1ZLZA

Re-evaluation of the low-temperature azide in mn-dependent superoxide dismutase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Azide Adduct of the Y174F mutant of Manganese superoxide dismutase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 74
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zlzA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zlzA02
1MMMA 1VEWA 3AK3A 1Y67A 3KKYA 1AP5A 1IX9A 1I0HA 3LSUA 1BT8A 1BS3A 1PM9A 4JZGA 3AK2A 4YIPA 2ADQB 3K9SA 1AR5A 1XILA 4FFKA 1ZLZA 1XREA 1AP6A 1EN5A 4GUNA 1XDCA 1XUQA 1JA8A 1MA1A 2AW9A 3IC9A 3DC5A 1D5NA 2P4KA 1BSMA 1KKCA 1WB7A 3RN4A 1N0NA 1JR9A 1VARA 2QKCA 2RCVA 3TJTA 1GN4A 1ZUQA 1ZSPA 2QKAA 1GN3A 3QVNA 3OT7A 1SZXA 3CEIA 4E4EA 3MDSA 4X9QA 3C3TA 2ADPA 3DC6A 1WB8A 1N0JA 1IDSA 5A9GA 1I08A 4BR6A 1LUWA 3BFRA 1MNGA 2GDSA 4F6EA 1ZTEA 1IXBA 1PL4A 3AK1A 1P7GA 1EN6A 1LUVA 4JZ2A 1EM1A 1GN6A 1QNMA 1MSDA 1AR4A 1EN4A 1GN2A 3C3SA 2CE4A 3EVKA 5AG2A 4C7UA 1B06A 2CDYA 1AVMA 4YIOA 4JYYA
chains in the Genus database with same CATH superfamily
1KYOF 2X6AA 1YIJV 1VQ8V 3K59A 5H9CA 2QGNA 2JJ1G 4FPPA 3OMIB 4O2BA 1R3LC 2ETNA 4A5UB 2HJDA 4DR6B 1YXBA 4X65B 4DK0A 4YIPA 3P32A 1GTOA 1KP3A 3KZIZ 3AG2C 1K34A 2N04A 2LFSA 5JVDA 2P4KA 1FXVA 4QE9A 4GKJB 2ARHA 1QR9A 2QWOB 2VQFO 2QKCA 3JD1A 3TK1A 1VQPV 1NR1A 3MD0A 3EFFK 5E79Z 1S5HC 2Q0AA 3OW2U 1XMQB 2DQ3A 4H13B 1K4CC 3JAWB 5CBFA 3RYCB 4OGQB 1RP3B 3C90A 2P22C 4DV2B 4JI4B 3JAMN 3SYCA 1VQ6V 2OT5A 1YF2A 1J5EO 4DV4O 4TUYA 4W4KA 2X0LA 1AI5A 1PD3A 1GK9A 4DYLA 2FMLA 4R8CA 5LA6A 4J7KA 4MSWC 2F95B 4X1YB 3EXAA 5B66Z 4IL6Z 3EVKA 3RGBA 3A2FA 4RAIA 1KD1W 3APOA 4NVPA 1QVGU 3P3PA 3J80N 3K5LA 4DR1O 3U10A 2B5UA 1S3JA 3RVYA 4GZRB 5FNVA 1QVFU 2GSMB 3LNMB 2OYQA 2EZOA 3HR0A 3CCMV 4FVMA 3LSUA 4YHHO 1N34O 1H2GA 1HR0B 3LSQA 1URFA 1I7FA 1AR5A 1SZTA 1NZ6A 1JFFA 3U11A 4Z1MG 1Q7YW 1KKDA 3SJBC 2UXCB 4O2AB 3ZHSA 1K92A 4IIJA 4UCRA 4X1KB 4CS3A 4DV5B 5IY5B 4UCTA 4D7TA 3KCXA 4PD4F 3FYIB 1JJ2U 4JI8B 3RBZA 2R70A 1I5YA 1WJZA 2YEVB 3UT5B 1GN4A 1ZUQA 4KL1A 1R6TA 1ZSPA 2ZXWB 1GN3A 2UUAO 1IVSA 4DV7O 3JALA 3CEIA 3TXQA 1NS1A 4PA3A 2ZE6A 4FK5C 5JJNB 1OCZC 3ZS8C 5EIBC 3JAKA 3VBBA 3H1JH 1M57B 4J9ZB 1L0LH 5H2FZ 1R1BA 1NR7A 2WLKA 1M9NA 3AG1B 4O4JA 4B3MO 5JQGA 3X2QB 3HKDA 1XMOB 5KUMA 4K0KO 1BHBA 1MSWD 3K04A 4Z1VA 4TOIA 1NKDA 4NXNB 4O4HA 3RYFB 3DXRB 4I0XB 4JGSA 2LW7A 2GHYA 4UB8Z 4JTAB 1GRJA 3G6BA 2BTQA 1AI4A 4DV3O 2UXBO 3BA9A 3BABA 2Z5UA 4TSFG 1GO3F 1I0HA 5LMNB 3HKCB 1N36O 4HBNA 1D5AA 2OCCB 1SQXH 5EIBD 2GBOA 3E35A 4FLWA 4FLUA 4IHJA 5BMVA 2P6JA 4FFKA 2B1GA 3STLC 3W7WA 5CB4B 3DTUB 3K57A 4U3JB 2ZT9B 1WAZA 3RFRA 3IC9A 2QM4A 4YY3O 2X6CA 3B8NA 3T2MA 1V54C 2ZNIA 1YDXA 2HLDG 2XT9A 4O4LB 1GH6A 5IJ0A 2ZE7A 5EC1C 1Y6XA 3CCSV 2VWJA 4UCUA 4ZOLB 4KXRA 5EBLC 2HHHO 3VOUA 4DRXA 2MK3A 1JPXA 2A79B 3N2GA 4UVAA 1VQ4V 4U7OA 3RWRD 3ZN0A 3ZHRA 4UVBA 4PELA 1Q5OA 2DN9A 1IBKB 3CXCU 3SDLA 3ABMC 4ABMA 5LGUA 3KCYA 1PNKA 3D3IA 1WPXA 1W59A 2E75B 2CH7A 1QHTA 1SERA 4LF7B 1NU1H 1V9PA 1DK1A 4GKKB 1R3IC 2E5LB 4X89A 2JEUA 2DWEC 1XHXA 2YIDA 1QQCA 5LMUB 2JS3A 2CAZC 1FOUA 3U0ZA 2IH3C 1XEQA 3O9OA 4Q20A 1BMFG 3JD0A 4PJ0Z 2YIBD 1AJNA 3CYOA 3FKSG 4WBNA 1U96A 5JCOA 4MTFA 2L35A 4MT8A 2V1DA 4DUZO 5LGTA 1X59A 1U97A 4XDJA 1YSCA 4NXMB 4DR7B 1VQ7V 4FLZA 5HFMA 3J81N 4J10A 4I9WA 3TETA 4LF4O 5GW7A 4X66B 5LYJA 3CC7V 5GONA 1FFXB 1GMGA 2A7WA 2JVDA 1VQOV 3E8HA 1Q90D 1SQGA 1HDJA 1YJNV 3THOA 1K97A 3RN4A 5JCOC 3DSQA 4ZI7A 1WLEA 3K03A 3HPLC 2Q0OC 1SF9A 2R9IA 1JVMA 2YXHA 2Q7HA 1WN7A 4ZIBA 4E4EA 2WWWA 2FTKA 3CCVV 2UUBO 2JS5A 2OIGA 3VQWA 1M56C 1NVPD 3GWOA 3F7VC 1P84F 1O9HA 2ZM6O 2H3OA 4MS2A 1YITV 2YXYA 4PA6A 1LUVA 2ATKC 2KQXA 4KUMA 1HP8A 2YIAA 2UUCB 2LP7A 4LF6B 4LF8O 1H8HG 2RJZA 5TISZ 5EZYA 1P7BA 3ASNB 2ILMA 2CE4A 4DO2A 3RVZA 4AI8A 4AILC 3T1YB 4DR4B 3IJ4A 1B06A 3JD4A 4I4TA 1QBZA 1WP7A 1JOYA 3OR7C 1TUEB 4UXNA 3ZRWB 4JI7O 1NQTA 4JI2O 1P49A 5BY1A 1Q81W 5KUKA 4JI6O 5IWAB 1IZ3A 5IYCO 4X1IA 2F43G 1VEWA 2NR5A 1ZL8B 3AG2B 1K4DC 1Z5WA 4H33A 1H5WA 5DEDA 4J41A 4UCVA 1B3QA 1K5SA 3K5MA 3CRMA 2Q7GA 3SPGA 1Q43A 4DR3O 4G28B 5IYDO 2WLJA 5J2TA 4K35A 4LF5O 4GX0A 1N33O 4O2BB 4LNUA 5JJEB 4TV8A 4F4LA 1TVKA 1D5NA 1FXHA 4G27B 1CPYA 1KKCA 1WB7A 3ZRXA 1D2DA 1GM8A 4DR5O 2EILC 4CS2A 4WCEV 1OCCC 3FB8C 4RQFA 3RYHA 5KAFZ 5JVDB 1M4UA 2EX3A 3N2KA 3AG7A 4DV1B 1B04A 1WB8A 3D3QA 1F23A 2P4VA 1Y74A 1SS3A 5B3SC 5CA1A 1H38A 2ZIOA 4G2KA 4RUFA 4CH4A 1F7YA 3ASOC 3IC7A 1SKVA 2A0LA 3CD6V 1UPGA 4DV6B 1I94O 3L74H 4PV1B 4JPRA 4QPJA 5HFLA 3VQYA 4LR3A 1BCCH 3FD9A 1MSDA 2DWDC 1CEZA 4RO2A 4CH6A 3OUFA 4TUYB 2PYLA 2ZNJA 4C7UA 3K9AA 5LA6B 3NXSA 1XQ8A 3CSXA 3OTOO 1TUBA 5CA3A 3ZHVA 1FKAO 2BOCC 4FLTA 1HNWB 5LHHA 1DLBA 3TCUA 3ZMTA 2A3QA 2VQEO 3N27A 4X20A 3QO8A 5FPOA 3L9DA 3K79A 3BY6A 3ZEDA 1TGOA 4LH6A 1BT8A 3M8AA 4JV5B 3WB1A 4K3AA 5FNVB 2YSUB 3E22A 2W6IG 4LFAO 4NTYA 1AB3A 1F4NA 1H2SB 2NLJC 4J9YB 4LFBB 2R9RB 4F6RB 5L3BA 1N32B 3CCQV 2Q4PA 3CX5F 4FLVA 4H37A 4LH7A 1JFFB 1FFTB 4X62O 2HEPA 1V55C 3BAAA 4IIJB 1YHQV 2JK5C 1OCZB 1MZFA 3CS5A 1UFIA 3ABTA 3BEHA 4QPKA 5ITZA 3WFVA 2GTAA 3C3TA 4PA7A 4CC6A 2ITDC 2WA3A 5IJ9B 3CC2V 2IH1C 1N4CA 3D36A 2ZQMA 3UM7A 2GDSA 2AZ0A 3F5TA 3JALB 2M6YA 3HKEA 2FB5A 2XAJA 3CHXA 1SC5B 4CZZA 3H1LH 1KU9A 4JAAA 3JAKB 1M1KW 3L75H 2WLIA 2DOSA 1K8AW 1EN4A 1THZA 3D8CA 4QE7A 3STZC 2XTAA 2KB1A 3ZHQA 3D36C 4UUJC 4O4JB 1EBOA 5JQGB 2OIEA 3HKDB 1BQ0A 1YI2V 4B3TO 1FJGB 4JYYA 1SQQH 2YDEA 2YS8A 3M7MX 4O4HB 4MVRA 1EZVH 4JI0O 3ZRSA 3A8TA 4DUYO 3E8FA 2ZCEA 2IU3A 4J7JA 2WLLA 1IX9A 3I5DA 2VRZA 3P3NA 2ZIMA 3OMAB 4FM0A 4X64O 2DMXA 3W7SA 4JYBA 1V54B 1JCHA 2BTQB 4DV3B 2Y0IA 2EJ7A 1EN5A 2LO1A 3FB6C 3ML0A 1IURA 4JYCA 2RN9A 1XBLA 4U3FH 4GX2A 1LNQA 3CJHA 5BR8O 2E3CA 2JJ2G 4IHJB 2ZR2A 5BMVB 2XHBA 1JR9A 2P5OA 5KX5A 4Q6GA 1W2BU 4OX9O 3IAYA 4B3SO 2QR4A 3ICXA 1NJIW 1IBLO 1DTOA 3CXHF 5CA0A 1HNXO 4WF9V 4L8JA 4QGPA 4NKGB 1Q8IA 4MW8A 2PY5A 2ADPA 1YJWV 5EYPA 1YVWA 3WG7C 3L71H 3WB0A 5IJ0B 5JWPA 3ABMB 4Z2WA 3G6EV 1H2NA 1SQVH 3FX7A 3CRCA 4UV8A 4X88A 2WAMA 4DRXB 5J9PC 2HHHB 4DR2O 1SQPH 3N2GB 4DR6O 4X65O 5E1AC 3CPWU 4YXWG 3OE7G 2EIJC 2GV9A 4NTWA 2OTJV 2BSKB 1VF6A 3JASA 4ICGA 2RNBA 3OEHG 4DV0B 1VMGA 4GKJO 5EBMC 4OPAA 2CH7B 4LBEC 2ODMA 5BZBA 2Z0AA 4YJ3A 1DF5A 4N21A 2HP8A 5LGNA 5EK0A 1Y67A 1QCEA 2DYSC 1XMQO 4FZ1A 2UXDB 3JAWA 3I56V 1AJQA 1NTKH 3HKBA 2XAFA 1VF6C 5KA5A 1BS3A 4FMTA 4DV2O 4WBNB 4JI4O 1AR1B 1XREA 1IBMO 4HNAA 2CUGA 2GUZA 1HW7A 1K7DA 3OGCC 1JA8A 4FLYA 4JAVA 4BW5A 1NTMH 4LF9B 2F23A 4I5SA 2WLNA 4JYAB 4J11A 3R66A 1G6UA 5LYJB 4MTXA 3E2EA 4FJCC 5L3FA 5GONB 2DYRC 3JD2A 1XOUA 1BGYH 1M56B 5KHHA 4I9QA 4IYIA 4IT5A 2YIBA 3CCLV 2Q67A 4BIZA 4ZI7B 1RSOA 4JI5B 1OZ0A 4ZHQA 5A9GA 2DJVA 3OMNB 4DW0A 1BL8A 3SYPA 4I50A 2QKSA 5CBHA 1DGSA 2PZSA 4JI1B 1COWG 2X6BA 5CMUA 3ETGA 1VQKV 5C8YA 1G4YB 2E76B 1HR0O 4B3RO 3I55V 1Y76A 2ZM6B 2K9PA 1OCRC 2AHYA 3ZRVA 2IM9A 1RPOA 3A0RA 1VIBA 1E79G 3O65A 5AG2A 5EC2C 4DV5O 1VQMV 4CBCA 2H8PC 3G67A 4JI8O 2JIZG 5EZYB 2EIKC 3ABLC 5LBQA 3JCZA 3P30A 3AG3C 3AK3A 4I4TB 1T5EA 1B6QA 4JI2B 4HZ3A 1NH2B 1YTFB 2JGDB 1PM9A 3SPIA 5KMGA 1VQ9V 2W6JG 4TV9A 4AQYB 2PF4E 3OFNG 2EILB 4GUNA 2QTOA 2AW9A 1QLEC 4XDLA 2N74A 1R6KA 2LGWA 2CGNA 4EKWA 1S72V 5J2TB 1ROPA 4LF5B 1TVKB 5DN6G 4CH5A 5B3SB 2LW1A 5L3DA 1KQSU 4NXNO 5JH7A 1OJHA 4HAMA 1L8DA 2FKXA 3OT7A 4PDVA 3ASOB 5H6QA 1Q6IA 3AG4C 1PV0A 2QWQB 1J95A 2EINC 4CC5A 3K06A 4LWSA 3RYHB 1ZWIC 2PI5A 4F6EA 3N2KB 1JMKC 4J42A 1SETA 1OCOC 4FM1A 3T1HB 4B7EA 3AK1A 5DECA 5LMNO 5B1AC 4JI3O 3E8BA 4I55A 1Y74B 2X7RB 4YJ2B 5CA1B 2XAHA 2Y69C 1SA0A 4OPHA 4BAYA 1MZEA 3CMAV 3WB2A 1RPRA 5LP6A 2Q6AA 4GYCB 1H2LA 2H94A 2BE3A 4WFEA 5B1BC 1WA8A 3F7YC 3L72H 5IT9N 5L3CA 4YIOA 4UVCA 3ZN1A 1FD9A 1XL6A 2Q68A 2XNDG 2XUMA 1MMMA 3ZIAG 1YEWA 1Y66A 3SPHA 2AGAA 4FZ0A 2ZR3A 2EIMC 2O57A 4CH3A 3JARA 5EBWC 1US6A 1RM1C 3SGIA 2HKOA 2M7WA 3BA8A 5LP6C 2A06H 3GWKC 4EFBA 4JF3A 3QTCA 3CCEV 1V55B 4X20B 1IBKO 3W7TA 2V4DA 3T1CA 2Q9LA 4N23A 2CGOA 3FAVA 3PJSK 4KHPB 3E22B 1N0NA 1Q6UA 2N05A 2RCVA 4FIPC 1XNRO 3G80A 3OUSA 4GKKO 2Q7EA 1KUQA 4GX1A 2E5LO 4LC1A 3TXSA 4HYOA 4NYKA 1F4MA 1SZXA 5LMUO 2G38A 3DC6A 1N0JA 3H1KH 4GX5A 3UO2A 1LUWA 3JCUZ 3QG5A 5ITZB 2VS0A 2Q5ZA 2LGQA 1EN6A 3M99B 3IGAC 4NXMO 4DR7O 1S5LZ 1PP9H 1VQ5V 4P9PA 2VQFB 3HKEB 1KBHA 5FL7G 2V7QG 5H5NA 2FL4A 4LFCO 5JJJB 3B40A 2NN4A 1QLNA 4ZKIA 3ZHUA 2CDYA 1X4TA 2WLIB 2QEXV 4XBFA 3ZMVA 1IXMA 3SJQC 3JD3A 1J5EB 3G4SV 4DV4B 1JX9A 2ADQB 2LFRA 3CRQA 1AP6A 2WLLB 3BPZA 3FFQA 3MAQA 1H2MA 1R3KC 2W0XA 2QM8A 4PDMA 2FYUH 1L0NH 5B1NA 3MHHC 3Q4HA 3AEIA 4LF6O 4FFBA 1VARA 3WG7B 4DR1B 2P90A 1K5QA 2YI9A 3CWBH 2F4VO 3CJHB 2UXXA 1OV9A 5BR8B 3T1YO 2PI4A 2IJIA 1HNZO 2ITCC 3UQ8A 4X9QA 3QF7A 2D3OW 2IW5A 4NB5A 2IJHA 4TT3G 4W4LA 2IU0A 5IWAO 1FXKA 4UB6Z 4BIOA 4YHHB 1N34B 4BR6A 5LHGA 1K33A 3BRCA 3ZMZA 3VQVA 5CA0B 2EIJB 3QNEA 1S5JA 3H1HH 5EYPB 3W7XA 2F1MA 3KDRA 3BHPA 3OD4A 2WPDG 4PA9A 2HVJC 1P4RA 2IJKA 2GTSA 5H6RA 3SPJA 4MVQA 2CK3G 1WP8A 1K73W 3K0GA 3K3WA 2PYJA 1XHZA 2P06A 5KHKA 1A32A 3ABKC 4DR2B 2MW2B 1FXKC 3UKMA 2UUAB 5D5PA 2DYSB 4MVSA 1PKXA 1YCIA 4DV7B 2BOBC 2KG7A 2KKWA 1W0JG 3H9VA 4PDRA 1UJWB 2EZPA 5LXTA 3JASB 1CP9A 3JATA 1WNSA 4DW1A 4GLXA 5LOVA 1AILA 4EB6A 3KKYA 3B09A 1PNMA 4GT1A 1M90W 2RDCA 4DV1O 3J7AU 2R9AA 1G1XB 4PDLA 2IBZH 4YJ3B 4AHCA 2CTQA 1SQBH 1SESA 4B3MB 4K0KB 2QSAA 3ZCCA 1XDCA 2DYRB 3HKBB 2AHZA 4NTXA 2R72A 1XNQO 3SYAA 5IE9A 3LDCA 4DV6O 4R50A 4WFHA 4HNAB 4D6TH 4JASA 1IBMB 5DM6V 2GUZB 3TJTA 5KHIA 1NBMG 3E89A 1YZBA 1E1RG 2UXBB 3K0DA 2QWNB 4TQFA 2XOKG 1FPOA 2WLMA 3T4DA 4XDKA 5IYZA 1Q86W 2XAQA 1N36B 3RYIA 2EJRA 5J2UA 4L87A 4P2ZA 1Q3EA 1HNWO 2UU9O 3K5NA 1OCRB 1RSOB 4O4IA 4ZHQB 3UO3A 4IYHA 4I50B 4YY3B 4WFBV 5IDJA 4JZ2A 5IYBO 4JV5O 3MHSC 1NT2B 1BE3H 4LCUC 5LHIA 1WPBA 1CXZB 1KC8W 2EIKB 3ABLB 4LFBO 3AG3B 1R6NA 2B9ZA 4K8XA 5C8YB 4F6RA 1NTZH 1N32O 4B08A 4H44B 2K1EA 2RQ6A 1KP2A 1Y76B 4B3RB 3PN1A 1FAFA 1FS0G 1M93A 2A9HA 3ZBHA 2ZE5A 4JAUA 4MVZA 5B1OA 3CB2A 3E8GA 2DW4A 1O9GA 4MTGA 2ZINA 1AP5A 3CRAA 1VF5B 1QLEB 1N8RW 5IJ9A 1NVPB 4JZGA 3AK2A 2XASA 4NR1A 5L3EA 1E1QG 1XILA 4J7ZA 4WFGA 2IJJA 4DK1A 1MG1A 3DC5A 5KMGB 1NI8A 4TV9B 3LNNA 3AG4B 3H1IH 3RYCA 2EINB 1DF4A 1W0KG 4TQDA 2BTOA 4OXSA 3CE2A 1OCOB 3FB5C 2EULA 2QE7G 3MDSA 5K1PA 4JTDB 4DUZB 5B1AB 1IDSA 1AI7A 4MVMA 1SQFA 3ETEA 5L3GA 2OWOA 1FJGO 1PL0A 4QNHB 3OM3B 1I08A 3LSSA 2PGGA 3EHBB 4BW9A 5JH7B 1VQLV 3BCCH 3CCUV 4LF4B 4CS4A 2Y69B 2OTLV 4K8ZA 1ZX3A 1AI6A 3CMEV 5KHJA 1P7GA 3SYQA 2YI8A 2AZ2A 2JGUA 4LWSB 4X1YA 1AROP 1S77D 3ETDA 3E83A 5B1BB 4QJFB 2HFEC 2ZDIA 3ZJZA 4JI3B 5FPRA 1KECA 1OHHG 4I55B 2HR3A 4P30A 2EIMB 2PTMA 3QO5A 1SA0B 2CTWA 3LDDA 2UUBB 2ZE8A 1RM1B 3SJCC 2LJ2A 1QR8A 3RW0A 5LP6B 2HG5C 3JYCA 3SR2C 3ZHTA 1LR1A 3CCRV 3WU2Z 1WA8B 4MVOA 2UXCO 4O2AA 2ZDIC 4UCSA 4GCZA 3OGIB 1JNBA 4X1KA 3K9SA 4KP4A 1PNLA 4J80A 4LF8B 4R6ZA 3JARB 4WFAV 2CTRA 1L1FA 1QU7A 2YEVA 4ASUG 3UT5A 1MA1A 5F2VO 3HB3B 3GVMA 3B77A 4EEQA 4JI7B 1R73A 4KFMA 4JI6B 2JEXA 1ENVA 2YUAA 4X1IB 1EFRG 2YICA 3FAVB 2BSKA 1K3EA 1RFYA 1MABG 1PPJH 3GB7C 3SPCA 4BWAA 3ABUA 5IY5C 1Q6HA 3QVNA 4DV0O 4WFFA 3OAAG 3JSNA 2QWRB 1OCCB 3FB7C 1XNRB 3IFXA 2QM7A 2Y4TA 2YXLA 4UCOA 4UFZA 4DR3B 3K5OA 2BCCH 1F51A 2ZXWC 2EBOA 3F5WC 1XMOO 5LL6Y 4LNUB 2UXDO 1N33B 4TV8B 3LUTB 2OCHA 4UV9A 1XL4A 3SYOA 2YC0A 4RQEA 3RYFA 3DXRA 4I0XA 4DR5B 1M57C 1AR4A 3C3SA 3JSLA 2DQ0A 2ZD9A 4EFEA 2NNUA 3AG1C 4LF9O 1BQZA 3L73H 3A0HZ 5GTHZ 4JYAO 2JRIA 3X2QC 3FYEB 1AJPA 2QJ1A 3HKCA 4LFCB 5KA6A 3RT3C 3A0BZ 2KSDA 3CC4V 3ZMUA 4QIWF 3K58A 1M5IA 2Y4UA 1SRYA 5C93A 3S3XA 2Q8VA 3SJAC 5CB4A 4JI5O 2Y0PA 2QWPB 4B7KA 4U3JA 4U7NA 1I94B 3W7UA 4R7CA 4MVUA 1ZLZA 4JI1O 1BHAA 1MOFA 4FLXA 3TGUH 4MTOA 4O4LA 1H8EG 1XUQA 5GTIZ 3ZMSA 1TA8A 2OCCC 1BSMA 3B8MA 3CP1A 4PI2A 5B5EZ 3G71V 5FLXN 2Y48A 4ZOLA 4IGGA 3OTOB 1TUBB 3T4ZA 2QKAA 3NR7A 2VQEB 3Q4HB 1GKFA 4PHZA 4FFBB 4PA4A 4BIUA 2P67A 2F4VB 2VWKA 5BXZA 4LFAB 3BFRA 3ETQA 1S0VA 1VF7A 1KMIZ 1HNZB 1ZTEA 1IXBA 3LDEA 4JTCB 4LF7O 3UCSC 1H2KA 3ABKB 1FXKB 4FM2A 2JGDA 4LP8A 2P7TC 1GN6A 4X62B 4AQYO 2QA4V 3CRRA 1GN2A 2B1IA 2PUSA 3S3WA 1TAEA 2F66C 5K1XA 3BVOA 3OTFA 4X8AA 1YJ9V 1VP7A 2WSSG 2DE0X 5CN0A 3CCJV 3B2EE 2E74B 2Q69A 1Q82W 1EZJA 3APQA 4RWUA 1IJGA 1GAXA 2JDIG 2KG7B 5D5QA 4P9OA 4X66O 4MW3A 2HJFC 1FFXA 5LXTB 3JATB 3K08A 5LOVB 4EB6B 3QO7A 2L6LA 3OR6C 5KLVH 5CBGA 3DGEA 3T1HO 1S76D 2WLHA 3H01A 1BZKA 5KHGA 4PI0A 4YJ2A 2QTSA 2QDOA 4RUEA 3VQXA 1K9MW 3KG2A 4B3TB 2LQTA 1G8MA 3ZX6A 1Z5VA 1XNQB 1HWYA 1Y4MA 2W0FC 4JI0B 2CTPA 4DUYB 4H0LB 1XI1A 1NH2D 4TWKA 1YTFD 2C2AA 4X64B 4ZBMA 2AXTZ 2D2CB 1GM9A 2UUCO 1MNGA 4E2LA 2WA4A 1PL4A 1R3JC 5A2QN 3L70H 5IYZB 2RMKB 1ZAUA 3RYIB 1VQNV 1ORQC 2Q73A 5J2UB 4DR4O 4DXWA 1I5XA 1EM1A 1JQ0A 3B4SA 5KAIZ 2F93B 2UU9B 2HVKC 3ZRWA 5KX5B 1QNMA 2ZKOA 4O4IB 4OX9B 4D7SA 1KB9F 1Z2GA 4B3SB 2XAGA 3E86A 3R65A 4KHPO 1IBLB 1HNXB 2UXNA 1ZL8A 3OEEG 1AVMA 1JJOA 1GM7A 2Z3YA 4I7ZB 3ASNC 1FYJA
chains in the Genus database with same CATH topology
1MMMA 1VEWA 3AK3A 1Y67A 3KKYA 1AP5A 1IX9A 1I0HA 3LSUA 1BT8A 1BS3A 1PM9A 4JZGA 3AK2A 4YIPA 2ADQB 3K9SA 1AR5A 1XILA 4FFKA 1ZLZA 1XREA 1AP6A 1EN5A 4GUNA 1XDCA 1XUQA 1JA8A 1MA1A 2AW9A 3IC9A 3DC5A 1D5NA 2P4KA 1BSMA 1KKCA 1WB7A 3RN4A 1N0NA 1JR9A 1VARA 2QKCA 2RCVA 3TJTA 1GN4A 1ZUQA 1ZSPA 2QKAA 1GN3A 3QVNA 3OT7A 1SZXA 3CEIA 4E4EA 3MDSA 4X9QA 3C3TA 2ADPA 3DC6A 1WB8A 1N0JA 1IDSA 5A9GA 1I08A 4BR6A 1LUWA 3BFRA 1MNGA 2GDSA 4F6EA 1ZTEA 1IXBA 1PL4A 3AK1A 1P7GA 1EN6A 1LUVA 3KDRA 4JZ2A 1EM1A 1GN6A 1QNMA 1MSDA 1AR4A 1EN4A 1GN2A 3C3SA 2CE4A 3EVKA 5AG2A 4C7UA 1B06A 2CDYA 1AVMA 4YIOA 4JYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMM A;  1VEW A;  3AK3 A;  1Y67 A;  3KKY A;  1AP5 A;  1IX9 A;  1I0H A;  3LSU A;  1BT8 A;  1BS3 A;  1PM9 A;  4JZG A;  3AK2 A;  4YIP A;  2ADQ B;  3K9S A;  1AR5 A;  1XIL A;  4FFK A;  1ZLZ A;  1XRE A;  1AP6 A;  1EN5 A;  4GUN A;  1XDC A;  1XUQ A;  1JA8 A;  1MA1 A;  2AW9 A;  3IC9 A;  3DC5 A;  1D5N A;  2P4K A;  1BSM A;  1KKC A;  1WB7 A;  3RN4 A;  1N0N A;  1JR9 A;  1VAR A;  2QKC A;  2RCV A;  3TJT A;  1GN4 A;  1ZUQ A;  1ZSP A;  2QKA A;  1GN3 A;  3QVN A;  3OT7 A;  1SZX A;  3CEI A;  4E4E A;  3MDS A;  4X9Q A;  3C3T A;  2ADP A;  3DC6 A;  1WB8 A;  1N0J A;  1IDS A;  5A9G A;  1I08 A;  4BR6 A;  1LUW A;  3BFR A;  1MNG A;  2GDS A;  4F6E A;  1ZTE A;  1IXB A;  1PL4 A;  3AK1 A;  1P7G A;  1EN6 A;  1LUV A;  4JZ2 A;  1EM1 A;  1GN6 A;  1QNM A;  1MSD A;  1AR4 A;  1EN4 A;  1GN2 A;  3C3S A;  2CE4 A;  3EVK A;  5AG2 A;  4C7U A;  1B06 A;  2CDY A;  1AVM A;  4YIO A;  4JYY A; 
#chains in the Genus database with same CATH topology
 1KYO F;  2X6A A;  1YIJ V;  1VQ8 V;  3K59 A;  5H9C A;  2QGN A;  2JJ1 G;  4FPP A;  3OMI B;  4O2B A;  1R3L C;  2ETN A;  4A5U B;  2HJD A;  4DR6 B;  1YXB A;  4X65 B;  4DK0 A;  4YIP A;  3P32 A;  1GTO A;  1KP3 A;  3KZI Z;  3AG2 C;  1K34 A;  2N04 A;  2LFS A;  5JVD A;  2P4K A;  1FXV A;  4QE9 A;  4GKJ B;  2ARH A;  1QR9 A;  2QWO B;  2VQF O;  2QKC A;  3JD1 A;  3TK1 A;  1VQP V;  1NR1 A;  3MD0 A;  3EFF K;  5E79 Z;  1S5H C;  2Q0A A;  3OW2 U;  1XMQ B;  2DQ3 A;  4H13 B;  1K4C C;  3JAW B;  5CBF A;  3RYC B;  4OGQ B;  1RP3 B;  3C90 A;  2P22 C;  4DV2 B;  4JI4 B;  3JAM N;  3SYC A;  1VQ6 V;  2OT5 A;  1YF2 A;  1J5E O;  4DV4 O;  4TUY A;  4W4K A;  2X0L A;  1AI5 A;  1PD3 A;  1GK9 A;  4DYL A;  2FML A;  4R8C A;  5LA6 A;  4J7K A;  4MSW C;  2F95 B;  4X1Y B;  3EXA A;  5B66 Z;  4IL6 Z;  3EVK A;  3RGB A;  3A2F A;  4RAI A;  1KD1 W;  3APO A;  4NVP A;  1QVG U;  3P3P A;  3J80 N;  3K5L A;  4DR1 O;  3U10 A;  2B5U A;  1S3J A;  3RVY A;  4GZR B;  5FNV A;  1QVF U;  2GSM B;  3LNM B;  2OYQ A;  2EZO A;  3HR0 A;  3CCM V;  4FVM A;  3LSU A;  4YHH O;  1N34 O;  1H2G A;  1HR0 B;  3LSQ A;  1URF A;  1I7F A;  1AR5 A;  1SZT A;  1NZ6 A;  1JFF A;  3U11 A;  4Z1M G;  1Q7Y W;  1KKD A;  3SJB C;  2UXC B;  4O2A B;  3ZHS A;  1K92 A;  4IIJ A;  4UCR A;  4X1K B;  4CS3 A;  4DV5 B;  5IY5 B;  4UCT A;  4D7T A;  3KCX A;  4PD4 F;  3FYI B;  1JJ2 U;  4JI8 B;  3RBZ A;  2R70 A;  1I5Y A;  1WJZ A;  2YEV B;  3UT5 B;  1GN4 A;  1ZUQ A;  4KL1 A;  1R6T A;  1ZSP A;  2ZXW B;  1GN3 A;  2UUA O;  1IVS A;  4DV7 O;  3JAL A;  3CEI A;  3TXQ A;  1NS1 A;  4PA3 A;  2ZE6 A;  4FK5 C;  5JJN B;  1OCZ C;  3ZS8 C;  5EIB C;  3JAK A;  3VBB A;  3H1J H;  1M57 B;  4J9Z B;  1L0L H;  5H2F Z;  1R1B A;  1NR7 A;  2WLK A;  1M9N A;  3AG1 B;  4O4J A;  4B3M O;  5JQG A;  3X2Q B;  3HKD A;  1XMO B;  5KUM A;  4K0K O;  1BHB A;  1MSW D;  3K04 A;  4Z1V A;  4TOI A;  1NKD A;  4NXN B;  4O4H A;  3RYF B;  3DXR B;  4I0X B;  4JGS A;  2LW7 A;  2GHY A;  4UB8 Z;  4JTA B;  1GRJ A;  3G6B A;  2BTQ A;  1AI4 A;  4DV3 O;  2UXB O;  3BA9 A;  3BAB A;  2Z5U A;  4TSF G;  1GO3 F;  1I0H A;  5LMN B;  3HKC B;  1N36 O;  4HBN A;  1D5A A;  2OCC B;  1SQX H;  5EIB D;  2GBO A;  3E35 A;  4FLW A;  4FLU A;  4IHJ A;  5BMV A;  2P6J A;  4FFK A;  2B1G A;  3STL C;  3W7W A;  5CB4 B;  3DTU B;  3K57 A;  4U3J B;  2ZT9 B;  1WAZ A;  3RFR A;  3IC9 A;  2QM4 A;  4YY3 O;  2X6C A;  3B8N A;  3T2M A;  1V54 C;  2ZNI A;  1YDX A;  2HLD G;  2XT9 A;  4O4L B;  1GH6 A;  5IJ0 A;  2ZE7 A;  5EC1 C;  1Y6X A;  3CCS V;  2VWJ A;  4UCU A;  4ZOL B;  4KXR A;  5EBL C;  2HHH O;  3VOU A;  4DRX A;  2MK3 A;  1JPX A;  2A79 B;  3N2G A;  4UVA A;  1VQ4 V;  4U7O A;  3RWR D;  3ZN0 A;  3ZHR A;  4UVB A;  4PEL A;  1Q5O A;  2DN9 A;  1IBK B;  3CXC U;  3SDL A;  3ABM C;  4ABM A;  5LGU A;  3KCY A;  1PNK A;  3D3I A;  1WPX A;  1W59 A;  2E75 B;  2CH7 A;  1QHT A;  1SER A;  4LF7 B;  1NU1 H;  1V9P A;  1DK1 A;  4GKK B;  1R3I C;  2E5L B;  4X89 A;  2JEU A;  2DWE C;  1XHX A;  2YID A;  1QQC A;  5LMU B;  2JS3 A;  2CAZ C;  1FOU A;  3U0Z A;  2IH3 C;  1XEQ A;  3O9O A;  4Q20 A;  1BMF G;  3JD0 A;  4PJ0 Z;  2YIB D;  1AJN A;  3CYO A;  3FKS G;  4WBN A;  1U96 A;  5JCO A;  4MTF A;  2L35 A;  4MT8 A;  2V1D A;  4DUZ O;  5LGT A;  1X59 A;  1U97 A;  4XDJ A;  1YSC A;  4NXM B;  4DR7 B;  1VQ7 V;  4FLZ A;  5HFM A;  3J81 N;  4J10 A;  4I9W A;  3TET A;  4LF4 O;  5GW7 A;  4X66 B;  5LYJ A;  3CC7 V;  5GON A;  1FFX B;  1GMG A;  2A7W A;  2JVD A;  1VQO V;  3E8H A;  1Q90 D;  1SQG A;  1HDJ A;  1YJN V;  3THO A;  1K97 A;  3RN4 A;  5JCO C;  3DSQ A;  4ZI7 A;  1WLE A;  3K03 A;  3HPL C;  2Q0O C;  1SF9 A;  2R9I A;  1JVM A;  2YXH A;  2Q7H A;  1WN7 A;  4ZIB A;  4E4E A;  2WWW A;  2FTK A;  3CCV V;  2UUB O;  2JS5 A;  2OIG A;  3VQW A;  1M56 C;  1NVP D;  3GWO A;  3F7V C;  1P84 F;  1O9H A;  2ZM6 O;  2H3O A;  4MS2 A;  1YIT V;  2YXY A;  4PA6 A;  1LUV A;  2ATK C;  2KQX A;  4KUM A;  1HP8 A;  2YIA A;  2UUC B;  2LP7 A;  4LF6 B;  4LF8 O;  1H8H G;  2RJZ A;  5TIS Z;  5EZY A;  1P7B A;  3ASN B;  2ILM A;  2CE4 A;  4DO2 A;  3RVZ A;  4AI8 A;  4AIL C;  3T1Y B;  4DR4 B;  3IJ4 A;  1B06 A;  3JD4 A;  4I4T A;  1QBZ A;  1WP7 A;  1JOY A;  3OR7 C;  1TUE B;  4UXN A;  3ZRW B;  4JI7 O;  1NQT A;  4JI2 O;  1P49 A;  5BY1 A;  1Q81 W;  5KUK A;  4JI6 O;  5IWA B;  1IZ3 A;  5IYC O;  4X1I A;  2F43 G;  1VEW A;  2NR5 A;  1ZL8 B;  3AG2 B;  1K4D C;  1Z5W A;  4H33 A;  1H5W A;  5DED A;  4J41 A;  4UCV A;  1B3Q A;  1K5S A;  3K5M A;  3CRM A;  2Q7G A;  3SPG A;  1Q43 A;  4DR3 O;  4G28 B;  5IYD O;  2WLJ A;  5J2T A;  4K35 A;  4LF5 O;  4GX0 A;  1N33 O;  4O2B B;  4LNU A;  5JJE B;  4TV8 A;  4F4L A;  1TVK A;  1D5N A;  1FXH A;  4G27 B;  1CPY A;  1KKC A;  1WB7 A;  3ZRX A;  1D2D A;  1GM8 A;  4DR5 O;  2EIL C;  4CS2 A;  4WCE V;  1OCC C;  3FB8 C;  4RQF A;  3RYH A;  5KAF Z;  5JVD B;  1M4U A;  2EX3 A;  3N2K A;  3AG7 A;  4DV1 B;  1B04 A;  1WB8 A;  3D3Q A;  1F23 A;  2P4V A;  1Y74 A;  1SS3 A;  5B3S C;  5CA1 A;  1H38 A;  2ZIO A;  4G2K A;  4RUF A;  4CH4 A;  1F7Y A;  3ASO C;  3IC7 A;  1SKV A;  2A0L A;  3CD6 V;  1UPG A;  4DV6 B;  1I94 O;  3L74 H;  4PV1 B;  4JPR A;  4QPJ A;  5HFL A;  3VQY A;  4LR3 A;  1BCC H;  3FD9 A;  1MSD A;  2DWD C;  1CEZ A;  4RO2 A;  4CH6 A;  3OUF A;  4TUY B;  2PYL A;  2ZNJ A;  4C7U A;  3K9A A;  5LA6 B;  3NXS A;  1XQ8 A;  3CSX A;  3OTO O;  1TUB A;  5CA3 A;  3ZHV A;  1FKA O;  2BOC C;  4FLT A;  1HNW B;  5LHH A;  1DLB A;  3TCU A;  3ZMT A;  2A3Q A;  2VQE O;  3N27 A;  4X20 A;  3QO8 A;  5FPO A;  3L9D A;  3K79 A;  3BY6 A;  3ZED A;  1TGO A;  4LH6 A;  1BT8 A;  3M8A A;  4JV5 B;  3WB1 A;  4K3A A;  5FNV B;  2YSU B;  3E22 A;  2W6I G;  4LFA O;  4NTY A;  1AB3 A;  1F4N A;  1H2S B;  2NLJ C;  4J9Y B;  4LFB B;  2R9R B;  4F6R B;  5L3B A;  1N32 B;  3CCQ V;  2Q4P A;  3CX5 F;  4FLV A;  4H37 A;  4LH7 A;  1JFF B;  1FFT B;  4X62 O;  2HEP A;  1V55 C;  3BAA A;  4IIJ B;  1YHQ V;  2JK5 C;  1OCZ B;  1MZF A;  3CS5 A;  1UFI A;  3ABT A;  3BEH A;  4QPK A;  5ITZ A;  3WFV A;  2GTA A;  3C3T A;  4PA7 A;  4CC6 A;  2ITD C;  2WA3 A;  5IJ9 B;  3CC2 V;  2IH1 C;  1N4C A;  3D36 A;  2ZQM A;  3UM7 A;  2GDS A;  2AZ0 A;  3F5T A;  3JAL B;  2M6Y A;  3HKE A;  2FB5 A;  2XAJ A;  3CHX A;  1SC5 B;  4CZZ A;  3H1L H;  1KU9 A;  4JAA A;  3JAK B;  1M1K W;  3L75 H;  2WLI A;  2DOS A;  1K8A W;  1EN4 A;  1THZ A;  3D8C A;  4QE7 A;  3STZ C;  2XTA A;  2KB1 A;  3ZHQ A;  3D36 C;  4UUJ C;  4O4J B;  1EBO A;  5JQG B;  2OIE A;  3HKD B;  1BQ0 A;  1YI2 V;  4B3T O;  1FJG B;  4JYY A;  1SQQ H;  2YDE A;  2YS8 A;  3M7M X;  4O4H B;  4MVR A;  1EZV H;  4JI0 O;  3ZRS A;  3A8T A;  4DUY O;  3E8F A;  2ZCE A;  2IU3 A;  4J7J A;  2WLL A;  1IX9 A;  3I5D A;  2VRZ A;  3P3N A;  2ZIM A;  3OMA B;  4FM0 A;  4X64 O;  2DMX A;  3W7S A;  4JYB A;  1V54 B;  1JCH A;  2BTQ B;  4DV3 B;  2Y0I A;  2EJ7 A;  1EN5 A;  2LO1 A;  3FB6 C;  3ML0 A;  1IUR A;  4JYC A;  2RN9 A;  1XBL A;  4U3F H;  4GX2 A;  1LNQ A;  3CJH A;  5BR8 O;  2E3C A;  2JJ2 G;  4IHJ B;  2ZR2 A;  5BMV B;  2XHB A;  1JR9 A;  2P5O A;  5KX5 A;  4Q6G A;  1W2B U;  4OX9 O;  3IAY A;  4B3S O;  2QR4 A;  3ICX A;  1NJI W;  1IBL O;  1DTO A;  3CXH F;  5CA0 A;  1HNX O;  4WF9 V;  4L8J A;  4QGP A;  4NKG B;  1Q8I A;  4MW8 A;  2PY5 A;  2ADP A;  1YJW V;  5EYP A;  1YVW A;  3WG7 C;  3L71 H;  3WB0 A;  5IJ0 B;  5JWP A;  3ABM B;  4Z2W A;  3G6E V;  1H2N A;  1SQV H;  3FX7 A;  3CRC A;  4UV8 A;  4X88 A;  2WAM A;  4DRX B;  5J9P C;  2HHH B;  4DR2 O;  1SQP H;  3N2G B;  4DR6 O;  4X65 O;  5E1A C;  3CPW U;  4YXW G;  3OE7 G;  2EIJ C;  2GV9 A;  4NTW A;  2OTJ V;  2BSK B;  1VF6 A;  3JAS A;  4ICG A;  2RNB A;  3OEH G;  4DV0 B;  1VMG A;  4GKJ O;  5EBM C;  4OPA A;  2CH7 B;  4LBE C;  2ODM A;  5BZB A;  2Z0A A;  4YJ3 A;  1DF5 A;  4N21 A;  2HP8 A;  5LGN A;  5EK0 A;  1Y67 A;  1QCE A;  2DYS C;  1XMQ O;  4FZ1 A;  2UXD B;  3JAW A;  3I56 V;  1AJQ A;  1NTK H;  3HKB A;  2XAF A;  1VF6 C;  5KA5 A;  1BS3 A;  4FMT A;  4DV2 O;  4WBN B;  4JI4 O;  1AR1 B;  1XRE A;  1IBM O;  4HNA A;  2CUG A;  2GUZ A;  1HW7 A;  1K7D A;  3OGC C;  1JA8 A;  4FLY A;  4JAV A;  4BW5 A;  1NTM H;  4LF9 B;  2F23 A;  4I5S A;  2WLN A;  4JYA B;  4J11 A;  3R66 A;  1G6U A;  5LYJ B;  4MTX A;  3E2E A;  4FJC C;  5L3F A;  5GON B;  2DYR C;  3JD2 A;  1XOU A;  1BGY H;  1M56 B;  5KHH A;  4I9Q A;  4IYI A;  4IT5 A;  2YIB A;  3CCL V;  2Q67 A;  4BIZ A;  4ZI7 B;  1RSO A;  4JI5 B;  1OZ0 A;  4ZHQ A;  5A9G A;  2DJV A;  3OMN B;  4DW0 A;  1BL8 A;  3SYP A;  4I50 A;  2QKS A;  5CBH A;  1DGS A;  2PZS A;  4JI1 B;  1COW G;  2X6B A;  5CMU A;  3ETG A;  1VQK V;  5C8Y A;  1G4Y B;  2E76 B;  1HR0 O;  4B3R O;  3I55 V;  1Y76 A;  2ZM6 B;  2K9P A;  1OCR C;  2AHY A;  3ZRV A;  2IM9 A;  1RPO A;  3A0R A;  1VIB A;  1E79 G;  3O65 A;  5AG2 A;  5EC2 C;  4DV5 O;  1VQM V;  4CBC A;  2H8P C;  3G67 A;  4JI8 O;  2JIZ G;  5EZY B;  2EIK C;  3ABL C;  5LBQ A;  3JCZ A;  3P30 A;  3AG3 C;  3AK3 A;  4I4T B;  1T5E A;  1B6Q A;  4JI2 B;  4HZ3 A;  1NH2 B;  1YTF B;  2JGD B;  1PM9 A;  3SPI A;  5KMG A;  1VQ9 V;  2W6J G;  4TV9 A;  4AQY B;  2PF4 E;  3OFN G;  2EIL B;  4GUN A;  2QTO A;  2AW9 A;  1QLE C;  4XDL A;  2N74 A;  1R6K A;  2LGW A;  2CGN A;  4EKW A;  1S72 V;  5J2T B;  1ROP A;  4LF5 B;  1TVK B;  5DN6 G;  4CH5 A;  5B3S B;  2LW1 A;  5L3D A;  1KQS U;  4NXN O;  5JH7 A;  1OJH A;  4HAM A;  1L8D A;  2FKX A;  3OT7 A;  4PDV A;  3ASO B;  5H6Q A;  1Q6I A;  3AG4 C;  1PV0 A;  2QWQ B;  1J95 A;  2EIN C;  4CC5 A;  3K06 A;  4LWS A;  3RYH B;  1ZWI C;  2PI5 A;  4F6E A;  3N2K B;  1JMK C;  4J42 A;  1SET A;  1OCO C;  4FM1 A;  3T1H B;  4B7E A;  3AK1 A;  5DEC A;  5LMN O;  5B1A C;  4JI3 O;  3E8B A;  4I55 A;  1Y74 B;  2X7R B;  4YJ2 B;  5CA1 B;  2XAH A;  2Y69 C;  1SA0 A;  4OPH A;  4BAY A;  1MZE A;  3CMA V;  3WB2 A;  1RPR A;  5LP6 A;  2Q6A A;  4GYC B;  1H2L A;  2H94 A;  2BE3 A;  4WFE A;  5B1B C;  1WA8 A;  3F7Y C;  3L72 H;  5IT9 N;  5L3C A;  4YIO A;  4UVC A;  3ZN1 A;  1FD9 A;  1XL6 A;  2Q68 A;  2XND G;  2XUM A;  1MMM A;  3ZIA G;  1YEW A;  1Y66 A;  3SPH A;  2AGA A;  4FZ0 A;  2ZR3 A;  2EIM C;  2O57 A;  4CH3 A;  3JAR A;  5EBW C;  1US6 A;  1RM1 C;  3SGI A;  2HKO A;  2M7W A;  3BA8 A;  5LP6 C;  2A06 H;  3GWK C;  4EFB A;  4JF3 A;  3QTC A;  3CCE V;  1V55 B;  4X20 B;  1IBK O;  3W7T A;  2V4D A;  3T1C A;  2Q9L A;  4N23 A;  2CGO A;  3FAV A;  3PJS K;  4KHP B;  3E22 B;  1N0N A;  1Q6U A;  2N05 A;  2RCV A;  4FIP C;  1XNR O;  3G80 A;  3OUS A;  4GKK O;  2Q7E A;  1KUQ A;  4GX1 A;  2E5L O;  4LC1 A;  3TXS A;  4HYO A;  4NYK A;  1F4M A;  1SZX A;  5LMU O;  2G38 A;  3DC6 A;  1N0J A;  3H1K H;  4GX5 A;  3UO2 A;  1LUW A;  3JCU Z;  3QG5 A;  5ITZ B;  2VS0 A;  2Q5Z A;  2LGQ A;  1EN6 A;  3M99 B;  3IGA C;  4NXM O;  4DR7 O;  1S5L Z;  1PP9 H;  1VQ5 V;  4P9P A;  2VQF B;  3HKE B;  1KBH A;  5FL7 G;  2V7Q G;  5H5N A;  2FL4 A;  4LFC O;  5JJJ B;  3B40 A;  2NN4 A;  1QLN A;  4ZKI A;  3ZHU A;  2CDY A;  1X4T A;  2WLI B;  2QEX V;  4XBF A;  3ZMV A;  1IXM A;  3SJQ C;  3JD3 A;  1J5E B;  3G4S V;  4DV4 B;  1JX9 A;  2ADQ B;  2LFR A;  3CRQ A;  1AP6 A;  2WLL B;  3BPZ A;  3FFQ A;  3MAQ A;  1H2M A;  1R3K C;  2W0X A;  2QM8 A;  4PDM A;  2FYU H;  1L0N H;  5B1N A;  3MHH C;  3Q4H A;  3AEI A;  4LF6 O;  4FFB A;  1VAR A;  3WG7 B;  4DR1 B;  2P90 A;  1K5Q A;  2YI9 A;  3CWB H;  2F4V O;  3CJH B;  2UXX A;  1OV9 A;  5BR8 B;  3T1Y O;  2PI4 A;  2IJI A;  1HNZ O;  2ITC C;  3UQ8 A;  4X9Q A;  3QF7 A;  2D3O W;  2IW5 A;  4NB5 A;  2IJH A;  4TT3 G;  4W4L A;  2IU0 A;  5IWA O;  1FXK A;  4UB6 Z;  4BIO A;  4YHH B;  1N34 B;  4BR6 A;  5LHG A;  1K33 A;  3BRC A;  3ZMZ A;  3VQV A;  5CA0 B;  2EIJ B;  3QNE A;  1S5J A;  3H1H H;  5EYP B;  3W7X A;  2F1M A;  3KDR A;  3BHP A;  3OD4 A;  2WPD G;  4PA9 A;  2HVJ C;  1P4R A;  2IJK A;  2GTS A;  5H6R A;  3SPJ A;  4MVQ A;  2CK3 G;  1WP8 A;  1K73 W;  3K0G A;  3K3W A;  2PYJ A;  1XHZ A;  2P06 A;  5KHK A;  1A32 A;  3ABK C;  4DR2 B;  2MW2 B;  1FXK C;  3UKM A;  2UUA B;  5D5P A;  2DYS B;  4MVS A;  1PKX A;  1YCI A;  4DV7 B;  2BOB C;  2KG7 A;  2KKW A;  1W0J G;  3H9V A;  4PDR A;  1UJW B;  2EZP A;  5LXT A;  3JAS B;  1CP9 A;  3JAT A;  1WNS A;  4DW1 A;  4GLX A;  5LOV A;  1AIL A;  4EB6 A;  3KKY A;  3B09 A;  1PNM A;  4GT1 A;  1M90 W;  2RDC A;  4DV1 O;  3J7A U;  2R9A A;  1G1X B;  4PDL A;  2IBZ H;  4YJ3 B;  4AHC A;  2CTQ A;  1SQB H;  1SES A;  4B3M B;  4K0K B;  2QSA A;  3ZCC A;  1XDC A;  2DYR B;  3HKB B;  2AHZ A;  4NTX A;  2R72 A;  1XNQ O;  3SYA A;  5IE9 A;  3LDC A;  4DV6 O;  4R50 A;  4WFH A;  4HNA B;  4D6T H;  4JAS A;  1IBM B;  5DM6 V;  2GUZ B;  3TJT A;  5KHI A;  1NBM G;  3E89 A;  1YZB A;  1E1R G;  2UXB B;  3K0D A;  2QWN B;  4TQF A;  2XOK G;  1FPO A;  2WLM A;  3T4D A;  4XDK A;  5IYZ A;  1Q86 W;  2XAQ A;  1N36 B;  3RYI A;  2EJR A;  5J2U A;  4L87 A;  4P2Z A;  1Q3E A;  1HNW O;  2UU9 O;  3K5N A;  1OCR B;  1RSO B;  4O4I A;  4ZHQ B;  3UO3 A;  4IYH A;  4I50 B;  4YY3 B;  4WFB V;  5IDJ A;  4JZ2 A;  5IYB O;  4JV5 O;  3MHS C;  1NT2 B;  1BE3 H;  4LCU C;  5LHI A;  1WPB A;  1CXZ B;  1KC8 W;  2EIK B;  3ABL B;  4LFB O;  3AG3 B;  1R6N A;  2B9Z A;  4K8X A;  5C8Y B;  4F6R A;  1NTZ H;  1N32 O;  4B08 A;  4H44 B;  2K1E A;  2RQ6 A;  1KP2 A;  1Y76 B;  4B3R B;  3PN1 A;  1FAF A;  1FS0 G;  1M93 A;  2A9H A;  3ZBH A;  2ZE5 A;  4JAU A;  4MVZ A;  5B1O A;  3CB2 A;  3E8G A;  2DW4 A;  1O9G A;  4MTG A;  2ZIN A;  1AP5 A;  3CRA A;  1VF5 B;  1QLE B;  1N8R W;  5IJ9 A;  1NVP B;  4JZG A;  3AK2 A;  2XAS A;  4NR1 A;  5L3E A;  1E1Q G;  1XIL A;  4J7Z A;  4WFG A;  2IJJ A;  4DK1 A;  1MG1 A;  3DC5 A;  5KMG B;  1NI8 A;  4TV9 B;  3LNN A;  3AG4 B;  3H1I H;  3RYC A;  2EIN B;  1DF4 A;  1W0K G;  4TQD A;  2BTO A;  4OXS A;  3CE2 A;  1OCO B;  3FB5 C;  2EUL A;  2QE7 G;  3MDS A;  5K1P A;  4JTD B;  4DUZ B;  5B1A B;  1IDS A;  1AI7 A;  4MVM A;  1SQF A;  3ETE A;  5L3G A;  2OWO A;  1FJG O;  1PL0 A;  4QNH B;  3OM3 B;  1I08 A;  3LSS A;  2PGG A;  3EHB B;  4BW9 A;  5JH7 B;  1VQL V;  3BCC H;  3CCU V;  4LF4 B;  4CS4 A;  2Y69 B;  2OTL V;  4K8Z A;  1ZX3 A;  1AI6 A;  3CME V;  5KHJ A;  1P7G A;  3SYQ A;  2YI8 A;  2AZ2 A;  2JGU A;  4LWS B;  4X1Y A;  1ARO P;  1S77 D;  3ETD A;  3E83 A;  5B1B B;  4QJF B;  2HFE C;  2ZDI A;  3ZJZ A;  4JI3 B;  5FPR A;  1KEC A;  1OHH G;  4I55 B;  2HR3 A;  4P30 A;  2EIM B;  2PTM A;  3QO5 A;  1SA0 B;  2CTW A;  3LDD A;  2UUB B;  2ZE8 A;  1RM1 B;  3SJC C;  2LJ2 A;  1QR8 A;  3RW0 A;  5LP6 B;  2HG5 C;  3JYC A;  3SR2 C;  3ZHT A;  1LR1 A;  3CCR V;  3WU2 Z;  1WA8 B;  4MVO A;  2UXC O;  4O2A A;  2ZDI C;  4UCS A;  4GCZ A;  3OGI B;  1JNB A;  4X1K A;  3K9S A;  4KP4 A;  1PNL A;  4J80 A;  4LF8 B;  4R6Z A;  3JAR B;  4WFA V;  2CTR A;  1L1F A;  1QU7 A;  2YEV A;  4ASU G;  3UT5 A;  1MA1 A;  5F2V O;  3HB3 B;  3GVM A;  3B77 A;  4EEQ A;  4JI7 B;  1R73 A;  4KFM A;  4JI6 B;  2JEX A;  1ENV A;  2YUA A;  4X1I B;  1EFR G;  2YIC A;  3FAV B;  2BSK A;  1K3E A;  1RFY A;  1MAB G;  1PPJ H;  3GB7 C;  3SPC A;  4BWA A;  3ABU A;  5IY5 C;  1Q6H A;  3QVN A;  4DV0 O;  4WFF A;  3OAA G;  3JSN A;  2QWR B;  1OCC B;  3FB7 C;  1XNR B;  3IFX A;  2QM7 A;  2Y4T A;  2YXL A;  4UCO A;  4UFZ A;  4DR3 B;  3K5O A;  2BCC H;  1F51 A;  2ZXW C;  2EBO A;  3F5W C;  1XMO O;  5LL6 Y;  4LNU B;  2UXD O;  1N33 B;  4TV8 B;  3LUT B;  2OCH A;  4UV9 A;  1XL4 A;  3SYO A;  2YC0 A;  4RQE A;  3RYF A;  3DXR A;  4I0X A;  4DR5 B;  1M57 C;  1AR4 A;  3C3S A;  3JSL A;  2DQ0 A;  2ZD9 A;  4EFE A;  2NNU A;  3AG1 C;  4LF9 O;  1BQZ A;  3L73 H;  3A0H Z;  5GTH Z;  4JYA O;  2JRI A;  3X2Q C;  3FYE B;  1AJP A;  2QJ1 A;  3HKC A;  4LFC B;  5KA6 A;  3RT3 C;  3A0B Z;  2KSD A;  3CC4 V;  3ZMU A;  4QIW F;  3K58 A;  1M5I A;  2Y4U A;  1SRY A;  5C93 A;  3S3X A;  2Q8V A;  3SJA C;  5CB4 A;  4JI5 O;  2Y0P A;  2QWP B;  4B7K A;  4U3J A;  4U7N A;  1I94 B;  3W7U A;  4R7C A;  4MVU A;  1ZLZ A;  4JI1 O;  1BHA A;  1MOF A;  4FLX A;  3TGU H;  4MTO A;  4O4L A;  1H8E G;  1XUQ A;  5GTI Z;  3ZMS A;  1TA8 A;  2OCC C;  1BSM A;  3B8M A;  3CP1 A;  4PI2 A;  5B5E Z;  3G71 V;  5FLX N;  2Y48 A;  4ZOL A;  4IGG A;  3OTO B;  1TUB B;  3T4Z A;  2QKA A;  3NR7 A;  2VQE B;  3Q4H B;  1GKF A;  4PHZ A;  4FFB B;  4PA4 A;  4BIU A;  2P67 A;  2F4V B;  2VWK A;  5BXZ A;  4LFA B;  3BFR A;  3ETQ A;  1S0V A;  1VF7 A;  1KMI Z;  1HNZ B;  1ZTE A;  1IXB A;  3LDE A;  4JTC B;  4LF7 O;  3UCS C;  1H2K A;  3ABK B;  1FXK B;  4FM2 A;  2JGD A;  4LP8 A;  2P7T C;  1GN6 A;  4X62 B;  4AQY O;  2QA4 V;  3CRR A;  1GN2 A;  2B1I A;  2PUS A;  3S3W A;  1TAE A;  2F66 C;  5K1X A;  3BVO A;  3OTF A;  4X8A A;  1YJ9 V;  1VP7 A;  2WSS G;  2DE0 X;  5CN0 A;  3CCJ V;  3B2E E;  2E74 B;  2Q69 A;  1Q82 W;  1EZJ A;  3APQ A;  4RWU A;  1IJG A;  1GAX A;  2JDI G;  2KG7 B;  5D5Q A;  4P9O A;  4X66 O;  4MW3 A;  2HJF C;  1FFX A;  5LXT B;  3JAT B;  3K08 A;  5LOV B;  4EB6 B;  3QO7 A;  2L6L A;  3OR6 C;  5KLV H;  5CBG A;  3DGE A;  3T1H O;  1S76 D;  2WLH A;  3H01 A;  1BZK A;  5KHG A;  4PI0 A;  4YJ2 A;  2QTS A;  2QDO A;  4RUE A;  3VQX A;  1K9M W;  3KG2 A;  4B3T B;  2LQT A;  1G8M A;  3ZX6 A;  1Z5V A;  1XNQ B;  1HWY A;  1Y4M A;  2W0F C;  4JI0 B;  2CTP A;  4DUY B;  4H0L B;  1XI1 A;  1NH2 D;  4TWK A;  1YTF D;  2C2A A;  4X64 B;  4ZBM A;  2AXT Z;  2D2C B;  1GM9 A;  2UUC O;  1MNG A;  4E2L A;  2WA4 A;  1PL4 A;  1R3J C;  5A2Q N;  3L70 H;  5IYZ B;  2RMK B;  1ZAU A;  3RYI B;  1VQN V;  1ORQ C;  2Q73 A;  5J2U B;  4DR4 O;  4DXW A;  1I5X A;  1EM1 A;  1JQ0 A;  3B4S A;  5KAI Z;  2F93 B;  2UU9 B;  2HVK C;  3ZRW A;  5KX5 B;  1QNM A;  2ZKO A;  4O4I B;  4OX9 B;  4D7S A;  1KB9 F;  1Z2G A;  4B3S B;  2XAG A;  3E86 A;  3R65 A;  4KHP O;  1IBL B;  1HNX B;  2UXN A;  1ZL8 A;  3OEE G;  1AVM A;  1JJO A;  1GM7 A;  2Z3Y A;  4I7Z B;  3ASN C;  1FYJ A; 
#chains in the Genus database with same CATH homology
 1MMM A;  1VEW A;  3AK3 A;  1Y67 A;  3KKY A;  1AP5 A;  1IX9 A;  1I0H A;  3LSU A;  1BT8 A;  1BS3 A;  1PM9 A;  4JZG A;  3AK2 A;  4YIP A;  2ADQ B;  3K9S A;  1AR5 A;  1XIL A;  4FFK A;  1ZLZ A;  1XRE A;  1AP6 A;  1EN5 A;  4GUN A;  1XDC A;  1XUQ A;  1JA8 A;  1MA1 A;  2AW9 A;  3IC9 A;  3DC5 A;  1D5N A;  2P4K A;  1BSM A;  1KKC A;  1WB7 A;  3RN4 A;  1N0N A;  1JR9 A;  1VAR A;  2QKC A;  2RCV A;  3TJT A;  1GN4 A;  1ZUQ A;  1ZSP A;  2QKA A;  1GN3 A;  3QVN A;  3OT7 A;  1SZX A;  3CEI A;  4E4E A;  3MDS A;  4X9Q A;  3C3T A;  2ADP A;  3DC6 A;  1WB8 A;  1N0J A;  1IDS A;  5A9G A;  1I08 A;  4BR6 A;  1LUW A;  3BFR A;  1MNG A;  2GDS A;  4F6E A;  1ZTE A;  1IXB A;  1PL4 A;  3AK1 A;  1P7G A;  1EN6 A;  1LUV A;  3KDR A;  4JZ2 A;  1EM1 A;  1GN6 A;  1QNM A;  1MSD A;  1AR4 A;  1EN4 A;  1GN2 A;  3C3S A;  2CE4 A;  3EVK A;  5AG2 A;  4C7U A;  1B06 A;  2CDY A;  1AVM A;  4YIO A;  4JYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...