1ZLZA

Re-evaluation of the low-temperature azide in mn-dependent superoxide dismutase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
b'SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Azide Adduct of the Y174F mutant of Manganese superoxide dismutase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 74
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zlzA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zlzA02
1IDSA 1N0JA 1JA8A 1P7GA 2CE4A 1ZTEA 3AK2A 1XUQA 1IX9A 2P4KA 1SZXA 1Y67A 1BSMA 4GUNA 2GDSA 1GN6A 1QNMA 4FFKA 1PL4A 4YIOA 4E4EA 1GN2A 1MSDA 2QKCA 3QVNA 3KKYA 2QKAA 1IXBA 2ADPA 4YIPA 1MNGA 1WB8A 3RN4A 3CEIA 1AR5A 4JZ2A 1WB7A 3AK1A 3AK3A 1BS3A 1XILA 1AP5A 1EN6A 1AR4A 1N0NA 1KKCA 1VEWA 4X9QA 1EN4A 3IC9A 1EM1A 3TJTA 1VARA 1AP6A 2RCVA 1ZUQA 3MDSA 1JR9A 3K9SA 5A9GA 3C3SA 1D5NA 1ZLZA 1XREA 1I0HA 3BFRA 3EVKA 4C7UA 1B06A 4JYYA 1LUVA 5AG2A 1GN4A 2ADQB 3LSUA 1AVMA 1BT8A 1ZSPA 1GN3A 1MA1A 3DC6A 1PM9A 3OT7A 3C3TA 4BR6A 2AW9A 4F6EA 4JZGA 1XDCA 3DC5A 1EN5A 1I08A 1MMMA 1LUWA 2CDYA
chains in the Genus database with same CATH superfamily
1M56C 5KX5B 4DW1A 4DV1O 2IH3C 2JK5C 2F93B 4O4HA 1W0JG 2ZIMA 3ZS8C 1SZTA 4UFZA 1YVWA 3ETGA 4WF9V 2EIJC 3ABLB 3A0RA 3CCMV 1FAFA 4QGPA 3ZBHA 3RFRA 3CRCA 3QG5A 1LNQA 4TUYB 3OD4A 1Z2GA 3CYOA 1H38A 3T1CA 3B8MA 4QE9A 2VQFO 3P3NA 1D5AA 4WBNA 1YF2A 1FXKA 3E22B 4UCSA 4NTWA 2RN9A 2X6AA 1EFRG 5DEDA 5KHGA 3DGEA 1SA0A 4EKWA 2L6LA 3EHBB 3P32A 5K1XA 4JI2O 3K08A 1FS0G 3ASOB 4ZOLA 3G67A 1THZA 1R73A 5JJJB 1AP5A 4GKJB 3JALB 1HP8A 3K5NA 1SQVH 3ZN1A 3K0GA 5H2FZ 4B3RB 1JR9A 4O4HB 2R9RB 2IU0A 1I0HA 4CC5A 2O57A 4FZ1A 4X8AA 2LGWA 1H2LA 3CCSV 5C8YA 3U10A 1N4CA 4BW5A 1OV9A 3E83A 4GYCB 4BAYA 4F6RB 4RUEA 2KKWA 2IJJA 2Y69C 3T2MA 4JV5B 4WBNB 4DR5O 2WSSG 1FXKB 3RYCA 2OWOA 1G8MA 1YCIA 1RSOA 1NR1A 1R3JC 4UCVA 2KG7A 5IJ0A 5JJEB 1DTOA 4YJ3B 4RUFA 2ZE6A 4DUZO 3AG3C 1YI2V 4ZOLB 1B3QA 1Q8IA 4B7KA 4QNHB 1NVPD 1G4YB 2CDYA 1JA8A 5LYJA 3ABMB 2QWRB 3M99B 1K4CC 5L3EA 1M4UA 3RT3C 3CC2V 4J7KA 1GN6A 1JCHA 1IBLO 2YEVA 2DYSC 3K58A 1ORQC 4E4EA 4WFAV 1B6QA 5C8YB 2Q0AA 5KLVH 5LP6C 1IXBA 4YHHB 3A0HZ 1OCRC 2ADPA 1Q6IA 3B40A 2UXCO 1E79G 2GUZA 4JZ2A 3BCCH 3ZHRA 2DN9A 3L74H 1RSOB 4NXNB 4NYKA 4IIJA 4JI0O 2ILMA 4MW3A 3D3IA 2OYQA 2LW7A 4DUYO 1YZBA 4R6ZA 1U97A 1BGYH 1S76D 2ETNA 5E1AC 2GTAA 2H3OA 4N21A 1UPGA 1Y4MA 5LYJB 1ENVA 2X6BA 4DR3O 1FXVA 2Q7HA 4P9OA 4O2AB 1K33A 4JI5O 4LWSB 5LHGA 3CCRV 1HNXB 2YEVB 4JI6O 3D3QA 1NQTA 5AG2A 2L35A 4NTYA 2EIKC 2EJ7A 2EX3A 4G27B 1Q43A 1N36B 4FFBA 4DV7O 2RNBA 1P49A 4DV4B 2DJVA 1I94B 1YJNV 1K73W 3MD0A 3RWRD 4GT1A 5GW7A 4IIJB 5EYPA 1QCEA 4FLVA 1IDSA 2F1MA 2UUAO 2OTJV 3DTUB 2LFSA 4B3TB 1PPJH 2HLDG 1AILA 2Y4UA 1YITV 3AG1B 3UCSC 1BMFG 1O9HA 4PA3A 1EZVH 3D36A 2E74B 2PGGA 3CRRA 3BY6A 3H1HH 2ZIOA 1Y76A 1GN2A 4LFAB 1OZ0A 2B1GA 3SJCC 4KXRA 1WP8A 3RYHA 2AZ2A 2P6JA 2IJIA 3KDRA 4YIPA 4LP8A 5LXTA 3CD6V 1AR5A 2FMLA 5CBHA 3KCYA 4FFBB 4H13B 1M56B 3AK1A 4DV0B 4NXMB 3ZRVA 3WB0A 5J2UA 2ZQMA 1N0NA 3JCUZ 2HVJC 4QE7A 2IJKA 4R8CA 2EIJB 5EYPB 3TJTA 4DXWA 4X64B 1HNWB 3L9DA 1TUBA 4J41A 2VQEB 1BE3H 4DV5O 2PUSA 2B5UA 1Z5VA 4I5SA 2RQ6A 1BHAA 4EEQA 3C90A 3ETEA 4JYAO 2YDEA 4JI8O 4DYLA 1QQCA 3H1LH 1Y76B 2FTKA 1VQ5V 3U11A 4IT5A 5EK0A 1GN4A 4KL1A 5LMUO 4XDKA 3CX5F 3FB7C 3L75H 1QBZA 1HDJA 2R70A 1Q7YW 3WB2A 3CS5A 3T4DA 1XNRB 1XL6A 3OM3B 4MTXA 3K3WA 5GONA 4FMTA 3DXRA 5LXTB 5BMVA 3BRCA 3R65A 3N27A 5J2UB 4DR1B 1FJGO 3BEHA 2KSDA 3HR0A 1N0JA 2OIEA 3UO2A 1PL0A 1GTOA 2FKXA 1Y67A 1R6NA 1AROP 1TUBB 3IFXA 5LP6A 4B7EA 3KG2A 1F7YA 5KHKA 2Y69B 2K1EA 2JRIA 1NTZH 4N23A 3FYEB 1KD1W 3QVNA 3T4ZA 2QKAA 4GKKO 3ZRSA 4LFBB 3ZN0A 4RQEA 3LDCA 3BPZA 4FPPA 1JVMA 3IJ4A 2P7TC 1TAEA 1SF9A 3GWOA 3G6BA 5LHHA 1SQQH 3CC4V 5GONB 3GVMA 3CSXA 3DXRB 4IYHA 5BMVB 4R7CA 1YEWA 3OFNG 2RJZA 3IC9A 2OCCC 4DV3O 4Q20A 1X4TA 4J42A 1BZKA 2Q69A 2DYSB 3ZIAG 4MTFA 4ICGA 2GSMB 5A9GA 5CA1A 4A5UB 1D5NA 4I0XA 4CC6A 5LP6B 2XAJA 4PDVA 4NR1A 2JGUA 2JJ1G 4F4LA 3B77A 3N2GB 2IJHA 3I56V 1Y74A 5B5EZ 1QR8A 4JASA 2WLJA 1Q6UA 2WPDG 4FM0A 2M7WA 4LF9B 4LF8B 1H5WA 1PKXA 2CGOA 4D7SA 3W7SA 4DV6B 4AHCA 4PJ0Z 4F6EA 3JD4A 1N32O 3RGBA 2DWEC 1RM1B 1SESA 3DC5A 4J9ZB 4B08A 3CCQV 5L3CA 4O4IA 4IHJB 1KYOF 2Q6AA 3UQ8A 2ZR2A 2W0FC 5GTIZ 1QVGU 3LDDA 1OCOC 1MOFA 2YI8A 1NTKH 4I0XB 4CS3A 1WPBA 1VQ9V 1JPXA 4KHPO 5EC1C 2CTWA 1GM8A 5ITZA 5IE9A 4OX9B 1Y74B 2BE3A 3MAQA 1FFXA 1Y6XA 1MNGA 4JYBA 1M57C 4DR7B 3LUTB 2HHHB 3P30A 2RDCA 2DYRC 3CCEV 1WB7A 2LW1A 1XMOO 2JS5A 3T1HB 4LR3A 3UO3A 1OCCB 1AR4A 5JQGA 1K34A 3W7XA 1K5QA 3S3XA 3FD9A 4LFCO 3SYPA 4X65O 3G4SV 5LOVA 4FLYA 4Z1MG 4X89A 4OGQB 1IXMA 5IDJA 3SJBC 3S3WA 2CAZC 3BFRA 1V54C 1XHZA 2YC0A 5DM6V 1SKVA 2ZR3A 3JATB 3FAVA 2XOKG 1VQ6V 2XAFA 3OAAG 1K7DA 3JAWB 5KAIZ 1L1FA 3WG7C 4FLWA 5ITZB 4LC1A 1FFXB 4J9YB 2P5OA 4NVPA 1IBMB 2EULA 3ETQA 1SQBH 4H44B 1W59A 2WLIA 3E22A 1PD3A 5JQGB 1P7GA 4ABMA 3VBBA 1N34B 1WJZA 2IU3A 5LOVB 4PA7A 1XL4A 2JJ2G 3JALA 1HNZB 1HR0O 2QM8A 3VOUA 2LFRA 4JAVA 1K4DC 3PJSK 3FAVB 4H37A 5FLXN 2XHBA 3OR6C 2P67A 1OCZC 3ZMUA 1YJWV 4WCEV 4JI3B 5FNVA 4B3SB 1GK9A 3OMIB 5LGTA 2ODMA 2QWQB 4PHZA 3SYCA 3GB7C 1KKDA 4F6RA 3K79A 1AR1B 2WLIB 3SJAC 1TUEB 5KAFZ 3LSSA 5JWPA 3TK1A 5IWAB 2UUBB 1RPRA 1XEQA 1F51A 1XREA 4YJ3A 2QTSA 3OEHG 2H8PC 3TXQA 1FKAO 2Q5ZA 2AHYA 2QWOB 1SETA 4HNAA 2DQ3A 3JAMN 2UXDO 1FPOA 4X20B 1J5EO 2ITCC 5EBWC 4CH6A 4DR5B 3LSUA 5EIBC 3BVOA 2QWNB 1R3IC 4OPAA 1R1BA 3HKEA 1MA1A 1WP7A 3FFQA 1IJGA 3QTCA 2OCCB 1M1KW 4UB6Z 5FNVB 1VQLV 2WWWA 4DUZB 5EIBD 1Q90D 3QF7A 4MVOA 5BXZA 2EZPA 5LL6Y 4TT3G 5KUMA 4MVZA 2VRZA 1W2BU 2R9IA 2ZCEA 2GHYA 4UVCA 1VQ4V 5TISZ 3PN1A 3JYCA 3DSQA 2YI9A 1IX9A 2BTOA 2DQ0A 3ZMTA 1QNMA 1IBLB 3ZMVA 1JQ0A 3LDEA 5BR8B 1JJ2U 2A0LA 2PI5A 4GKJO 4FLUA 4OXSA 3W7WA 4HNAB 1ROPA 3OGIB 4B3RO 2VWKA 2MK3A 4I55B 2BTQB 4AILC 4O2AA 3RN4A 3IC7A 4LWSA 3HKEB 3HKDB 5H6QA 2YIAA 2JIZG 3E8FA 1XILA 2H94A 1EN6A 3HKCA 4DUYB 1OCOB 3E8BA 5B1BC 4JV5O 2D2CB 2IH1C 1VARA 2RCVA 1S3JA 4DR3B 1Q5OA 3SYAA 5FL7G 2XNDG 4MVUA 3NXSA 1P84F 3BA9A 4MVMA 4DR4B 2DYRB 1GRJA 3ABKC 1XNQB 2C2AA 4FZ0A 4CS4A 1E1QG 3JARA 4LH7A 2R72A 2WLMA 4P2ZA 1QLNA 4LF4B 4WFEA 5J9PC 2QM4A 3SPIA 1PNLA 1EN5A 1H2NA 1BQZA 4PA6A 4QIWF 3HKCB 4YHHO 1AI5A 4Q6GA 1V54B 3THOA 5JJNB 2BSKA 2WLHA 5JVDA 3ZHQA 2HJDA 4UUJC 4NXNO 2V4DA 4MW8A 4GX1A 4LNUB 4FFKA 2M6YA 4JPRA 2ZE7A 3VQYA 3LSQA 1NKDA 3KKYA 1PV0A 4X88A 1QLEC 1US6A 1GH6A 4BIUA 1T5EA 2BOBC 4EB6A 1S0VA 3K03A 4WFHA 4WFGA 3JARB 5BZBA 5HFMA 3ASNC 3GWKC 5CBGA 1HNXO 4JAUA 2HEPA 1ZX3A 3QO5A 3CE2A 3OW2U 2QR4A 1IZ3A 4PELA 3K57A 5J2TA 1KMIZ 1XHXA 1N36O 2BSKB 5JVDB 3OTFA 4FIPC 3C3SA 1ZLZA 3ZHVA 1Q86W 4DV4O 1I94O 2VS0A 1LR1A 4GX5A 3FB5C 5JCOC 4JI8B 1LUVA 2ZNJA 5B3SC 1VF7A 5IYCO 2QA4V 2VWJA 5LMUB 2EILC 4BIZA 4B3TO 3FX7A 3BHPA 1F4NA 4RAIA 4EB6B 5LGNA 2PF4E 2QKSA 1IBKO 1K97A 5IJ9B 4JI4B 1H8EG 1O9GA 3SPJA 2EBOA 4LFAO 2OCHA 1XOUA 2DE0X 3X2QC 2ZXWC 1RPOA 1RP3B 3ICXA 2Y0IA 3UKMA 1MMMA 4U3JB 2DW4A 2CE4A 3ZHUA 1PNKA 1ZTEA 1XUQA 4X1YA 2OT5A 5J2TB 1BSMA 3FB6C 3E8GA 4KP4A 4NXMO 4DV0O 2P4VA 2X7RB 2UXBB 5CB4A 5L3DA 4I50A 4X64O 1HNWO 1XMQB 1JMKC 2IM9A 4GKKB 2VQEO 4X66B 3CMEV 2QEXV 5EC2C 3K5MA 4D7TA 3WU2Z 4MS2A 2UXXA 4ASUG 3OGCC 4PI2A 3CEIA 3T1YB 3QO8A 3AK3A 2ATKC 1BS3A 2IBZH 3N2GA 3SPHA 4LCUC 2UUCB 2ZD9A 3ABTA 3OTOB 4LF5B 2PTMA 1WNSA 1AP6A 1ZUQA 4J7ZA 1I5XA 3AG3B 3TGUH 3ZHSA 3UM7A 2X0LA 3L70H 4X1YB 5B1AC 5CB4B 4ZIBA 4IHJA 4JTCB 1KC8W 4DK0A 4I50B 4QPJA 3J81N 1E1RG 3RBZA 4JI1B 3CCVV 4TWKA 2F4VB 5KUKA 1AI6A 1AJNA 2QSAA 4JGSA 3L73H 3BAAA 4CZZA 1OCRB 2E5LO 5IYZA 1FYJA 3RVYA 4GX2A 1LUWA 4LFBO 3JD0A 2P22C 1K8AW 2NR5A 2P4KA 1SZXA 3N2KA 4PD4F 4DV2B 3A8TA 4O4LA 2G38A 1B04A 4U3FH 4IL6Z 4PA4A 5D5QA 3ABKB 4LF7B 1FXKC 5KA6A 5B1NA 2WA4A 1UJWB 4B3MO 1YHQV 1BHBA 2FYUH 2E75B 3STZC 1NBMG 2AXTZ 4JYCA 2BOCC 1DGSA 3AG4C 2YXHA 5EZYA 3MHHC 2Q7EA 1V9PA 3JATA 1BCCH 2EIKB 3JAWA 1KKCA 5LHIA 4I9QA 2V7QG 4JF3A 4TV8A 4LF9O 4KUMA 2PYJA 5IYZB 1XI1A 1F4MA 2A79B 1VQMV 2Q4PA 3MDSA 2Q7GA 1FOUA 4PDMA 3K5OA 4DV6O 3N2KB 3CJHA 3JAKA 3EVKA 1QLEB 2DOSA 3JSNA 4O4LB 1B06A 4X62B 4JYYA 3SDLA 1YDXA 4BWAA 1VQPV 3JSLA 2FL4A 2PYLA 2UU9B 2JGDA 3OUFA 5K1PA 1TA8A 2QGNA 1SS3A 2ADQB 1N33B 3B4SA 3CMAV 4DR2O 3C3TA 2AW9A 2P06A 4JZGA 3EXAA 5EZYB 2HJFC 4AQYB 1L0LH 4YY3B 3ML0A 4OX9O 3A0BZ 3ETDA 2ZM6B 1I08A 3ZEDA 4JI7B 3K0DA 1H8HG 1TGOA 4IGGA 4TV8B 4LF6B 4OPHA 1WPXA 4K0KO 4DR7O 2HHHO 2QJ1A 2R9AA 1VP7A 3APOA 5B3SB 5DECA 2LJ2A 4JTAB 2K9PA 2Y48A 3J7AU 2W6IG 2EILB 2E3CA 3T1HO 1G1XB 1URFA 3CJHB 3JAKB 1R6TA 3STLC 1DF5A 5LMNB 2QE7G 4X1KB 4K8ZA 3K59A 3OMAB 3VQVA 2EZOA 2LO1A 2HKOA 4DV1B 1VQOV 1CEZA 2JGDB 1JX9A 3RVZA 2N05A 2CK3G 5H9CA 3X2QB 4D6TH 4UCTA 4GCZA 1NI8A 4FLTA 4I7ZB 4E2LA 2YXYA 2A9HA 4X20A 2XAHA 1Z5WA 2VQFB 2CTRA 1DF4A 1TVKA 1K9MW 4GX0A 2ARHA 2Q8VA 4J10A 4QPKA 3K9SA 1IBMO 1JFFA 4JI2B 4WFFA 4PDLA 1CPYA 4DR6O 3ZMSA 3ZX6A 2Y4TA 3G71V 2JDIG 3D8CA 4X1IA 5D5PA 2UXDB 1OHHG 2QWPB 1J5EB 1G6UA 1MZEA 1N34O 1VMGA 3U0ZA 5CMUA 4LH6A 2Q68A 1P7BA 2GTSA 3OT7A 1Q82W 1CP9A 2KQXA 1SRYA 3ZHTA 4PA9A 1HNZO 2YIDA 1D2DA 3AG2C 1KP3A 1COWG 5C93A 2Z0AA 3SYQA 3JD2A 4NKGB 3D36C 4I55A 3AK2A 2BTQA 5B1AB 1VQ7V 1TVKB 4JI3O 4B3SO 1NT2B 2F43G 1VIBA 3HKDA 4GUNA 3OEEG 1MG1A 4TV9A 2YICA 4H33A 1L0NH 2JEUA 3JASB 1HWYA 1KU9A 4UV8A 3H01A 1JFFB 4FVMA 2PZSA 1PL4A 4YIOA 2NNUA 2WA3A 2QKCA 1GAXA 3WB1A 1R3KC 3TXSA 4DW0A 4DO2A 3HKBA 4X1IB 5IWAO 5KHIA 2UUBO 1VF6C 3B2EE 3OE7G 4UCUA 1NU1H 3CCLV 1YJ9V 4G2KA 3ZJZA 2XASA 4RQFA 1V55C 4UV9A 2WLLA 5JH7A 2OIGA 1GO3F 1VEWA 1KECA 1GMGA 1W0KG 4PI0A 2AGAA 2UXCB 4W4LA 4HAMA 2F95B 2JS3A 1SA0B 4MTGA 3H1IH 3E8HA 3AG7A 4ZKIA 3UT5A 4BW9A 4O4JA 4UCOA 4TV9B 4JI0B 1PNMA 2EJRA 4HYOA 2EIMC 4GLXA 2QTOA 3AG4B 4FM2A 5IY5C 2CTPA 2YS8A 3FB8C 3HKBB 1GN3A 4LNUA 1NS1A 3EFFK 5BR8O 4JI5B 1JNBA 4AI8A 5B66Z 1SQPH 2QDOA 3K5LA 2WLLB 4JI6B 5JH7B 1M57B 5FPOA 2W0XA 4MVSA 3APQA 1SQXH 1NTMH 1S77D 4TOIA 2PY5A 2ZINA 4UCRA 1AJPA 3RYCB 1AI4A 1N8RW 1ZL8A 4DV7B 1F23A 2XUMA 2KG7B 5IJ0B 1R3LC 4WFBV 2YUAA 2OTLV 3LNMB 3UT5B 4J7JA 4O4JB 2RMKB 2AHZA 1ZAUA 4U7OA 2WLKA 3H1KH 2XT9A 4K3AA 4MTOA 1JJOA 1CXZB 3ZCCA 2IW5A 3CC7V 2UUAB 2YXLA 2B1IA 1RM1C 2LGQA 3ABUA 4FLXA 4H0LB 3ZRXA 4CH5A 3WG7B 4EFBA 4UVBA 4RWUA 2HP8A 4DR4O 3SYOA 1M90W 5FPRA 1EN4A 1WA8A 4XDJA 1XNQO 3E2EA 1NH2B 5F2VO 3WFVA 4JAAA 2BCCH 3SPGA 5E79Z 2GUZB 5IJ9A 1IVSA 3CXCU 4LF4O 1ZL8B 1VF5B 1X59A 4NTXA 4RO2A 5KHJA 4J11A 4XDLA 4U3JA 4JTDB 3IAYA 2V1DA 2CUGA 1HW7A 5KHHA 3CXHF 1OCCC 3E86A 4Z2WA 1Q6HA 3M7MX 1R6KA 2NLJC 4DV5B 3SJQC 1FD9A 2P90A 1PM9A 4HBNA 4W4KA 2XTAA 1AI7A 4EFEA 1IBKB 3AEIA 1OCZB 5KMGA 4P30A 1QR9A 4JYAB 4UVAA 1YTFD 1NJIW 1WA8B 3JCZA 1UFIA 1MABG 5GTHZ 2CH7A 1S5HC 1VF6A 1PP9H 1SC5B 2YIBD 1IURA 1MSDA 2ZDIC 1DK1A 4KFMA 2ITDC 2EINC 2E76B 3O9OA 3RYFA 1FJGB 2WAMA 5H5NA 2A3QA 4UXNA 4NB5A 1Q3EA 3CCJV 3AG2B 1SERA 5A2QN 2F66C 3CB2A 2B9ZA 2UXNA 1MZFA 2Q9LA 4IYIA 4I4TA 2JVDA 2D3OW 5KMGB 4X9QA 4U7NA 3M8AA 4HZ3A 3RYHB 1S72V 3HPLC 1NR7A 3NR7A 4O2BA 4C7UA 4JI4O 2ZKOA 2CH7B 5B1OA 4FM1A 1NZ6A 3P3PA 2HR3A 5L3GA 1K5SA 3ABLC 3I5DA 1FXHA 4CS2A 5CBFA 4R50A 4DV3B 4DK1A 3J80N 3RYFB 1H2MA 1V55B 5L3BA 4G28B 1BT8A 1ZSPA 1XNRO 3BA8A 3DC6A 5LA6A 2CTQA 3Q4HA 1H2GA 2UXBO 3RYIA 2FB5A 3JD3A 2NN4A 4FLZA 2A7WA 2E5LB 1RFYA 4L8JA 3B8NA 2Y0PA 4DR1O 4MVQA 3OUSA 1XMQO 1NVPB 1BQ0A 3SR2C 4I4TB 5KA5A 3ASOC 1MSWD 1BL8A 1SQGA 4X66O 3FKSG 3CWBH 5LGUA 3H9VA 4PV1B 3G80A 4PDRA 1XBLA 1JOYA 2EIMB 4CH4A 2DWDC 2XAGA 3A2FA 3L72H 1M5IA 1KB9F 3T1YO 3CRAA 1EZJA 5IY5B 5B1BB 3TCUA 1H2KA 2ZT9B 4O2BB 3BABA 4DRXA 2UUCO 3G6EV 1VQ8V 3B09A 3OTOO 3SGIA 1QHTA 1N32B 2N04A 4TQFA 4B3MB 4LF5O 3R66A 3CP1A 3F7VC 1VQKV 3VQWA 1AJQA 3KZIZ 2F23A 3QNEA 2Q0OC 1VQNV 3ZRWA 2X6CA 4Z1VA 2AZ0A 4MT8A 3E89A 5LA6B 1KQSU 3Q4HB 2ZE8A 4P9PA 2Z3YA 1QU7A 1GM9A 3RYIB 2W6JG 4K8XA 4KHPB 4I9WA 4MSWC 2GBOA 1WLEA 1KBHA 2LP7A 4YJ2A 1K92A 1SQFA 3TETA 5DN6G 1Y66A 4JI1O 1Q81W 2F4VO 4TQDA 3KCXA 1I7FA 1GKFA 1K3EA 3K04A 5CA3A 3QO7A 3ABMC 5IYBO 4BIOA 3K06A 1XMOB 3CRQA 4QJFB 5EBMC 5IYDO 4DRXB 5H6RA 3OR7C 3SPCA 4FJCC 3F5TA 1FFTB 4LFCB 1H2SB 4X65B 4LF8O 2Q73A 2HFEC 5JCOA 4CH3A 4DV2O 1AVMA 2QM7A 5CN0A 4MVRA 1KP2A 2DMXA 1EBOA 1QVFU 2PI4A 2HVKC 4LF7O 3K9AA 4DR2B 5CA1B 2YSUB 1S5JA 2YIBA 3ZRWB 4XBFA 4X1KA 1WAZA 3CCUV 2Q67A 1DLBA 2XAQA 1XQ8A 4UB8Z 1ZWIC 3ASNB 2MW2B 4YJ2B 1KUQA 2ZDIA 4K35A 4K0KB 1AB3A 2N74A 5CA0A 3VQXA 1I5YA 2GDSA 3OMNB 2HG5C 1J95A 3CPWU 2ZE5A 1U96A 5L3FA 3W7TA 4J80A 2ZNIA 1YTFB 5LBQA 5IT9N 2JEXA 4O4IB 3E35A 1GM7A 3W7UA 4GZRB 1WB8A 4ZBMA 1S5LZ 4LBEC 1A32A 5EBLC 4X62O 2Z5UA 4L87A 4ZHQA 3H1JH 4ZI7A 5KX5A 1HR0B 2CGNA 2UU9O 2WLNA 5BY1A 1EM1A 3F5WC 1NH2D 1WN7A 4CBCA 1N33O 3O65A 1M9NA 2ZXWB 2EINB 2GV9A 5CA0B 4TUYA 4AQYO 5HFLA 4YY3O 3MHSC 1YSCA 4YXWG 2ZM6O 3AG1C 4DR6B 4JI7O 2A06H 3HB3B 3IGAC 1OJHA 4LF6O 1YXBA 3JD1A 2KB1A 3I55V 1YIJV 2LQTA 3CRMA 3LNNA 3JASA 4TSFG 4BR6A 3FYIB 5LMNO 1XDCA 1P4RA 3ZMZA 1L8DA 3CHXA 3L71H 1M93A 3RW0A 3F7YC 4ZHQB 4ZI7B 4FK5C
chains in the Genus database with same CATH topology
1IDSA 1N0JA 1JA8A 1P7GA 2CE4A 1ZTEA 3AK2A 1XUQA 1IX9A 2P4KA 1SZXA 1Y67A 1BSMA 4GUNA 2GDSA 1GN6A 1QNMA 4FFKA 1PL4A 4YIOA 4E4EA 1GN2A 1MSDA 2QKCA 3QVNA 3KKYA 2QKAA 1IXBA 2ADPA 3KDRA 4YIPA 1MNGA 1WB8A 3RN4A 3CEIA 1AR5A 4JZ2A 1WB7A 3AK1A 3AK3A 1BS3A 1XILA 1AP5A 1EN6A 1AR4A 1N0NA 1KKCA 1VEWA 4X9QA 1EN4A 3IC9A 1EM1A 3TJTA 1VARA 1AP6A 2RCVA 1ZUQA 3MDSA 1JR9A 3K9SA 5A9GA 3C3SA 1D5NA 1ZLZA 1XREA 1I0HA 3BFRA 3EVKA 4C7UA 1B06A 4JYYA 1LUVA 5AG2A 1GN4A 2ADQB 3LSUA 1AVMA 1BT8A 1ZSPA 1GN3A 1MA1A 3DC6A 1PM9A 3OT7A 3C3TA 4BR6A 2AW9A 4F6EA 4JZGA 1XDCA 3DC5A 1EN5A 1I08A 1MMMA 1LUWA 2CDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDS A;  1N0J A;  1JA8 A;  1P7G A;  2CE4 A;  1ZTE A;  3AK2 A;  1XUQ A;  1IX9 A;  2P4K A;  1SZX A;  1Y67 A;  1BSM A;  4GUN A;  2GDS A;  1GN6 A;  1QNM A;  4FFK A;  1PL4 A;  4YIO A;  4E4E A;  1GN2 A;  1MSD A;  2QKC A;  3QVN A;  3KKY A;  2QKA A;  1IXB A;  2ADP A;  4YIP A;  1MNG A;  1WB8 A;  3RN4 A;  3CEI A;  1AR5 A;  4JZ2 A;  1WB7 A;  3AK1 A;  3AK3 A;  1BS3 A;  1XIL A;  1AP5 A;  1EN6 A;  1AR4 A;  1N0N A;  1KKC A;  1VEW A;  4X9Q A;  1EN4 A;  3IC9 A;  1EM1 A;  3TJT A;  1VAR A;  1AP6 A;  2RCV A;  1ZUQ A;  3MDS A;  1JR9 A;  3K9S A;  5A9G A;  3C3S A;  1D5N A;  1ZLZ A;  1XRE A;  1I0H A;  3BFR A;  3EVK A;  4C7U A;  1B06 A;  4JYY A;  1LUV A;  5AG2 A;  1GN4 A;  2ADQ B;  3LSU A;  1AVM A;  1BT8 A;  1ZSP A;  1GN3 A;  1MA1 A;  3DC6 A;  1PM9 A;  3OT7 A;  3C3T A;  4BR6 A;  2AW9 A;  4F6E A;  4JZG A;  1XDC A;  3DC5 A;  1EN5 A;  1I08 A;  1MMM A;  1LUW A;  2CDY A; 
#chains in the Genus database with same CATH topology
 1M56 C;  5KX5 B;  4DW1 A;  4DV1 O;  2IH3 C;  2JK5 C;  2F93 B;  4O4H A;  1W0J G;  2ZIM A;  3ZS8 C;  1SZT A;  4UFZ A;  1YVW A;  3ETG A;  4WF9 V;  2EIJ C;  3ABL B;  3A0R A;  3CCM V;  1FAF A;  4QGP A;  3ZBH A;  3RFR A;  3CRC A;  3QG5 A;  1LNQ A;  4TUY B;  3OD4 A;  1Z2G A;  3CYO A;  1H38 A;  3T1C A;  3B8M A;  4QE9 A;  2VQF O;  3P3N A;  1D5A A;  4WBN A;  1YF2 A;  1FXK A;  3E22 B;  4UCS A;  4NTW A;  2RN9 A;  2X6A A;  1EFR G;  5DED A;  5KHG A;  3DGE A;  1SA0 A;  4EKW A;  2L6L A;  3EHB B;  3P32 A;  5K1X A;  4JI2 O;  3K08 A;  1FS0 G;  3ASO B;  4ZOL A;  3G67 A;  1THZ A;  1R73 A;  5JJJ B;  1AP5 A;  4GKJ B;  3JAL B;  1HP8 A;  3K5N A;  1SQV H;  3ZN1 A;  3K0G A;  5H2F Z;  4B3R B;  1JR9 A;  4O4H B;  2R9R B;  2IU0 A;  1I0H A;  4CC5 A;  2O57 A;  4FZ1 A;  4X8A A;  2LGW A;  1H2L A;  3CCS V;  5C8Y A;  3U10 A;  1N4C A;  4BW5 A;  1OV9 A;  3E83 A;  4GYC B;  4BAY A;  4F6R B;  4RUE A;  2KKW A;  2IJJ A;  2Y69 C;  3T2M A;  4JV5 B;  4WBN B;  4DR5 O;  2WSS G;  1FXK B;  3RYC A;  2OWO A;  1G8M A;  1YCI A;  1RSO A;  1NR1 A;  1R3J C;  4UCV A;  2KG7 A;  5IJ0 A;  5JJE B;  1DTO A;  4YJ3 B;  4RUF A;  2ZE6 A;  4DUZ O;  3AG3 C;  1YI2 V;  4ZOL B;  1B3Q A;  1Q8I A;  4B7K A;  4QNH B;  1NVP D;  1G4Y B;  2CDY A;  1JA8 A;  5LYJ A;  3ABM B;  2QWR B;  3M99 B;  1K4C C;  5L3E A;  1M4U A;  3RT3 C;  3CC2 V;  4J7K A;  1GN6 A;  1JCH A;  1IBL O;  2YEV A;  2DYS C;  3K58 A;  1ORQ C;  4E4E A;  4WFA V;  1B6Q A;  5C8Y B;  2Q0A A;  5KLV H;  5LP6 C;  1IXB A;  4YHH B;  3A0H Z;  1OCR C;  2ADP A;  1Q6I A;  3B40 A;  2UXC O;  1E79 G;  2GUZ A;  4JZ2 A;  3BCC H;  3ZHR A;  2DN9 A;  3L74 H;  1RSO B;  4NXN B;  4NYK A;  4IIJ A;  4JI0 O;  2ILM A;  4MW3 A;  3D3I A;  2OYQ A;  2LW7 A;  4DUY O;  1YZB A;  4R6Z A;  1U97 A;  1BGY H;  1S76 D;  2ETN A;  5E1A C;  2GTA A;  2H3O A;  4N21 A;  1UPG A;  1Y4M A;  5LYJ B;  1ENV A;  2X6B A;  4DR3 O;  1FXV A;  2Q7H A;  4P9O A;  4O2A B;  1K33 A;  4JI5 O;  4LWS B;  5LHG A;  3CCR V;  1HNX B;  2YEV B;  4JI6 O;  3D3Q A;  1NQT A;  5AG2 A;  2L35 A;  4NTY A;  2EIK C;  2EJ7 A;  2EX3 A;  4G27 B;  1Q43 A;  1N36 B;  4FFB A;  4DV7 O;  2RNB A;  1P49 A;  4DV4 B;  2DJV A;  1I94 B;  1YJN V;  1K73 W;  3MD0 A;  3RWR D;  4GT1 A;  5GW7 A;  4IIJ B;  5EYP A;  1QCE A;  4FLV A;  1IDS A;  2F1M A;  2UUA O;  2OTJ V;  3DTU B;  2LFS A;  4B3T B;  1PPJ H;  2HLD G;  1AIL A;  2Y4U A;  1YIT V;  3AG1 B;  3UCS C;  1BMF G;  1O9H A;  4PA3 A;  1EZV H;  3D36 A;  2E74 B;  2PGG A;  3CRR A;  3BY6 A;  3H1H H;  2ZIO A;  1Y76 A;  1GN2 A;  4LFA B;  1OZ0 A;  2B1G A;  3SJC C;  4KXR A;  1WP8 A;  3RYH A;  2AZ2 A;  2P6J A;  2IJI A;  3KDR A;  4YIP A;  4LP8 A;  5LXT A;  3CD6 V;  1AR5 A;  2FML A;  5CBH A;  3KCY A;  4FFB B;  4H13 B;  1M56 B;  3AK1 A;  4DV0 B;  4NXM B;  3ZRV A;  3WB0 A;  5J2U A;  2ZQM A;  1N0N A;  3JCU Z;  2HVJ C;  4QE7 A;  2IJK A;  4R8C A;  2EIJ B;  5EYP B;  3TJT A;  4DXW A;  4X64 B;  1HNW B;  3L9D A;  1TUB A;  4J41 A;  2VQE B;  1BE3 H;  4DV5 O;  2PUS A;  2B5U A;  1Z5V A;  4I5S A;  2RQ6 A;  1BHA A;  4EEQ A;  3C90 A;  3ETE A;  4JYA O;  2YDE A;  4JI8 O;  4DYL A;  1QQC A;  3H1L H;  1Y76 B;  2FTK A;  1VQ5 V;  3U11 A;  4IT5 A;  5EK0 A;  1GN4 A;  4KL1 A;  5LMU O;  4XDK A;  3CX5 F;  3FB7 C;  3L75 H;  1QBZ A;  1HDJ A;  2R70 A;  1Q7Y W;  3WB2 A;  3CS5 A;  3T4D A;  1XNR B;  1XL6 A;  3OM3 B;  4MTX A;  3K3W A;  5GON A;  4FMT A;  3DXR A;  5LXT B;  5BMV A;  3BRC A;  3R65 A;  3N27 A;  5J2U B;  4DR1 B;  1FJG O;  3BEH A;  2KSD A;  3HR0 A;  1N0J A;  2OIE A;  3UO2 A;  1PL0 A;  1GTO A;  2FKX A;  1Y67 A;  1R6N A;  1ARO P;  1TUB B;  3IFX A;  5LP6 A;  4B7E A;  3KG2 A;  1F7Y A;  5KHK A;  2Y69 B;  2K1E A;  2JRI A;  1NTZ H;  4N23 A;  3FYE B;  1KD1 W;  3QVN A;  3T4Z A;  2QKA A;  4GKK O;  3ZRS A;  4LFB B;  3ZN0 A;  4RQE A;  3LDC A;  3BPZ A;  4FPP A;  1JVM A;  3IJ4 A;  2P7T C;  1TAE A;  1SF9 A;  3GWO A;  3G6B A;  5LHH A;  1SQQ H;  3CC4 V;  5GON B;  3GVM A;  3CSX A;  3DXR B;  4IYH A;  5BMV B;  4R7C A;  1YEW A;  3OFN G;  2RJZ A;  3IC9 A;  2OCC C;  4DV3 O;  4Q20 A;  1X4T A;  4J42 A;  1BZK A;  2Q69 A;  2DYS B;  3ZIA G;  4MTF A;  4ICG A;  2GSM B;  5A9G A;  5CA1 A;  4A5U B;  1D5N A;  4I0X A;  4CC6 A;  5LP6 B;  2XAJ A;  4PDV A;  4NR1 A;  2JGU A;  2JJ1 G;  4F4L A;  3B77 A;  3N2G B;  2IJH A;  3I56 V;  1Y74 A;  5B5E Z;  1QR8 A;  4JAS A;  2WLJ A;  1Q6U A;  2WPD G;  4FM0 A;  2M7W A;  4LF9 B;  4LF8 B;  1H5W A;  1PKX A;  2CGO A;  4D7S A;  3W7S A;  4DV6 B;  4AHC A;  4PJ0 Z;  4F6E A;  3JD4 A;  1N32 O;  3RGB A;  2DWE C;  1RM1 B;  1SES A;  3DC5 A;  4J9Z B;  4B08 A;  3CCQ V;  5L3C A;  4O4I A;  4IHJ B;  1KYO F;  2Q6A A;  3UQ8 A;  2ZR2 A;  2W0F C;  5GTI Z;  1QVG U;  3LDD A;  1OCO C;  1MOF A;  2YI8 A;  1NTK H;  4I0X B;  4CS3 A;  1WPB A;  1VQ9 V;  1JPX A;  4KHP O;  5EC1 C;  2CTW A;  1GM8 A;  5ITZ A;  5IE9 A;  4OX9 B;  1Y74 B;  2BE3 A;  3MAQ A;  1FFX A;  1Y6X A;  1MNG A;  4JYB A;  1M57 C;  4DR7 B;  3LUT B;  2HHH B;  3P30 A;  2RDC A;  2DYR C;  3CCE V;  1WB7 A;  2LW1 A;  1XMO O;  2JS5 A;  3T1H B;  4LR3 A;  3UO3 A;  1OCC B;  1AR4 A;  5JQG A;  1K34 A;  3W7X A;  1K5Q A;  3S3X A;  3FD9 A;  4LFC O;  3SYP A;  4X65 O;  3G4S V;  5LOV A;  4FLY A;  4Z1M G;  4X89 A;  4OGQ B;  1IXM A;  5IDJ A;  3SJB C;  3S3W A;  2CAZ C;  3BFR A;  1V54 C;  1XHZ A;  2YC0 A;  5DM6 V;  1SKV A;  2ZR3 A;  3JAT B;  3FAV A;  2XOK G;  1VQ6 V;  2XAF A;  3OAA G;  1K7D A;  3JAW B;  5KAI Z;  1L1F A;  3WG7 C;  4FLW A;  5ITZ B;  4LC1 A;  1FFX B;  4J9Y B;  2P5O A;  4NVP A;  1IBM B;  2EUL A;  3ETQ A;  1SQB H;  4H44 B;  1W59 A;  2WLI A;  3E22 A;  1PD3 A;  5JQG B;  1P7G A;  4ABM A;  3VBB A;  1N34 B;  1WJZ A;  2IU3 A;  5LOV B;  4PA7 A;  1XL4 A;  2JJ2 G;  3JAL A;  1HNZ B;  1HR0 O;  2QM8 A;  3VOU A;  2LFR A;  4JAV A;  1K4D C;  3PJS K;  3FAV B;  4H37 A;  5FLX N;  2XHB A;  3OR6 C;  2P67 A;  1OCZ C;  3ZMU A;  1YJW V;  4WCE V;  4JI3 B;  5FNV A;  4B3S B;  1GK9 A;  3OMI B;  5LGT A;  2ODM A;  2QWQ B;  4PHZ A;  3SYC A;  3GB7 C;  1KKD A;  4F6R A;  3K79 A;  1AR1 B;  2WLI B;  3SJA C;  1TUE B;  5KAF Z;  3LSS A;  5JWP A;  3TK1 A;  5IWA B;  2UUB B;  1RPR A;  1XEQ A;  1F51 A;  1XRE A;  4YJ3 A;  2QTS A;  3OEH G;  2H8P C;  3TXQ A;  1FKA O;  2Q5Z A;  2AHY A;  2QWO B;  1SET A;  4HNA A;  2DQ3 A;  3JAM N;  2UXD O;  1FPO A;  4X20 B;  1J5E O;  2ITC C;  5EBW C;  4CH6 A;  4DR5 B;  3LSU A;  5EIB C;  3BVO A;  2QWN B;  1R3I C;  4OPA A;  1R1B A;  3HKE A;  1MA1 A;  1WP7 A;  3FFQ A;  1IJG A;  3QTC A;  2OCC B;  1M1K W;  4UB6 Z;  5FNV B;  1VQL V;  2WWW A;  4DUZ B;  5EIB D;  1Q90 D;  3QF7 A;  4MVO A;  5BXZ A;  2EZP A;  5LL6 Y;  4TT3 G;  5KUM A;  4MVZ A;  2VRZ A;  1W2B U;  2R9I A;  2ZCE A;  2GHY A;  4UVC A;  1VQ4 V;  5TIS Z;  3PN1 A;  3JYC A;  3DSQ A;  2YI9 A;  1IX9 A;  2BTO A;  2DQ0 A;  3ZMT A;  1QNM A;  1IBL B;  3ZMV A;  1JQ0 A;  3LDE A;  5BR8 B;  1JJ2 U;  2A0L A;  2PI5 A;  4GKJ O;  4FLU A;  4OXS A;  3W7W A;  4HNA B;  1ROP A;  3OGI B;  4B3R O;  2VWK A;  2MK3 A;  4I55 B;  2BTQ B;  4AIL C;  4O2A A;  3RN4 A;  3IC7 A;  4LWS A;  3HKE B;  3HKD B;  5H6Q A;  2YIA A;  2JIZ G;  3E8F A;  1XIL A;  2H94 A;  1EN6 A;  3HKC A;  4DUY B;  1OCO B;  3E8B A;  5B1B C;  4JV5 O;  2D2C B;  2IH1 C;  1VAR A;  2RCV A;  1S3J A;  4DR3 B;  1Q5O A;  3SYA A;  5FL7 G;  2XND G;  4MVU A;  3NXS A;  1P84 F;  3BA9 A;  4MVM A;  4DR4 B;  2DYR B;  1GRJ A;  3ABK C;  1XNQ B;  2C2A A;  4FZ0 A;  4CS4 A;  1E1Q G;  3JAR A;  4LH7 A;  2R72 A;  2WLM A;  4P2Z A;  1QLN A;  4LF4 B;  4WFE A;  5J9P C;  2QM4 A;  3SPI A;  1PNL A;  1EN5 A;  1H2N A;  1BQZ A;  4PA6 A;  4QIW F;  3HKC B;  4YHH O;  1AI5 A;  4Q6G A;  1V54 B;  3THO A;  5JJN B;  2BSK A;  2WLH A;  5JVD A;  3ZHQ A;  2HJD A;  4UUJ C;  4NXN O;  2V4D A;  4MW8 A;  4GX1 A;  4LNU B;  4FFK A;  2M6Y A;  4JPR A;  2ZE7 A;  3VQY A;  3LSQ A;  1NKD A;  3KKY A;  1PV0 A;  4X88 A;  1QLE C;  1US6 A;  1GH6 A;  4BIU A;  1T5E A;  2BOB C;  4EB6 A;  1S0V A;  3K03 A;  4WFH A;  4WFG A;  3JAR B;  5BZB A;  5HFM A;  3ASN C;  3GWK C;  5CBG A;  1HNX O;  4JAU A;  2HEP A;  1ZX3 A;  3QO5 A;  3CE2 A;  3OW2 U;  2QR4 A;  1IZ3 A;  4PEL A;  3K57 A;  5J2T A;  1KMI Z;  1XHX A;  1N36 O;  2BSK B;  5JVD B;  3OTF A;  4FIP C;  3C3S A;  1ZLZ A;  3ZHV A;  1Q86 W;  4DV4 O;  1I94 O;  2VS0 A;  1LR1 A;  4GX5 A;  3FB5 C;  5JCO C;  4JI8 B;  1LUV A;  2ZNJ A;  5B3S C;  1VF7 A;  5IYC O;  2QA4 V;  2VWJ A;  5LMU B;  2EIL C;  4BIZ A;  4B3T O;  3FX7 A;  3BHP A;  1F4N A;  4RAI A;  4EB6 B;  5LGN A;  2PF4 E;  2QKS A;  1IBK O;  1K97 A;  5IJ9 B;  4JI4 B;  1H8E G;  1O9G A;  3SPJ A;  2EBO A;  4LFA O;  2OCH A;  1XOU A;  2DE0 X;  3X2Q C;  2ZXW C;  1RPO A;  1RP3 B;  3ICX A;  2Y0I A;  3UKM A;  1MMM A;  4U3J B;  2DW4 A;  2CE4 A;  3ZHU A;  1PNK A;  1ZTE A;  1XUQ A;  4X1Y A;  2OT5 A;  5J2T B;  1BSM A;  3FB6 C;  3E8G A;  4KP4 A;  4NXM O;  4DV0 O;  2P4V A;  2X7R B;  2UXB B;  5CB4 A;  5L3D A;  4I50 A;  4X64 O;  1HNW O;  1XMQ B;  1JMK C;  2IM9 A;  4GKK B;  2VQE O;  4X66 B;  3CME V;  2QEX V;  5EC2 C;  3K5M A;  4D7T A;  3WU2 Z;  4MS2 A;  2UXX A;  4ASU G;  3OGC C;  4PI2 A;  3CEI A;  3T1Y B;  3QO8 A;  3AK3 A;  2ATK C;  1BS3 A;  2IBZ H;  3N2G A;  3SPH A;  4LCU C;  2UUC B;  2ZD9 A;  3ABT A;  3OTO B;  4LF5 B;  2PTM A;  1WNS A;  1AP6 A;  1ZUQ A;  4J7Z A;  1I5X A;  3AG3 B;  3TGU H;  3ZHS A;  3UM7 A;  2X0L A;  3L70 H;  4X1Y B;  5B1A C;  5CB4 B;  4ZIB A;  4IHJ A;  4JTC B;  1KC8 W;  4DK0 A;  4I50 B;  4QPJ A;  3J81 N;  1E1R G;  3RBZ A;  4JI1 B;  3CCV V;  4TWK A;  2F4V B;  5KUK A;  1AI6 A;  1AJN A;  2QSA A;  4JGS A;  3L73 H;  3BAA A;  4CZZ A;  1OCR B;  2E5L O;  5IYZ A;  1FYJ A;  3RVY A;  4GX2 A;  1LUW A;  4LFB O;  3JD0 A;  2P22 C;  1K8A W;  2NR5 A;  2P4K A;  1SZX A;  3N2K A;  4PD4 F;  4DV2 B;  3A8T A;  4O4L A;  2G38 A;  1B04 A;  4U3F H;  4IL6 Z;  4PA4 A;  5D5Q A;  3ABK B;  4LF7 B;  1FXK C;  5KA6 A;  5B1N A;  2WA4 A;  1UJW B;  4B3M O;  1YHQ V;  1BHB A;  2FYU H;  2E75 B;  3STZ C;  1NBM G;  2AXT Z;  4JYC A;  2BOC C;  1DGS A;  3AG4 C;  2YXH A;  5EZY A;  3MHH C;  2Q7E A;  1V9P A;  3JAT A;  1BCC H;  2EIK B;  3JAW A;  1KKC A;  5LHI A;  4I9Q A;  2V7Q G;  4JF3 A;  4TV8 A;  4LF9 O;  4KUM A;  2PYJ A;  5IYZ B;  1XI1 A;  1F4M A;  2A79 B;  1VQM V;  2Q4P A;  3MDS A;  2Q7G A;  1FOU A;  4PDM A;  3K5O A;  4DV6 O;  3N2K B;  3CJH A;  3JAK A;  3EVK A;  1QLE B;  2DOS A;  3JSN A;  4O4L B;  1B06 A;  4X62 B;  4JYY A;  3SDL A;  1YDX A;  4BWA A;  1VQP V;  3JSL A;  2FL4 A;  2PYL A;  2UU9 B;  2JGD A;  3OUF A;  5K1P A;  1TA8 A;  2QGN A;  1SS3 A;  2ADQ B;  1N33 B;  3B4S A;  3CMA V;  4DR2 O;  3C3T A;  2AW9 A;  2P06 A;  4JZG A;  3EXA A;  5EZY B;  2HJF C;  4AQY B;  1L0L H;  4YY3 B;  3ML0 A;  4OX9 O;  3A0B Z;  3ETD A;  2ZM6 B;  1I08 A;  3ZED A;  4JI7 B;  3K0D A;  1H8H G;  1TGO A;  4IGG A;  4TV8 B;  4LF6 B;  4OPH A;  1WPX A;  4K0K O;  4DR7 O;  2HHH O;  2QJ1 A;  2R9A A;  1VP7 A;  3APO A;  5B3S B;  5DEC A;  2LJ2 A;  4JTA B;  2K9P A;  2Y48 A;  3J7A U;  2W6I G;  2EIL B;  2E3C A;  3T1H O;  1G1X B;  1URF A;  3CJH B;  3JAK B;  1R6T A;  3STL C;  1DF5 A;  5LMN B;  2QE7 G;  4X1K B;  4K8Z A;  3K59 A;  3OMA B;  3VQV A;  2EZO A;  2LO1 A;  2HKO A;  4DV1 B;  1VQO V;  1CEZ A;  2JGD B;  1JX9 A;  3RVZ A;  2N05 A;  2CK3 G;  5H9C A;  3X2Q B;  4D6T H;  4UCT A;  4GCZ A;  1NI8 A;  4FLT A;  4I7Z B;  4E2L A;  2YXY A;  2A9H A;  4X20 A;  2XAH A;  1Z5W A;  2VQF B;  2CTR A;  1DF4 A;  1TVK A;  1K9M W;  4GX0 A;  2ARH A;  2Q8V A;  4J10 A;  4QPK A;  3K9S A;  1IBM O;  1JFF A;  4JI2 B;  4WFF A;  4PDL A;  1CPY A;  4DR6 O;  3ZMS A;  3ZX6 A;  2Y4T A;  3G71 V;  2JDI G;  3D8C A;  4X1I A;  5D5P A;  2UXD B;  1OHH G;  2QWP B;  1J5E B;  1G6U A;  1MZE A;  1N34 O;  1VMG A;  3U0Z A;  5CMU A;  4LH6 A;  2Q68 A;  1P7B A;  2GTS A;  3OT7 A;  1Q82 W;  1CP9 A;  2KQX A;  1SRY A;  3ZHT A;  4PA9 A;  1HNZ O;  2YID A;  1D2D A;  3AG2 C;  1KP3 A;  1COW G;  5C93 A;  2Z0A A;  3SYQ A;  3JD2 A;  4NKG B;  3D36 C;  4I55 A;  3AK2 A;  2BTQ A;  5B1A B;  1VQ7 V;  1TVK B;  4JI3 O;  4B3S O;  1NT2 B;  2F43 G;  1VIB A;  3HKD A;  4GUN A;  3OEE G;  1MG1 A;  4TV9 A;  2YIC A;  4H33 A;  1L0N H;  2JEU A;  3JAS B;  1HWY A;  1KU9 A;  4UV8 A;  3H01 A;  1JFF B;  4FVM A;  2PZS A;  1PL4 A;  4YIO A;  2NNU A;  2WA3 A;  2QKC A;  1GAX A;  3WB1 A;  1R3K C;  3TXS A;  4DW0 A;  4DO2 A;  3HKB A;  4X1I B;  5IWA O;  5KHI A;  2UUB O;  1VF6 C;  3B2E E;  3OE7 G;  4UCU A;  1NU1 H;  3CCL V;  1YJ9 V;  4G2K A;  3ZJZ A;  2XAS A;  4RQF A;  1V55 C;  4UV9 A;  2WLL A;  5JH7 A;  2OIG A;  1GO3 F;  1VEW A;  1KEC A;  1GMG A;  1W0K G;  4PI0 A;  2AGA A;  2UXC B;  4W4L A;  4HAM A;  2F95 B;  2JS3 A;  1SA0 B;  4MTG A;  3H1I H;  3E8H A;  3AG7 A;  4ZKI A;  3UT5 A;  4BW9 A;  4O4J A;  4UCO A;  4TV9 B;  4JI0 B;  1PNM A;  2EJR A;  4HYO A;  2EIM C;  4GLX A;  2QTO A;  3AG4 B;  4FM2 A;  5IY5 C;  2CTP A;  2YS8 A;  3FB8 C;  3HKB B;  1GN3 A;  4LNU A;  1NS1 A;  3EFF K;  5BR8 O;  4JI5 B;  1JNB A;  4AI8 A;  5B66 Z;  1SQP H;  2QDO A;  3K5L A;  2WLL B;  4JI6 B;  5JH7 B;  1M57 B;  5FPO A;  2W0X A;  4MVS A;  3APQ A;  1SQX H;  1NTM H;  1S77 D;  4TOI A;  2PY5 A;  2ZIN A;  4UCR A;  1AJP A;  3RYC B;  1AI4 A;  1N8R W;  1ZL8 A;  4DV7 B;  1F23 A;  2XUM A;  2KG7 B;  5IJ0 B;  1R3L C;  4WFB V;  2YUA A;  2OTL V;  3LNM B;  3UT5 B;  4J7J A;  4O4J B;  2RMK B;  2AHZ A;  1ZAU A;  4U7O A;  2WLK A;  3H1K H;  2XT9 A;  4K3A A;  4MTO A;  1JJO A;  1CXZ B;  3ZCC A;  2IW5 A;  3CC7 V;  2UUA B;  2YXL A;  2B1I A;  1RM1 C;  2LGQ A;  3ABU A;  4FLX A;  4H0L B;  3ZRX A;  4CH5 A;  3WG7 B;  4EFB A;  4UVB A;  4RWU A;  2HP8 A;  4DR4 O;  3SYO A;  1M90 W;  5FPR A;  1EN4 A;  1WA8 A;  4XDJ A;  1XNQ O;  3E2E A;  1NH2 B;  5F2V O;  3WFV A;  4JAA A;  2BCC H;  3SPG A;  5E79 Z;  2GUZ B;  5IJ9 A;  1IVS A;  3CXC U;  4LF4 O;  1ZL8 B;  1VF5 B;  1X59 A;  4NTX A;  4RO2 A;  5KHJ A;  4J11 A;  4XDL A;  4U3J A;  4JTD B;  3IAY A;  2V1D A;  2CUG A;  1HW7 A;  5KHH A;  3CXH F;  1OCC C;  3E86 A;  4Z2W A;  1Q6H A;  3M7M X;  1R6K A;  2NLJ C;  4DV5 B;  3SJQ C;  1FD9 A;  2P90 A;  1PM9 A;  4HBN A;  4W4K A;  2XTA A;  1AI7 A;  4EFE A;  1IBK B;  3AEI A;  1OCZ B;  5KMG A;  4P30 A;  1QR9 A;  4JYA B;  4UVA A;  1YTF D;  1NJI W;  1WA8 B;  3JCZ A;  1UFI A;  1MAB G;  5GTH Z;  2CH7 A;  1S5H C;  1VF6 A;  1PP9 H;  1SC5 B;  2YIB D;  1IUR A;  1MSD A;  2ZDI C;  1DK1 A;  4KFM A;  2ITD C;  2EIN C;  2E76 B;  3O9O A;  3RYF A;  1FJG B;  2WAM A;  5H5N A;  2A3Q A;  4UXN A;  4NB5 A;  1Q3E A;  3CCJ V;  3AG2 B;  1SER A;  5A2Q N;  2F66 C;  3CB2 A;  2B9Z A;  2UXN A;  1MZF A;  2Q9L A;  4IYI A;  4I4T A;  2JVD A;  2D3O W;  5KMG B;  4X9Q A;  4U7N A;  3M8A A;  4HZ3 A;  3RYH B;  1S72 V;  3HPL C;  1NR7 A;  3NR7 A;  4O2B A;  4C7U A;  4JI4 O;  2ZKO A;  2CH7 B;  5B1O A;  4FM1 A;  1NZ6 A;  3P3P A;  2HR3 A;  5L3G A;  1K5S A;  3ABL C;  3I5D A;  1FXH A;  4CS2 A;  5CBF A;  4R50 A;  4DV3 B;  4DK1 A;  3J80 N;  3RYF B;  1H2M A;  1V55 B;  5L3B A;  4G28 B;  1BT8 A;  1ZSP A;  1XNR O;  3BA8 A;  3DC6 A;  5LA6 A;  2CTQ A;  3Q4H A;  1H2G A;  2UXB O;  3RYI A;  2FB5 A;  3JD3 A;  2NN4 A;  4FLZ A;  2A7W A;  2E5L B;  1RFY A;  4L8J A;  3B8N A;  2Y0P A;  4DR1 O;  4MVQ A;  3OUS A;  1XMQ O;  1NVP B;  1BQ0 A;  3SR2 C;  4I4T B;  5KA5 A;  3ASO C;  1MSW D;  1BL8 A;  1SQG A;  4X66 O;  3FKS G;  3CWB H;  5LGU A;  3H9V A;  4PV1 B;  3G80 A;  4PDR A;  1XBL A;  1JOY A;  2EIM B;  4CH4 A;  2DWD C;  2XAG A;  3A2F A;  3L72 H;  1M5I A;  1KB9 F;  3T1Y O;  3CRA A;  1EZJ A;  5IY5 B;  5B1B B;  3TCU A;  1H2K A;  2ZT9 B;  4O2B B;  3BAB A;  4DRX A;  2UUC O;  3G6E V;  1VQ8 V;  3B09 A;  3OTO O;  3SGI A;  1QHT A;  1N32 B;  2N04 A;  4TQF A;  4B3M B;  4LF5 O;  3R66 A;  3CP1 A;  3F7V C;  1VQK V;  3VQW A;  1AJQ A;  3KZI Z;  2F23 A;  3QNE A;  2Q0O C;  1VQN V;  3ZRW A;  2X6C A;  4Z1V A;  2AZ0 A;  4MT8 A;  3E89 A;  5LA6 B;  1KQS U;  3Q4H B;  2ZE8 A;  4P9P A;  2Z3Y A;  1QU7 A;  1GM9 A;  3RYI B;  2W6J G;  4K8X A;  4KHP B;  4I9W A;  4MSW C;  2GBO A;  1WLE A;  1KBH A;  2LP7 A;  4YJ2 A;  1K92 A;  1SQF A;  3TET A;  5DN6 G;  1Y66 A;  4JI1 O;  1Q81 W;  2F4V O;  4TQD A;  3KCX A;  1I7F A;  1GKF A;  1K3E A;  3K04 A;  5CA3 A;  3QO7 A;  3ABM C;  5IYB O;  4BIO A;  3K06 A;  1XMO B;  3CRQ A;  4QJF B;  5EBM C;  5IYD O;  4DRX B;  5H6R A;  3OR7 C;  3SPC A;  4FJC C;  3F5T A;  1FFT B;  4LFC B;  1H2S B;  4X65 B;  4LF8 O;  2Q73 A;  2HFE C;  5JCO A;  4CH3 A;  4DV2 O;  1AVM A;  2QM7 A;  5CN0 A;  4MVR A;  1KP2 A;  2DMX A;  1EBO A;  1QVF U;  2PI4 A;  2HVK C;  4LF7 O;  3K9A A;  4DR2 B;  5CA1 B;  2YSU B;  1S5J A;  2YIB A;  3ZRW B;  4XBF A;  4X1K A;  1WAZ A;  3CCU V;  2Q67 A;  1DLB A;  2XAQ A;  1XQ8 A;  4UB8 Z;  1ZWI C;  3ASN B;  2MW2 B;  4YJ2 B;  1KUQ A;  2ZDI A;  4K35 A;  4K0K B;  1AB3 A;  2N74 A;  5CA0 A;  3VQX A;  1I5Y A;  2GDS A;  3OMN B;  2HG5 C;  1J95 A;  3CPW U;  2ZE5 A;  1U96 A;  5L3F A;  3W7T A;  4J80 A;  2ZNI A;  1YTF B;  5LBQ A;  5IT9 N;  2JEX A;  4O4I B;  3E35 A;  1GM7 A;  3W7U A;  4GZR B;  1WB8 A;  4ZBM A;  1S5L Z;  4LBE C;  1A32 A;  5EBL C;  4X62 O;  2Z5U A;  4L87 A;  4ZHQ A;  3H1J H;  4ZI7 A;  5KX5 A;  1HR0 B;  2CGN A;  2UU9 O;  2WLN A;  5BY1 A;  1EM1 A;  3F5W C;  1NH2 D;  1WN7 A;  4CBC A;  1N33 O;  3O65 A;  1M9N A;  2ZXW B;  2EIN B;  2GV9 A;  5CA0 B;  4TUY A;  4AQY O;  5HFL A;  4YY3 O;  3MHS C;  1YSC A;  4YXW G;  2ZM6 O;  3AG1 C;  4DR6 B;  4JI7 O;  2A06 H;  3HB3 B;  3IGA C;  1OJH A;  4LF6 O;  1YXB A;  3JD1 A;  2KB1 A;  3I55 V;  1YIJ V;  2LQT A;  3CRM A;  3LNN A;  3JAS A;  4TSF G;  4BR6 A;  3FYI B;  5LMN O;  1XDC A;  1P4R A;  3ZMZ A;  1L8D A;  3CHX A;  3L71 H;  1M93 A;  3RW0 A;  3F7Y C;  4ZHQ B;  4ZI7 B;  4FK5 C; 
#chains in the Genus database with same CATH homology
 1IDS A;  1N0J A;  1JA8 A;  1P7G A;  2CE4 A;  1ZTE A;  3AK2 A;  1XUQ A;  1IX9 A;  2P4K A;  1SZX A;  1Y67 A;  1BSM A;  4GUN A;  2GDS A;  1GN6 A;  1QNM A;  4FFK A;  1PL4 A;  4YIO A;  4E4E A;  1GN2 A;  1MSD A;  2QKC A;  3QVN A;  3KKY A;  2QKA A;  1IXB A;  2ADP A;  3KDR A;  4YIP A;  1MNG A;  1WB8 A;  3RN4 A;  3CEI A;  1AR5 A;  4JZ2 A;  1WB7 A;  3AK1 A;  3AK3 A;  1BS3 A;  1XIL A;  1AP5 A;  1EN6 A;  1AR4 A;  1N0N A;  1KKC A;  1VEW A;  4X9Q A;  1EN4 A;  3IC9 A;  1EM1 A;  3TJT A;  1VAR A;  1AP6 A;  2RCV A;  1ZUQ A;  3MDS A;  1JR9 A;  3K9S A;  5A9G A;  3C3S A;  1D5N A;  1ZLZ A;  1XRE A;  1I0H A;  3BFR A;  3EVK A;  4C7U A;  1B06 A;  4JYY A;  1LUV A;  5AG2 A;  1GN4 A;  2ADQ B;  3LSU A;  1AVM A;  1BT8 A;  1ZSP A;  1GN3 A;  1MA1 A;  3DC6 A;  1PM9 A;  3OT7 A;  3C3T A;  4BR6 A;  2AW9 A;  4F6E A;  4JZG A;  1XDC A;  3DC5 A;  1EN5 A;  1I08 A;  1MMM A;  1LUW A;  2CDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...