2LW1A 1UJWB 2EINB 3WB0A 4TOIA 4LF5O 1YTFD 3F7YC 3K04A 2JGDA 4MW3A 4KFMA 4NTWA 3JATB 4FFBB 4L87A 1K5QA 1K4CC 4MVQA 3CXCU 2VQEO 3EHBB 2VWKA 4B3SB 3E83A 4B3RO 1YI2V 2Q7HA 4UVAA 2JJ1G 4QPJA 2R9RB 3AEIA 5H6QA 4WBNA 5LP6C 4DR7B 3J7AU 5LL6Y 3RT3C 2GTSA 1N34B 3JARA 5KA6A 1MZEA 5LMUO 1K73W 3L72H 1HNXB 3B2EE 1RPRA 3FB7C 4J9ZB 3RBZA 5DN6G 3E2EA 2Q9LA 1EZVH 3AK2A 4DR2O 5CB4B 5IT9N 4X65O 4J42A 4YHHO 1VQ6V 5BMVB 3K57A 3W7WA 1V55C 4DV7O 3H1JH 4BIZA 4OPHA 3MD0A 3F5WC 3P3PA 1M57C 2Q73A 4GKJO 3T2MA 1IXMA 2UXNA 2LGQA 2Q0AA 5LA6B 4DRXA 1JPXA 3C3TA 1V55B 2PTMA 2ZT9B 4X66O 1URFA 1JFFB 2ODMA 2ZDIA 4J9YB 4DV2B 4JI3O 5L3FA 4GKKB 3E8GA 2PY5A 1QVGU 1FAFA 3TGUH 2KG7B 2CTPA 4CS4A 2FMLA 3ZN1A 1XREA 2M6YA 3CX5F 5J2UB 2Q6AA 4JI3B 2K9PA 2RMKB 1XMOO 5JH7B 5B1BB 2Q4PA 3D36A 5LOVA 1XMQO 1PD3A 4IGGA 1DGSA 3F7VC 1OJHA 1WAZA 3ZHQA 1L1FA 2OIEA 4W4LA 3KCXA 3AG2B 2QSAA 1TVKB 3GVMA 3T1HO 1F51A 3CP1A 1Q3EA 4WFHA 2DYRB 4XBFA 1R6KA 1YJWV 3E8BA 4JI1O 1PKXA 1AI4A 3SYOA 3CCLV 1QLEB 5K1XA 1P7BA 1EN4A 3FYIB 2GV9A 1JCHA 2G38A 1M56C 2BE3A 1NQTA 3SJCC 1QU7A 1NR1A 1XQ8A 3CRRA 3T4DA 2QWNB 1HNXO 4X9QA 1R6NA 4NB5A 4YJ3B 4KHPO 1DK1A 4X62O 1PNKA 2LQTA 3CPWU 4DUZB 3M99B 3CRAA 4JV5O 1SZXA 2L35A 1ZLZA 1P84F 2HJDA 4ZIBA 3JALB 2F23A 3K58A 2N74A 2HG5C 5KLVH 3ZRSA 2IU3A 1NH2B 1THZA 4AQYB 5CA1A 1SZTA 5H2FZ 3ZHRA 3I56V 3AG3B 1DF4A 4DV1O 2X6CA 4TV9A 2V4DA 1BT8A 4DO2A 4CH5A 1SERA 1UPGA 4UXNA 4UCRA 2ILMA 5IDJA 4JGSA 2WA3A 4GLXA 2Y0IA 3CB2A 2DN9A 4YY3B 4RO2A 2XASA 4P2ZA 3B8NA 4JI8B 2RQ6A 5CB4A 1IBLO 1QLEC 1XHXA 3UO3A 2Z0AA 2ZINA 4XDLA 4QJFB 4ZHQA 3A0BZ 1OZ0A 5KHJA 4MTXA 4LF6O 2B1GA 1GMGA 5LP6A 3S3XA 1Z2GA 1ZAUA 1WA8A 1IZ3A 4CS2A 2CAZC 5IYZA 1H2MA 2DQ0A 2JS3A 5B1BC 2ADQB 3HKEA 3N2KB 3CMAV 3IGAC 5JQGA 1VQ8V 1VF5B 1NJIW 3H1IH 2BOCC 2ITDC 1AP6A 1KKCA 5IWAB 5IYCO 1M9NA 1M5IA 1Q81W 3K5MA 5KAIZ 1H2KA 3A8TA 2WLIB 1H8EG 1GO3F 3WB1A 4PA3A 1S5LZ 3RYFA 1HNWO 1QNMA 1GRJA 5LGTA 5FNVA 4J80A 4LWSB 1XOUA 1SA0A 2RNBA 2X6BA 1JJ2U 1H5WA 1Y66A 1JFFA 3JAWB 4NTXA 2DWDC 5B66Z 4Q6GA 3B09A 4I9WA 1FFXA 1F23A 3T1YO 4K0KO 3SYQA 4DV5B 4B3RB 3CCUV 2PI5A 4HYOA 3CS5A 3S3WA 5HFLA 4O4IB 3RYIB 2HJFC 5FPOA 1M93A 4I0XA 4W4KA 4K0KB 1AI7A 2JK5C 2QWOB 2F66C 4LF8B 2HKOA 1N34O 1E1QG 4KXRA 4O2BB 2AZ2A 1KQSU 4LF9B 4EB6B 3QNEA 3M8AA 1YJ9V 5B3SC 2UXCO 4R8CA 1MA1A 1IBLB 3BRCA 1GM7A 4LF8O 4RWUA 2EZOA 4HZ3A 1FPOA 3JASB 5D5QA 4JYYA 5KUKA 1VQNV 1VQMV 4BW5A 1RM1C 2VS0A 1VQ5V 4JI0O 3N2GB 4X1IA 1PL0A 3KDRA 4DV7B 2Q68A 3CRQA 1JVMA 4X89A 3LSSA 4LFAO 2R9IA 4FM2A 2X7RB 1CP9A 5C8YA 1VQ9V 5LGUA 1M56B 3JSLA 1VQOV 1BMFG 2JGDB 4JTDB 3QO8A 4TT3G 1H38A 3RYFB 4CH3A 2EIKB 1QBZA 5IWAO 3QVNA 4DYLA 5J2UA 3B40A 2OCHA 4UVBA 2CDYA 3OFNG 4PDVA 3ABMC 4F6RA 2DWEC 5JQGB 2YUAA 1YZBA 1SESA 3RVZA 3JD2A 5LGNA 1XMQB 3HKEB 3N2KA 3PN1A 4WF9V 4DR5B 1OCZB 4FJCC 3ZN0A 2UUCB 2Q7EA 4JYCA 3AG2C 1GH6A 4JI4O 4B3TB 4R7CA 4NTYA 2UXXA 3OD4A 4R6ZA 4LFCB 2BSKB 4FMTA 4FLXA 2Q5ZA 4X62B 2A3QA 3D36C 3OEEG 1WP8A 3CCQV 5EBMC 3L75H 2BTQB 2N04A 1XUQA 1BL8A 4UB8Z 4GX5A 2ZQMA 1HDJA 4JI2O 3TK1A 2W0XA 4FLUA 3ZMZA 2WLLB 2Y69B 1VMGA 4ZBMA 3ASNB 3T1YB 3ZRXA 4FIPC 3I55V 4L8JA 4J7KA 2V7QG 3CC2V 5ITZB 2UXCB 1K92A 1AR4A 3FAVB 1OCZC 2EULA 3IFXA 1U96A 4LF7B 4YJ2B 2XT9A 4X65B 1YJNV 1MABG 3K59A 3CCJV 2PF4E 1MG1A 2UXDB 3ABKC 4O2AA 3TJTA 1ZL8B 3ASOC 1EN5A 3RYCB 3TETA 4NXNB 3CCVV 4OXSA 1YIJV 3NXSA 2P5OA 3ABTA 2WLMA 3EVKA 2AXTZ 2JIZG 5H9CA 4DV4O 4X66B 1WPXA 3L74H 4O4JA 2GHYA 4NXNO 4LCUC 3DTUB 4GKKO 3OW2U 1S0VA 4H44B 1BS3A 5JWPA 5GONA 4I4TB 5LBQA 4O4HB 2NNUA 1PPJH 4D6TH 1L0LH 3RN4A 1VF6C 1N32B 2WLKA 4PD4F 4TWKA 3E22B 5D5PA 2KQXA 1M90W 2BTQA 1XMOB 1K8AW 3UCSC 2F93B 1V54C 2CE4A 4DR5O 4B3SO 1AVMA 3IAYA 2B5UA 4G27B 1M4UA 1YXBA 3RW0A 3CCSV 3KZIZ 4H37A 1OCOC 2DYSC 1MSDA 2PUSA 3BPZA 3K9AA 1VF7A 4JASA 2JEUA 3GWOA 5CN0A 1ORQC 2JDIG 3BAAA 3G6EV 3AG7A 5KAFZ 3WG7C 5LYJB 1FYJA 2W6IG 4E4EA 3BCCH 5B1NA 1OHHG 4ZI7B 3QO5A 3EXAA 1IX9A 1SKVA 4CZZA 2O57A 4YIPA 2Q67A 2ZE8A 1SQXH 1W2BU 3N2GA 3K0DA 2Y4UA 2ARHA 4O2AB 4EFBA 2Y4TA 4KHPB 2ZM6O 3B8MA 4DV3O 4UCVA 4ZOLB 2X0LA 5EZYB 1Y76B 3LDDA 4GKJB 2GDSA 2Q0OC 5FPRA 3MDSA 3NR7A 1GN3A 5B3SB 2D3OW 4JYBA 2ZM6B 4X1KB 1NS1A 2WLHA 4JZ2A 4LBEC 3K03A 3FX7A 4OPAA 1NBMG 1SS3A 2JEXA 1D5NA 1OCRC 3CRMA 4O4IA 3ETGA 4WFBV 5GTHZ 1YTFB 3JARB 4LR3A 3G4SV 3PJSK 2PZSA 4C7UA 2DQ3A 1Q6IA 2GUZA 4JF3A 4FVMA 2NN4A 1XILA 1T5EA 1VQ7V 3H1HH 1VARA 1KUQA 2YS8A 3RYIA 3LNMB 3G6BA 2P6JA 3E22A 1S77D 3G71V 1PNLA 2P22C 5LXTB 5EC2C 2KSDA 2UUCO 2IJIA 2KKWA 1GKFA 3JAKA 3ABLC 4TV8A 1XL4A 1G6UA 4P9PA 3P30A 2QKCA 3OEHG 4LC1A 4FZ0A 2CTRA 1I0HA 3B77A 3RYCA 1FXKA 1S5HC 1Z5VA 1GN2A 2Q7GA 1YCIA 2HVJC 2WWWA 2F43G 1VP7A 2RDCA 5KMGB 5JH7A 4FLZA 3CWBH 4JV5B 5CA0B 4UCUA 4B7EA 1MSWD 2YXYA 3HR0A 2V1DA 2AHZA 3RWRD 4JI4B 4DR3O 3K5NA 2EIKC 1Q5OA 2Y69C 3FB5C 5B1OA 1G8MA 2P67A 4DV1B 5GONB 1EZJA 5B5EZ 1Y6XA 1A32A 4RQEA 3IJ4A 4JI2B 2EINC 2CGNA 2YC0A 2UXDO 1IJGA 5KX5B 3AG1B 3CC4V 1H2SB 3OMIB 5EIBC 4RUEA 2JS5A 1NTKH 2YSUB 3HKDB 2XUMA 3JD1A 1FS0G 5CA3A 1R3KC 3G80A 1AJNA 4KP4A 3VQWA 3T4ZA 1AB3A 4NR1A 1AR5A 3CHXA 4IIJB 1ZUQA 4LF7O 5C93A 1KKDA 2AW9A 2DYSB 4NKGB 3ZIAG 4JI7O 2YI8A 2CTWA 2HFEC 2LP7A 4RQFA 3F5TA 2OCCB 4E2LA 4DR1B 4B3MO 2F4VO 2ITCC 3CCRV 2YI9A 1H8HG 4KL1A 1OCCB 1NVPD 1KMIZ 2EIJC 1RFYA 3VOUA 1AROP 5B1AB 4Q20A 3RFRA 4CC6A 3M7MX 1FXHA 3UT5A 3OTFA 1HNWB 3STZC 5C8YB 1DTOA 4UCOA 1KU9A 1N32O 4MVRA 3I5DA 4X1YA 1N4CA 1E1RG 3KG2A 1RM1B 5KUMA 4H33A 3W7TA 1IURA 1FJGO 1Y67A 1TVKA 5A9GA 3CCEV 4O4HA 4DV5O 2GUZB 4WFFA 1ZX3A 4J41A 2MW2B 3ASOB 4PA9A 4IYIA 3ZS8C 3ZMSA 1FJGB 3FKSG 5EBWC 3DC5A 4FZ1A 2R72A 5B1AC 4DV3B 1H2NA 1H2GA 3H1KH 5JJJB 3E35A 3R66A 3BHPA 2QWRB 3K5OA 4G28B 2P7TC 1AI6A 1Q6UA 4IIJA 2ZKOA 1Y76A 3K08A 2ZR2A 4MSWC 3QG5A 3ZHUA 2F95B 3HB3B 3SJAC 2QM4A 1EBOA 2UU9O 2XNDG 4K8XA 4PI2A 4I5SA 4UVCA 2YXHA 1FD9A 1YEWA 5L3CA 1WPBA 3OUFA 3ZCCA 4TUYA 1OCOB 2PGGA 4JI7B 2ZXWC 3OMAB 4D7TA 1KBHA 4YY3O 4DR6O 2ATKC 4GX2A 4DK0A 1WN7A 1QQCA 5KMGA 1US6A 3JSNA 3E86A 3OGCC 4J11A 4B3MB 2YEVA 2QE7G 1MMMA 5DECA 4ZI7A 4PJ0Z 4U7NA 4BIOA 2H8PC 1KP3A 2HLDG 4IHJA 1XNQB 4DV4B 4P9OA 4CBCA 2IM9A 5JVDB 2VRZA 4GYCB 2XTAA 5IJ0A 3HPLC 1JR9A 4J10A 1VQPV 5LHIA 4PA6A 2UUBO 4K35A 4G2KA 3U11A 1HR0O 1V54B 3SPGA 4EFEA 1GM8A 1DLBA 4MW8A 3HKBA 4LFCO 4QE7A 1B6QA 3O9OA 3LDEA 2UUBB 1BE3H 3SPIA 3AG1C 3ZEDA 5KHHA 4UCTA 2ZDIC 1NT2B 1KECA 1QCEA 4I4TA 4DR3B 3SPHA 2Y48A 1RPOA 1WP7A 4BAYA 3LNNA 1Q7YW 3JAKB 1E79G 3VQYA 1W0JG 2EIMC 2QKSA 3JYCA 1Y74B 4MVMA 2UXBO 2M7WA 3L70H 3CJHA 2ZE5A 4BIUA 3BEHA 1GM9A 1YVWA 1B3QA 1JA8A 5JJEB 3OTOO 3UM7A 4K8ZA 2EBOA 3FAVA 3JASA 2NR5A 4FPPA 2HHHO 3ZRVA 4R50A 2Q69A 3RGBA 2UU9B 2H94A 1FXKC 3P32A 4DUYO 1Q86W 1D5AA 2QWQB 3E8FA 4ASUG 1XBLA 3ABLB 1SQVH 4X20B 2F1MA 3HKCA 3RVYA 3RYHA 2EZPA 5EK0A 1HNZO 1KD1W 5J9PC 2BSKA 2W6JG 4TUYB 4HBNA 1PV0A 2IH1C 3ML0A 2F4VB 5IJ9A 4U7OA 1X4TA 1J95A 1VQ4V 1I7FA 2PYJA 4P30A 2XAGA 4JI0B 3ZJZA 3D8CA 2XAFA 1Q43A 2KB1A 3K9SA 1FFXB 1N36O 2IJJA 4PI0A 2BTOA 5LHHA 5K1PA 2LFSA 3SYPA 4NXMO 5J2TB 4PDLA 1NKDA 2AGAA 5EYPB 4DXWA 1K33A 1BGYH 5L3DA 4FLYA 4F6RB 1AR1B 1DF5A 2NLJC 3OE7G 3ZMVA 1FXKB 4NXMB 2Z5UA 4MTGA 5LMNB 4EKWA 2ETNA 4JI6B 3CD6V 4I9QA 4O4LB 2DE0X 1UFIA 3BA8A 1HWYA 3B4SA 3BFRA 3WFVA 2Q8VA 4LNUA 1M57B 2W0FC 5BR8O 2OIGA 3J80N 4YIOA 2E74B 3CEIA 2XAHA 4X8AA 1GTOA 3DXRB 4UB6Z 3CE2A 1JNBA 3SYCA 1IVSA 1GAXA 1R3IC 4QNHB 4N23A 5L3GA 3IC7A 2QTOA 1SQPH 2CH7A 1EM1A 3FYEB 2FKXA 1FKAO 1VEWA 3BY6A 1ROPA 1IBMB 1SETA 1O9GA 1Q6HA 4O4JB 1ENVA 2HHHB 2HVKC 2CUGA 1ZL8A 1ZTEA 3OUSA 4Z1MG 4DUYB 1CEZA 2YIBD 3A0HZ 1NR7A 3LUTB 3U10A 3AG4B 3ABMB 2P90A 1RSOA 5F2VO 1S3JA 1QR8A 4DR4B 3JCZA 1TUEB 5EBLC 1F4MA 3GB7C 3D3QA 3FB8C 3SJBC 1CPYA 3ZBHA 3C3SA 1BQ0A 2GTAA 1OV9A 1K34A 1N0NA 3WB2A 1LR1A 1GN4A 5EC1C 5IYBO 1QVFU 1P4RA 5FLXN 4I0XB 1L8DA 5LYJA 4H13B 1PP9H 2IU0A 3JD4A 1N36B 4WFAV 3D3IA 1MZFA 4U3JB 1SA0B 4NYKA 3X2QC 5CBFA 4IYHA 5LHGA 3JD0A 4OGQB 1IBKB 4GCZA 2AZ0A 1P49A 1PNMA 3O65A 3SGIA 5IYDO 4JI5B 1OCCC 2WAMA 4CH6A 2ZNIA 1XL6A 4F4LA 4I55B 2WLLA 2EILB 3Q4HB 3FB6C 4LH7A 3DXRA 4WFEA 5DM6V 1GK9A 2JGUA 4JI5O 2QJ1A 4DK1A 5IYZB 5CBGA 1F4NA 3LSUA 1HW7A 3QTCA 5LMNO 3K5LA 5J2TA 4O4LA 2N05A 2E75B 2YIAA 3ETDA 5KHIA 2K1EA 4LF5B 2JRIA 4Z2WA 1AI5A 2B1IA 2LW7A 4J7ZA 2ZXWB 1JX9A 3W7UA 4JAVA 1S76D 5IE9A 3SJQC 5JCOC 4UV8A 2QR4A 3WG7B 4HAMA 3TXSA 3R65A 4HNAA 3N27A 2P4VA 5KA5A 1EFRG 2CK3G 1S72V 4PELA 1FOUA 3C90A 1FFTB 2XHBA 1QHTA 1K97A 4JYAO 2OTJV 1AP5A 4LH6A 4FM1A 3BVOA 2YIDA 2JJ2G 3BA9A 4UFZA 1BHBA 1VF6A 3ZMTA 1Q82W 3FD9A 5EZYA 2RN9A 4U3JA 1B04A 4TSFG 2A0LA 5IJ9B 3JALA 1TGOA 2R70A 2JVDA 5LMUB 3AK1A 1SQGA 1TUBB 2FTKA 2QGNA 1FXVA 4GX1A 3HKCB 3OAAG 5IY5C 2ZIMA 4X20A 3TXQA 4ICGA 5E1AC 4IL6Z 4DR2B 2E3CA 4KUMA 1S5JA 4I50B 4MVZA 3A2FA 4DR1O 1COWG 3DGEA 2YICA 3L73H 4A5UB 4JTCB 3BABA 5DEDA 4B08A 3CRCA 1PM9A 3H9VA 4MTOA 5JJNB 3ETEA 4FFKA 4QIWF 3SR2C 3ETQA 1RP3B 4O2BA 1K5SA 1QLNA 1I94O 4ABMA 2C2AA 2QM7A 1JQ0A 4DV0B 5A2QN 2WA4A 5AG2A 3SPJA 4LNUB 4TQDA 2VQFO 1N33O 2UUAO 4WFGA 4LFBO 1AJPA 2CGOA 1IBKO 5BXZA 1I94B 1JOYA
chains in the Genus database with same CATH topology
1IXBA 4E4EA 2QKCA 1AR4A 1IX9A 1I0HA 4YIPA 3KDRA 1ZTEA 1MMMA 2ADQB 1IDSA 1GN2A 1EN6A 3KKYA 4BR6A 2RCVA 1AP6A 1KKCA 3DC6A 1EN4A 3TJTA 1B06A 1EN5A 1JR9A 1WB7A 4F6EA 2GDSA 1Y67A 3MDSA 3C3SA 5A9GA 1GN3A 3K9SA 3AK2A 1N0NA 3EVKA 2ADPA 1GN4A 1AP5A 3QVNA 4X9QA 4JZ2A 1QNMA 2CDYA 1XDCA 1LUWA 1MNGA 4GUNA 1D5NA 1GN6A 2P4KA 1ZSPA 1SZXA 3AK1A 3DC5A 1ZLZA 1LUVA 1BS3A 3AK3A 4C7UA 2QKAA 3IC9A 3RN4A 3C3TA 4JZGA 1WB8A 1XILA 1BT8A 3BFRA 2CE4A 3OT7A 1AVMA 1AR5A 1VARA 1PM9A 1PL4A 1ZUQA 4FFKA 4YIOA 1XREA 3CEIA 2AW9A 1XUQA 1MSDA 1BSMA 5AG2A 1JA8A 1P7GA 1N0JA 3LSUA 1I08A 1EM1A 1MA1A 1VEWA 4JYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXB A;  4E4E A;  2QKC A;  1AR4 A;  1IX9 A;  1I0H A;  4YIP A;  1ZTE A;  1MMM A;  2ADQ B;  1IDS A;  1GN2 A;  1EN6 A;  3KKY A;  4BR6 A;  2RCV A;  1AP6 A;  1KKC A;  3DC6 A;  1EN4 A;  3TJT A;  1B06 A;  1EN5 A;  1JR9 A;  1WB7 A;  4F6E A;  2GDS A;  1Y67 A;  3MDS A;  3C3S A;  5A9G A;  1GN3 A;  3K9S A;  3AK2 A;  1N0N A;  3EVK A;  2ADP A;  1GN4 A;  1AP5 A;  3QVN A;  4X9Q A;  4JZ2 A;  1QNM A;  2CDY A;  1XDC A;  1LUW A;  1MNG A;  4GUN A;  1D5N A;  1GN6 A;  2P4K A;  1ZSP A;  1SZX A;  3AK1 A;  3DC5 A;  1ZLZ A;  1LUV A;  1BS3 A;  3AK3 A;  4C7U A;  2QKA A;  3IC9 A;  3RN4 A;  3C3T A;  4JZG A;  1WB8 A;  1XIL A;  1BT8 A;  3BFR A;  2CE4 A;  3OT7 A;  1AVM A;  1AR5 A;  1VAR A;  1PM9 A;  1PL4 A;  1ZUQ A;  4FFK A;  4YIO A;  1XRE A;  3CEI A;  2AW9 A;  1XUQ A;  1MSD A;  1BSM A;  5AG2 A;  1JA8 A;  1P7G A;  1N0J A;  3LSU A;  1I08 A;  1EM1 A;  1MA1 A;  1VEW A;  4JYY A; 
#chains in the Genus database with same CATH topology
 3T1C A;  2IW5 A;  5LOV B;  2DOS A;  1JMK C;  2H3O A;  4MVS A;  5BR8 B;  3ABU A;  1N33 B;  2YXL A;  2ZCE A;  1MOF A;  4PDM A;  3Q4H A;  4LP8 A;  5IY5 B;  5L3B A;  2OWO A;  5EYP A;  2WLI A;  4TV8 B;  3KKY A;  1D2D A;  2FYU H;  1XNR B;  4AI8 A;  2ZE6 A;  2A9H A;  2QDO A;  3CME V;  4JAU A;  3MAQ A;  1K9M W;  3KCY A;  3ZHS A;  5GTI Z;  4JI6 O;  2IH3 C;  5LXT A;  5H6R A;  4XDJ A;  1YDX A;  2EJ7 A;  2MK3 A;  2ADP A;  3UKM A;  1J5E B;  4DR7 O;  1XI1 A;  3E89 A;  5LP6 B;  1K4D C;  2OYQ A;  4EEQ A;  3H01 A;  1XDC A;  4GUN A;  5BZB A;  1BCC H;  2EJR A;  3E8H A;  2FB5 A;  1ZSP A;  3K06 A;  2QA4 V;  5GW7 A;  5CMU A;  4B7K A;  4X88 A;  1TA8 A;  1W0K G;  1TAE A;  4LF9 O;  2X6A A;  1WB8 A;  3SYA A;  1NVP B;  3OTO B;  1OCR B;  5BY1 A;  4TV9 B;  3ZX6 A;  3OMN B;  3VBB A;  4DR6 B;  2WPD G;  1PL4 A;  5CA1 B;  1ZWI C;  3RYH B;  2GBO A;  4EB6 A;  4MS2 A;  4UCS A;  2ZR3 A;  3OR7 C;  4DV2 O;  5ITZ A;  1LNQ A;  2E76 B;  5CA0 A;  1R6T A;  4IT5 A;  4AHC A;  3GWK C;  1TUB A;  1H2L A;  2DYR C;  3JCU Z;  4GT1 A;  5FNV B;  1IXB A;  4X1Y B;  4I7Z B;  3JAM N;  3DSQ A;  4WBN B;  4QPK A;  1KB9 F;  1SC5 B;  4OX9 O;  2XOK G;  3ZMU A;  5CBH A;  3ASN C;  4PHZ A;  1NTZ H;  4HNA B;  1EN6 A;  4U3F H;  5TIS Z;  1SRY A;  4YXW G;  2WLN A;  4DV0 O;  3K79 A;  4RAI A;  3VQX A;  5HFM A;  5E79 Z;  5JCO A;  2Y0P A;  4CH4 A;  2QM8 A;  5L3E A;  4FLW A;  4OX9 B;  3LSQ A;  4RUF A;  1B06 A;  2FL4 A;  2IJK A;  4LWS A;  4PA7 A;  3HKB B;  3UT5 B;  2AHY A;  2PYL A;  4XDK A;  2RJZ A;  4K3A A;  3T1H B;  1XHZ A;  2IBZ H;  1W59 A;  1XEQ A;  1F7Y A;  4DW0 A;  4BW9 A;  4TQF A;  3AG3 C;  3UQ8 A;  1YHQ V;  3ABK B;  1VIB A;  3P3N A;  1MNG A;  1NH2 D;  4ZKI A;  1GN6 A;  3L71 H;  2P4K A;  4DW1 A;  2A7W A;  1R73 A;  4MTF A;  1G1X B;  3J81 N;  2YDE A;  3JD3 A;  2ZNJ A;  1R1B A;  1V9P A;  2YEV B;  1K7D A;  1WJZ A;  4FK5 C;  4H0L B;  3IC9 A;  1NZ6 A;  3CSX A;  1YSC A;  4X64 B;  3X2Q B;  4NVP A;  2BOB C;  2VQE B;  3L9D A;  4DUZ O;  2QTS A;  1BQZ A;  4WCE V;  1WA8 B;  2KG7 A;  3ZRW A;  2EIJ B;  3EFF K;  1YF2 A;  4PA4 A;  5KHG A;  3HKD A;  1IBM O;  4I50 A;  2EIL C;  2A79 B;  3STL C;  4LF4 B;  1CXZ B;  1BSM A;  1SQB H;  1HNZ B;  4PV1 B;  3TCU A;  1K3E A;  5BMV A;  2OT5 A;  3ICX A;  2ZD9 A;  2ZE7 A;  3VQV A;  4JYA B;  2PI4 A;  1NTM H;  2BCC H;  3SPC A;  4YJ2 A;  4D7S A;  4FLV A;  1Y4M A;  3QO7 A;  1Q90 D;  3UO2 A;  2LGW A;  3APO A;  4GX0 A;  3ZHV A;  2E5L O;  4J7J A;  2IJH A;  1RSO B;  5KHK A;  4QGP A;  1KC8 W;  3OR6 C;  4FLT A;  4DV6 O;  4LFB B;  4BR6 A;  2RCV A;  3WU2 Z;  2CH7 B;  3DC6 A;  1BZK A;  4MVO A;  2OCC C;  2E5L B;  1WB7 A;  2LJ2 A;  4PDR A;  4CS3 A;  3THO A;  1AJQ A;  3CJH B;  2DW4 A;  4DV6 B;  1NU1 H;  4UUJ C;  3AG4 C;  2VWJ A;  3APQ A;  5FL7 G;  1XNQ O;  2XAJ A;  3H1L H;  5EIB D;  5JVD A;  1X59 A;  2ZIO A;  1XNR O;  2VQF B;  3ZHT A;  4JTA B;  2QEX V;  2LO1 A;  3OM3 B;  4JPR A;  1HR0 B;  1I5X A;  2D2C B;  4JZG A;  4JAA A;  2OTL V;  4UV9 A;  1SQQ H;  4QE9 A;  1SQF A;  4I55 A;  1N8R W;  3FFQ A;  4Z1V A;  4IHJ B;  2B9Z A;  5IJ0 B;  2XAQ A;  4X64 O;  3OT7 A;  3JAT A;  4FFB A;  3G67 A;  2HEP A;  2L6L A;  1BHA A;  1WLE A;  1P7G A;  1G4Y B;  1N0J A;  1QR9 A;  2EX3 A;  3W7S A;  4JI1 B;  2EIM B;  2CTQ A;  1I08 A;  1L0N H;  2YIB A;  4B3T O;  4LF4 O;  4DR4 O;  1J5E O;  4AQY O;  2UXB B;  4MVU A;  4MT8 A;  5LA6 A;  4DRX B;  4ZHQ B;  2WSS G;  1Q8I A;  2HR3 A;  1VQK V;  1KYO F;  1AIL A;  4AIL C;  4X1I B;  1SF9 A;  4FM0 A;  1IDS A;  3CC7 V;  3K3W A;  1HP8 A;  4GZR B;  1I5Y A;  4JI8 O;  2DJV A;  2A06 H;  3W7X A;  1M1K W;  2WLJ A;  4X1K A;  2Z3Y A;  3ZRW B;  2GSM B;  3OGI B;  4F6E A;  1NI8 A;  4YHH B;  1U97 A;  5KX5 A;  3MHS C;  1VQL V;  4LFA B;  4ZOL A;  3CCM V;  1Y74 A;  3MHH C;  3CXH F;  1LUW A;  4N21 A;  1WNS A;  5H5N A;  3CYO A;  2QWP B;  1LUV A;  1R3L C;  4YJ3 A;  2LFR A;  3AK3 A;  2QKA A;  3LDC A;  3K0G A;  2R9A A;  3QF7 A;  1JJO A;  4CC5 A;  1YIT V;  3SDL A;  4LF6 B;  2DMX A;  1KP2 A;  3JAW A;  2UUA B;  1Z5W A;  2HP8 A;  3A0R A;  4BWA A;  3U0Z A;  1O9H A;  1R3J C;  2P06 A;  2LW1 A;  1UJW B;  2EIN B;  3WB0 A;  4TOI A;  4LF5 O;  1YTF D;  3F7Y C;  3K04 A;  2JGD A;  4MW3 A;  4KFM A;  4NTW A;  3JAT B;  4FFB B;  4L87 A;  1K5Q A;  1K4C C;  4MVQ A;  3CXC U;  2VQE O;  3EHB B;  2VWK A;  4B3S B;  3E83 A;  4B3R O;  1YI2 V;  2Q7H A;  4UVA A;  2JJ1 G;  4QPJ A;  2R9R B;  3AEI A;  5H6Q A;  4WBN A;  5LP6 C;  4DR7 B;  3J7A U;  5LL6 Y;  3RT3 C;  2GTS A;  1N34 B;  3JAR A;  5KA6 A;  1MZE A;  5LMU O;  1K73 W;  3L72 H;  1HNX B;  3B2E E;  1RPR A;  3FB7 C;  4J9Z B;  3RBZ A;  5DN6 G;  3E2E A;  2Q9L A;  1EZV H;  3AK2 A;  4DR2 O;  5CB4 B;  5IT9 N;  4X65 O;  4J42 A;  4YHH O;  1VQ6 V;  5BMV B;  3K57 A;  3W7W A;  1V55 C;  4DV7 O;  3H1J H;  4BIZ A;  4OPH A;  3MD0 A;  3F5W C;  3P3P A;  1M57 C;  2Q73 A;  4GKJ O;  3T2M A;  1IXM A;  2UXN A;  2LGQ A;  2Q0A A;  5LA6 B;  4DRX A;  1JPX A;  3C3T A;  1V55 B;  2PTM A;  2ZT9 B;  4X66 O;  1URF A;  1JFF B;  2ODM A;  2ZDI A;  4J9Y B;  4DV2 B;  4JI3 O;  5L3F A;  4GKK B;  3E8G A;  2PY5 A;  1QVG U;  1FAF A;  3TGU H;  2KG7 B;  2CTP A;  4CS4 A;  2FML A;  3ZN1 A;  1XRE A;  2M6Y A;  3CX5 F;  5J2U B;  2Q6A A;  4JI3 B;  2K9P A;  2RMK B;  1XMO O;  5JH7 B;  5B1B B;  2Q4P A;  3D36 A;  5LOV A;  1XMQ O;  1PD3 A;  4IGG A;  1DGS A;  3F7V C;  1OJH A;  1WAZ A;  3ZHQ A;  1L1F A;  2OIE A;  4W4L A;  3KCX A;  3AG2 B;  2QSA A;  1TVK B;  3GVM A;  3T1H O;  1F51 A;  3CP1 A;  1Q3E A;  4WFH A;  2DYR B;  4XBF A;  1R6K A;  1YJW V;  3E8B A;  4JI1 O;  1PKX A;  1AI4 A;  3SYO A;  3CCL V;  1QLE B;  5K1X A;  1P7B A;  1EN4 A;  3FYI B;  2GV9 A;  1JCH A;  2G38 A;  1M56 C;  2BE3 A;  1NQT A;  3SJC C;  1QU7 A;  1NR1 A;  1XQ8 A;  3CRR A;  3T4D A;  2QWN B;  1HNX O;  4X9Q A;  1R6N A;  4NB5 A;  4YJ3 B;  4KHP O;  1DK1 A;  4X62 O;  1PNK A;  2LQT A;  3CPW U;  4DUZ B;  3M99 B;  3CRA A;  4JV5 O;  1SZX A;  2L35 A;  1ZLZ A;  1P84 F;  2HJD A;  4ZIB A;  3JAL B;  2F23 A;  3K58 A;  2N74 A;  2HG5 C;  5KLV H;  3ZRS A;  2IU3 A;  1NH2 B;  1THZ A;  4AQY B;  5CA1 A;  1SZT A;  5H2F Z;  3ZHR A;  3I56 V;  3AG3 B;  1DF4 A;  4DV1 O;  2X6C A;  4TV9 A;  2V4D A;  1BT8 A;  4DO2 A;  4CH5 A;  1SER A;  1UPG A;  4UXN A;  4UCR A;  2ILM A;  5IDJ A;  4JGS A;  2WA3 A;  4GLX A;  2Y0I A;  3CB2 A;  2DN9 A;  4YY3 B;  4RO2 A;  2XAS A;  4P2Z A;  3B8N A;  4JI8 B;  2RQ6 A;  5CB4 A;  1IBL O;  1QLE C;  1XHX A;  3UO3 A;  2Z0A A;  2ZIN A;  4XDL A;  4QJF B;  4ZHQ A;  3A0B Z;  1OZ0 A;  5KHJ A;  4MTX A;  4LF6 O;  2B1G A;  1GMG A;  5LP6 A;  3S3X A;  1Z2G A;  1ZAU A;  1WA8 A;  1IZ3 A;  4CS2 A;  2CAZ C;  5IYZ A;  1H2M A;  2DQ0 A;  2JS3 A;  5B1B C;  2ADQ B;  3HKE A;  3N2K B;  3CMA V;  3IGA C;  5JQG A;  1VQ8 V;  1VF5 B;  1NJI W;  3H1I H;  2BOC C;  2ITD C;  1AP6 A;  1KKC A;  5IWA B;  5IYC O;  1M9N A;  1M5I A;  1Q81 W;  3K5M A;  5KAI Z;  1H2K A;  3A8T A;  2WLI B;  1H8E G;  1GO3 F;  3WB1 A;  4PA3 A;  1S5L Z;  3RYF A;  1HNW O;  1QNM A;  1GRJ A;  5LGT A;  5FNV A;  4J80 A;  4LWS B;  1XOU A;  1SA0 A;  2RNB A;  2X6B A;  1JJ2 U;  1H5W A;  1Y66 A;  1JFF A;  3JAW B;  4NTX A;  2DWD C;  5B66 Z;  4Q6G A;  3B09 A;  4I9W A;  1FFX A;  1F23 A;  3T1Y O;  4K0K O;  3SYQ A;  4DV5 B;  4B3R B;  3CCU V;  2PI5 A;  4HYO A;  3CS5 A;  3S3W A;  5HFL A;  4O4I B;  3RYI B;  2HJF C;  5FPO A;  1M93 A;  4I0X A;  4W4K A;  4K0K B;  1AI7 A;  2JK5 C;  2QWO B;  2F66 C;  4LF8 B;  2HKO A;  1N34 O;  1E1Q G;  4KXR A;  4O2B B;  2AZ2 A;  1KQS U;  4LF9 B;  4EB6 B;  3QNE A;  3M8A A;  1YJ9 V;  5B3S C;  2UXC O;  4R8C A;  1MA1 A;  1IBL B;  3BRC A;  1GM7 A;  4LF8 O;  4RWU A;  2EZO A;  4HZ3 A;  1FPO A;  3JAS B;  5D5Q A;  4JYY A;  5KUK A;  1VQN V;  1VQM V;  4BW5 A;  1RM1 C;  2VS0 A;  1VQ5 V;  4JI0 O;  3N2G B;  4X1I A;  1PL0 A;  3KDR A;  4DV7 B;  2Q68 A;  3CRQ A;  1JVM A;  4X89 A;  3LSS A;  4LFA O;  2R9I A;  4FM2 A;  2X7R B;  1CP9 A;  5C8Y A;  1VQ9 V;  5LGU A;  1M56 B;  3JSL A;  1VQO V;  1BMF G;  2JGD B;  4JTD B;  3QO8 A;  4TT3 G;  1H38 A;  3RYF B;  4CH3 A;  2EIK B;  1QBZ A;  5IWA O;  3QVN A;  4DYL A;  5J2U A;  3B40 A;  2OCH A;  4UVB A;  2CDY A;  3OFN G;  4PDV A;  3ABM C;  4F6R A;  2DWE C;  5JQG B;  2YUA A;  1YZB A;  1SES A;  3RVZ A;  3JD2 A;  5LGN A;  1XMQ B;  3HKE B;  3N2K A;  3PN1 A;  4WF9 V;  4DR5 B;  1OCZ B;  4FJC C;  3ZN0 A;  2UUC B;  2Q7E A;  4JYC A;  3AG2 C;  1GH6 A;  4JI4 O;  4B3T B;  4R7C A;  4NTY A;  2UXX A;  3OD4 A;  4R6Z A;  4LFC B;  2BSK B;  4FMT A;  4FLX A;  2Q5Z A;  4X62 B;  2A3Q A;  3D36 C;  3OEE G;  1WP8 A;  3CCQ V;  5EBM C;  3L75 H;  2BTQ B;  2N04 A;  1XUQ A;  1BL8 A;  4UB8 Z;  4GX5 A;  2ZQM A;  1HDJ A;  4JI2 O;  3TK1 A;  2W0X A;  4FLU A;  3ZMZ A;  2WLL B;  2Y69 B;  1VMG A;  4ZBM A;  3ASN B;  3T1Y B;  3ZRX A;  4FIP C;  3I55 V;  4L8J A;  4J7K A;  2V7Q G;  3CC2 V;  5ITZ B;  2UXC B;  1K92 A;  1AR4 A;  3FAV B;  1OCZ C;  2EUL A;  3IFX A;  1U96 A;  4LF7 B;  4YJ2 B;  2XT9 A;  4X65 B;  1YJN V;  1MAB G;  3K59 A;  3CCJ V;  2PF4 E;  1MG1 A;  2UXD B;  3ABK C;  4O2A A;  3TJT A;  1ZL8 B;  3ASO C;  1EN5 A;  3RYC B;  3TET A;  4NXN B;  3CCV V;  4OXS A;  1YIJ V;  3NXS A;  2P5O A;  3ABT A;  2WLM A;  3EVK A;  2AXT Z;  2JIZ G;  5H9C A;  4DV4 O;  4X66 B;  1WPX A;  3L74 H;  4O4J A;  2GHY A;  4NXN O;  4LCU C;  3DTU B;  4GKK O;  3OW2 U;  1S0V A;  4H44 B;  1BS3 A;  5JWP A;  5GON A;  4I4T B;  5LBQ A;  4O4H B;  2NNU A;  1PPJ H;  4D6T H;  1L0L H;  3RN4 A;  1VF6 C;  1N32 B;  2WLK A;  4PD4 F;  4TWK A;  3E22 B;  5D5P A;  2KQX A;  1M90 W;  2BTQ A;  1XMO B;  1K8A W;  3UCS C;  2F93 B;  1V54 C;  2CE4 A;  4DR5 O;  4B3S O;  1AVM A;  3IAY A;  2B5U A;  4G27 B;  1M4U A;  1YXB A;  3RW0 A;  3CCS V;  3KZI Z;  4H37 A;  1OCO C;  2DYS C;  1MSD A;  2PUS A;  3BPZ A;  3K9A A;  1VF7 A;  4JAS A;  2JEU A;  3GWO A;  5CN0 A;  1ORQ C;  2JDI G;  3BAA A;  3G6E V;  3AG7 A;  5KAF Z;  3WG7 C;  5LYJ B;  1FYJ A;  2W6I G;  4E4E A;  3BCC H;  5B1N A;  1OHH G;  4ZI7 B;  3QO5 A;  3EXA A;  1IX9 A;  1SKV A;  4CZZ A;  2O57 A;  4YIP A;  2Q67 A;  2ZE8 A;  1SQX H;  1W2B U;  3N2G A;  3K0D A;  2Y4U A;  2ARH A;  4O2A B;  4EFB A;  2Y4T A;  4KHP B;  2ZM6 O;  3B8M A;  4DV3 O;  4UCV A;  4ZOL B;  2X0L A;  5EZY B;  1Y76 B;  3LDD A;  4GKJ B;  2GDS A;  2Q0O C;  5FPR A;  3MDS A;  3NR7 A;  1GN3 A;  5B3S B;  2D3O W;  4JYB A;  2ZM6 B;  4X1K B;  1NS1 A;  2WLH A;  4JZ2 A;  4LBE C;  3K03 A;  3FX7 A;  4OPA A;  1NBM G;  1SS3 A;  2JEX A;  1D5N A;  1OCR C;  3CRM A;  4O4I A;  3ETG A;  4WFB V;  5GTH Z;  1YTF B;  3JAR B;  4LR3 A;  3G4S V;  3PJS K;  2PZS A;  4C7U A;  2DQ3 A;  1Q6I A;  2GUZ A;  4JF3 A;  4FVM A;  2NN4 A;  1XIL A;  1T5E A;  1VQ7 V;  3H1H H;  1VAR A;  1KUQ A;  2YS8 A;  3RYI A;  3LNM B;  3G6B A;  2P6J A;  3E22 A;  1S77 D;  3G71 V;  1PNL A;  2P22 C;  5LXT B;  5EC2 C;  2KSD A;  2UUC O;  2IJI A;  2KKW A;  1GKF A;  3JAK A;  3ABL C;  4TV8 A;  1XL4 A;  1G6U A;  4P9P A;  3P30 A;  2QKC A;  3OEH G;  4LC1 A;  4FZ0 A;  2CTR A;  1I0H A;  3B77 A;  3RYC A;  1FXK A;  1S5H C;  1Z5V A;  1GN2 A;  2Q7G A;  1YCI A;  2HVJ C;  2WWW A;  2F43 G;  1VP7 A;  2RDC A;  5KMG B;  5JH7 A;  4FLZ A;  3CWB H;  4JV5 B;  5CA0 B;  4UCU A;  4B7E A;  1MSW D;  2YXY A;  3HR0 A;  2V1D A;  2AHZ A;  3RWR D;  4JI4 B;  4DR3 O;  3K5N A;  2EIK C;  1Q5O A;  2Y69 C;  3FB5 C;  5B1O A;  1G8M A;  2P67 A;  4DV1 B;  5GON B;  1EZJ A;  5B5E Z;  1Y6X A;  1A32 A;  4RQE A;  3IJ4 A;  4JI2 B;  2EIN C;  2CGN A;  2YC0 A;  2UXD O;  1IJG A;  5KX5 B;  3AG1 B;  3CC4 V;  1H2S B;  3OMI B;  5EIB C;  4RUE A;  2JS5 A;  1NTK H;  2YSU B;  3HKD B;  2XUM A;  3JD1 A;  1FS0 G;  5CA3 A;  1R3K C;  3G80 A;  1AJN A;  4KP4 A;  3VQW A;  3T4Z A;  1AB3 A;  4NR1 A;  1AR5 A;  3CHX A;  4IIJ B;  1ZUQ A;  4LF7 O;  5C93 A;  1KKD A;  2AW9 A;  2DYS B;  4NKG B;  3ZIA G;  4JI7 O;  2YI8 A;  2CTW A;  2HFE C;  2LP7 A;  4RQF A;  3F5T A;  2OCC B;  4E2L A;  4DR1 B;  4B3M O;  2F4V O;  2ITC C;  3CCR V;  2YI9 A;  1H8H G;  4KL1 A;  1OCC B;  1NVP D;  1KMI Z;  2EIJ C;  1RFY A;  3VOU A;  1ARO P;  5B1A B;  4Q20 A;  3RFR A;  4CC6 A;  3M7M X;  1FXH A;  3UT5 A;  3OTF A;  1HNW B;  3STZ C;  5C8Y B;  1DTO A;  4UCO A;  1KU9 A;  1N32 O;  4MVR A;  3I5D A;  4X1Y A;  1N4C A;  1E1R G;  3KG2 A;  1RM1 B;  5KUM A;  4H33 A;  3W7T A;  1IUR A;  1FJG O;  1Y67 A;  1TVK A;  5A9G A;  3CCE V;  4O4H A;  4DV5 O;  2GUZ B;  4WFF A;  1ZX3 A;  4J41 A;  2MW2 B;  3ASO B;  4PA9 A;  4IYI A;  3ZS8 C;  3ZMS A;  1FJG B;  3FKS G;  5EBW C;  3DC5 A;  4FZ1 A;  2R72 A;  5B1A C;  4DV3 B;  1H2N A;  1H2G A;  3H1K H;  5JJJ B;  3E35 A;  3R66 A;  3BHP A;  2QWR B;  3K5O A;  4G28 B;  2P7T C;  1AI6 A;  1Q6U A;  4IIJ A;  2ZKO A;  1Y76 A;  3K08 A;  2ZR2 A;  4MSW C;  3QG5 A;  3ZHU A;  2F95 B;  3HB3 B;  3SJA C;  2QM4 A;  1EBO A;  2UU9 O;  2XND G;  4K8X A;  4PI2 A;  4I5S A;  4UVC A;  2YXH A;  1FD9 A;  1YEW A;  5L3C A;  1WPB A;  3OUF A;  3ZCC A;  4TUY A;  1OCO B;  2PGG A;  4JI7 B;  2ZXW C;  3OMA B;  4D7T A;  1KBH A;  4YY3 O;  4DR6 O;  2ATK C;  4GX2 A;  4DK0 A;  1WN7 A;  1QQC A;  5KMG A;  1US6 A;  3JSN A;  3E86 A;  3OGC C;  4J11 A;  4B3M B;  2YEV A;  2QE7 G;  1MMM A;  5DEC A;  4ZI7 A;  4PJ0 Z;  4U7N A;  4BIO A;  2H8P C;  1KP3 A;  2HLD G;  4IHJ A;  1XNQ B;  4DV4 B;  4P9O A;  4CBC A;  2IM9 A;  5JVD B;  2VRZ A;  4GYC B;  2XTA A;  5IJ0 A;  3HPL C;  1JR9 A;  4J10 A;  1VQP V;  5LHI A;  4PA6 A;  2UUB O;  4K35 A;  4G2K A;  3U11 A;  1HR0 O;  1V54 B;  3SPG A;  4EFE A;  1GM8 A;  1DLB A;  4MW8 A;  3HKB A;  4LFC O;  4QE7 A;  1B6Q A;  3O9O A;  3LDE A;  2UUB B;  1BE3 H;  3SPI A;  3AG1 C;  3ZED A;  5KHH A;  4UCT A;  2ZDI C;  1NT2 B;  1KEC A;  1QCE A;  4I4T A;  4DR3 B;  3SPH A;  2Y48 A;  1RPO A;  1WP7 A;  4BAY A;  3LNN A;  1Q7Y W;  3JAK B;  1E79 G;  3VQY A;  1W0J G;  2EIM C;  2QKS A;  3JYC A;  1Y74 B;  4MVM A;  2UXB O;  2M7W A;  3L70 H;  3CJH A;  2ZE5 A;  4BIU A;  3BEH A;  1GM9 A;  1YVW A;  1B3Q A;  1JA8 A;  5JJE B;  3OTO O;  3UM7 A;  4K8Z A;  2EBO A;  3FAV A;  3JAS A;  2NR5 A;  4FPP A;  2HHH O;  3ZRV A;  4R50 A;  2Q69 A;  3RGB A;  2UU9 B;  2H94 A;  1FXK C;  3P32 A;  4DUY O;  1Q86 W;  1D5A A;  2QWQ B;  3E8F A;  4ASU G;  1XBL A;  3ABL B;  1SQV H;  4X20 B;  2F1M A;  3HKC A;  3RVY A;  3RYH A;  2EZP A;  5EK0 A;  1HNZ O;  1KD1 W;  5J9P C;  2BSK A;  2W6J G;  4TUY B;  4HBN A;  1PV0 A;  2IH1 C;  3ML0 A;  2F4V B;  5IJ9 A;  4U7O A;  1X4T A;  1J95 A;  1VQ4 V;  1I7F A;  2PYJ A;  4P30 A;  2XAG A;  4JI0 B;  3ZJZ A;  3D8C A;  2XAF A;  1Q43 A;  2KB1 A;  3K9S A;  1FFX B;  1N36 O;  2IJJ A;  4PI0 A;  2BTO A;  5LHH A;  5K1P A;  2LFS A;  3SYP A;  4NXM O;  5J2T B;  4PDL A;  1NKD A;  2AGA A;  5EYP B;  4DXW A;  1K33 A;  1BGY H;  5L3D A;  4FLY A;  4F6R B;  1AR1 B;  1DF5 A;  2NLJ C;  3OE7 G;  3ZMV A;  1FXK B;  4NXM B;  2Z5U A;  4MTG A;  5LMN B;  4EKW A;  2ETN A;  4JI6 B;  3CD6 V;  4I9Q A;  4O4L B;  2DE0 X;  1UFI A;  3BA8 A;  1HWY A;  3B4S A;  3BFR A;  3WFV A;  2Q8V A;  4LNU A;  1M57 B;  2W0F C;  5BR8 O;  2OIG A;  3J80 N;  4YIO A;  2E74 B;  3CEI A;  2XAH A;  4X8A A;  1GTO A;  3DXR B;  4UB6 Z;  3CE2 A;  1JNB A;  3SYC A;  1IVS A;  1GAX A;  1R3I C;  4QNH B;  4N23 A;  5L3G A;  3IC7 A;  2QTO A;  1SQP H;  2CH7 A;  1EM1 A;  3FYE B;  2FKX A;  1FKA O;  1VEW A;  3BY6 A;  1ROP A;  1IBM B;  1SET A;  1O9G A;  1Q6H A;  4O4J B;  1ENV A;  2HHH B;  2HVK C;  2CUG A;  1ZL8 A;  1ZTE A;  3OUS A;  4Z1M G;  4DUY B;  1CEZ A;  2YIB D;  3A0H Z;  1NR7 A;  3LUT B;  3U10 A;  3AG4 B;  3ABM B;  2P90 A;  1RSO A;  5F2V O;  1S3J A;  1QR8 A;  4DR4 B;  3JCZ A;  1TUE B;  5EBL C;  1F4M A;  3GB7 C;  3D3Q A;  3FB8 C;  3SJB C;  1CPY A;  3ZBH A;  3C3S A;  1BQ0 A;  2GTA A;  1OV9 A;  1K34 A;  1N0N A;  3WB2 A;  1LR1 A;  1GN4 A;  5EC1 C;  5IYB O;  1QVF U;  1P4R A;  5FLX N;  4I0X B;  1L8D A;  5LYJ A;  4H13 B;  1PP9 H;  2IU0 A;  3JD4 A;  1N36 B;  4WFA V;  3D3I A;  1MZF A;  4U3J B;  1SA0 B;  4NYK A;  3X2Q C;  5CBF A;  4IYH A;  5LHG A;  3JD0 A;  4OGQ B;  1IBK B;  4GCZ A;  2AZ0 A;  1P49 A;  1PNM A;  3O65 A;  3SGI A;  5IYD O;  4JI5 B;  1OCC C;  2WAM A;  4CH6 A;  2ZNI A;  1XL6 A;  4F4L A;  4I55 B;  2WLL A;  2EIL B;  3Q4H B;  3FB6 C;  4LH7 A;  3DXR A;  4WFE A;  5DM6 V;  1GK9 A;  2JGU A;  4JI5 O;  2QJ1 A;  4DK1 A;  5IYZ B;  5CBG A;  1F4N A;  3LSU A;  1HW7 A;  3QTC A;  5LMN O;  3K5L A;  5J2T A;  4O4L A;  2N05 A;  2E75 B;  2YIA A;  3ETD A;  5KHI A;  2K1E A;  4LF5 B;  2JRI A;  4Z2W A;  1AI5 A;  2B1I A;  2LW7 A;  4J7Z A;  2ZXW B;  1JX9 A;  3W7U A;  4JAV A;  1S76 D;  5IE9 A;  3SJQ C;  5JCO C;  4UV8 A;  2QR4 A;  3WG7 B;  4HAM A;  3TXS A;  3R65 A;  4HNA A;  3N27 A;  2P4V A;  5KA5 A;  1EFR G;  2CK3 G;  1S72 V;  4PEL A;  1FOU A;  3C90 A;  1FFT B;  2XHB A;  1QHT A;  1K97 A;  4JYA O;  2OTJ V;  1AP5 A;  4LH6 A;  4FM1 A;  3BVO A;  2YID A;  2JJ2 G;  3BA9 A;  4UFZ A;  1BHB A;  1VF6 A;  3ZMT A;  1Q82 W;  3FD9 A;  5EZY A;  2RN9 A;  4U3J A;  1B04 A;  4TSF G;  2A0L A;  5IJ9 B;  3JAL A;  1TGO A;  2R70 A;  2JVD A;  5LMU B;  3AK1 A;  1SQG A;  1TUB B;  2FTK A;  2QGN A;  1FXV A;  4GX1 A;  3HKC B;  3OAA G;  5IY5 C;  2ZIM A;  4X20 A;  3TXQ A;  4ICG A;  5E1A C;  4IL6 Z;  4DR2 B;  2E3C A;  4KUM A;  1S5J A;  4I50 B;  4MVZ A;  3A2F A;  4DR1 O;  1COW G;  3DGE A;  2YIC A;  3L73 H;  4A5U B;  4JTC B;  3BAB A;  5DED A;  4B08 A;  3CRC A;  1PM9 A;  3H9V A;  4MTO A;  5JJN B;  3ETE A;  4FFK A;  4QIW F;  3SR2 C;  3ETQ A;  1RP3 B;  4O2B A;  1K5S A;  1QLN A;  1I94 O;  4ABM A;  2C2A A;  2QM7 A;  1JQ0 A;  4DV0 B;  5A2Q N;  2WA4 A;  5AG2 A;  3SPJ A;  4LNU B;  4TQD A;  2VQF O;  1N33 O;  2UUA O;  4WFG A;  4LFB O;  1AJP A;  2CGO A;  1IBK O;  5BXZ A;  1I94 B;  1JOY A; 
#chains in the Genus database with same CATH homology
 1IXB A;  4E4E A;  2QKC A;  1AR4 A;  1IX9 A;  1I0H A;  4YIP A;  3KDR A;  1ZTE A;  1MMM A;  2ADQ B;  1IDS A;  1GN2 A;  1EN6 A;  3KKY A;  4BR6 A;  2RCV A;  1AP6 A;  1KKC A;  3DC6 A;  1EN4 A;  3TJT A;  1B06 A;  1EN5 A;  1JR9 A;  1WB7 A;  4F6E A;  2GDS A;  1Y67 A;  3MDS A;  3C3S A;  5A9G A;  1GN3 A;  3K9S A;  3AK2 A;  1N0N A;  3EVK A;  2ADP A;  1GN4 A;  1AP5 A;  3QVN A;  4X9Q A;  4JZ2 A;  1QNM A;  2CDY A;  1XDC A;  1LUW A;  1MNG A;  4GUN A;  1D5N A;  1GN6 A;  2P4K A;  1ZSP A;  1SZX A;  3AK1 A;  3DC5 A;  1ZLZ A;  1LUV A;  1BS3 A;  3AK3 A;  4C7U A;  2QKA A;  3IC9 A;  3RN4 A;  3C3T A;  4JZG A;  1WB8 A;  1XIL A;  1BT8 A;  3BFR A;  2CE4 A;  3OT7 A;  1AVM A;  1AR5 A;  1VAR A;  1PM9 A;  1PL4 A;  1ZUQ A;  4FFK A;  4YIO A;  1XRE A;  3CEI A;  2AW9 A;  1XUQ A;  1MSD A;  1BSM A;  5AG2 A;  1JA8 A;  1P7G A;  1N0J A;  3LSU A;  1I08 A;  1EM1 A;  1MA1 A;  1VEW A;  4JYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...