1ZLZA

Re-evaluation of the low-temperature azide in mn-dependent superoxide dismutase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
publication title Azide Adduct of the Y174F mutant of Manganese superoxide dismutase from Escherichia coli
rcsb
source organism Escherichia coli
total genus 74
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1zlzA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1zlzA02
1N0JA 1LUVA 1Y67A 1EM1A 3AK3A 1GN3A 1MSDA 2QKAA 1IXBA 1GN6A 3AK1A 1IDSA 2CDYA 1PM9A 3LSUA 3C3SA 2GDSA 1ZTEA 1VEWA 1B06A 1EN6A 4E4EA 3RN4A 4GUNA 1ZUQA 1N0NA 4JZ2A 1MA1A 1LUWA 5A9GA 1XUQA 1MNGA 2ADPA 1ZSPA 1I0HA 4X9QA 1WB7A 3C3TA 3AK2A 3K9SA 2AW9A 4FFKA 3TJTA 1D5NA 1XDCA 1JA8A 3QVNA 4F6EA 1I08A 3DC5A 4C7UA 1PL4A 3IC9A 1GN4A 1ZLZA 1AP5A 3CEIA 3BFRA 1BS3A 1KKCA 1AVMA 3MDSA 2ADQB 1BSMA 1IX9A 1EN4A 1AR4A 1XILA 1P7GA 5AG2A 2QKCA 1MMMA 1AP6A 1VARA 4YIPA 3OT7A 1AR5A 4BR6A 3KKYA 3DC6A 1EN5A 1SZXA 1QNMA 3EVKA 1GN2A 1BT8A 4JZGA 4YIOA 1XREA 2RCVA 1WB8A 4JYYA 2P4KA 2CE4A 1JR9A
chains in the Genus database with same CATH superfamily
1Y67A 2EZOA 2WAMA 2BTOA 3RYHB 4YHHB 4LFCO 2NN4A 4ZKIA 1ENVA 3W7SA 1VQ6V 2F4VO 3H1KH 1IXBA 4RO2A 4H33A 3JASA 2GDSA 2VQEB 1IBMO 1SQFA 1VEWA 4NYKA 2M7WA 4O2BA 5A2QN 3JARB 2YIBA 1ROPA 1JPXA 1D5AA 5DN6G 2FL4A 4ZIBA 4I9QA 4LWSA 4WFHA 3OM3B 3E22B 1HNZO 3ZN1A 4HNAB 2K9PA 4F4LA 5CA1A 1WB7A 1OCRB 4KL1A 1NU1H 5BMVA 3H1LH 3K9SA 1YJWV 4TV9A 1QLNA 5B1AB 1VQLV 3RYFA 5KLVH 1P4RA 2QJ1A 4F6EA 4JI7O 1SA0A 4TT3G 1Y74B 3K0DA 3BPZA 1FOUA 3X2QB 4BW5A 4J41A 2W6IG 3UO3A 2EIKB 4PDMA 3CCUV 1AVMA 4ABMA 5BY1A 2IM9A 2ZQMA 1IX9A 1FXHA 2GBOA 3CXHF 1XILA 5JWPA 3CCSV 3D36C 2E3CA 4WF9V 4WBNA 2A3QA 3LNNA 2F23A 2L35A 3K08A 4JYAB 1ZL8B 1I7FA 3B8NA 3ZS8C 2AHZA 1BHBA 3ABTA 1PKXA 1BGYH 2CGOA 2DE0X 3J7AU 1QR9A 2DQ0A 3ZMUA 2D2CB 2B1IA 1K3EA 5L3DA 4F6RA 2QA4V 1K34A 5FPRA 2Q4PA 4FJCC 2ZE5A 1I94B 3ZIAG 3SDLA 5D5QA 3QNEA 5D5PA 1GRJA 2R9RB 3BRCA 5C8YB 1Z5WA 4UFZA 1R6TA 4FZ0A 2CUGA 4LF9O 4DO2A 3H1HH 4GUNA 5IWAO 5LA6B 2F43G 2JEUA 2Z0AA 1KD1W 3VQYA 2WLNA 1WNSA 4HBNA 1XUQA 3ZRWB 1G1XB 3WFVA 2P22C 3KG2A 4LNUA 4DV0B 1ORQC 1DTOA 3ETDA 4I7ZB 1NQTA 1QU7A 1YCIA 3WB1A 4NTYA 3TXSA 4JTAB 2A06H 3CCQV 1XEQA 2JS5A 4QPKA 2XAJA 4DW0A 5KHHA 3ZX6A 4JPRA 2OTJV 3JD0A 1O9GA 4PD4F 3DC5A 4K35A 4TV8A 3A2FA 4DR1B 1VQPV 3B2EE 5DECA 4MSWC 4PDRA 3HKCB 4QJFB 4JI6O 1LNQA 5CBHA 3ICXA 4UB8Z 4N23A 1SRYA 1QR8A 5H6QA 1SF9A 3D36A 1K9MW 5JH7B 1Q81W 4X62B 4BR6A 3KKYA 3OTOB 1Z5VA 1PNKA 2ZM6B 1GH6A 2BSKA 4DV2B 3O9OA 4GZRB 5L3GA 4YY3O 1M57B 3CJHB 2Q67A 3OEEG 1U97A 1JA8A 4JI8O 1L8DA 4P9OA 3IFXA 2AZ0A 3K58A 1SESA 4JI0B 3JD2A 3P3PA 2UXBO 2CTWA 2F66C 4JI3B 3CXCU 4NXNB 3SPJA 1G6UA 4PELA 4LF6B 2W6JG 4B3MO 3C3SA 4PJ0Z 4DR7O 3KZIZ 1Q6HA 4LF8O 1R3JC 4U3JA 2PY5A 5IYCO 3SYOA 1XMQB 3K5OA 2E5LB 3MD0A 2MW2B 3N2GB 1XL4A 3LDCA 2ZIOA 5LP6B 2HEPA 3K5NA 4H44B 1A32A 2YXHA 4DR4O 3CRAA 1JFFB 4P30A 1ZAUA 3QVNA 3BABA 3FX7A 1I08A 2DYRC 2DWEC 3UCSC 4N21A 2R9AA 5JJEB 1ZLZA 3RT3C 3AEIA 1Q8IA 2YSUB 5IYZA 1KKCA 3CP1A 4DRXA 4JI1O 4LFBO 1FXKC 3BEHA 4D6TH 1N32B 2DJVA 3JASB 3OUSA 5AG2A 5KHGA 2LO1A 5IT9N 4O2BB 4DK0A 3JAMN 1J5EO 3CMEV 1VIBA 1SZXA 4QNHB 2ILMA 2X6AA 3K3WA 5JCOC 1E1RG 3OAAG 2OIEA 4ZOLB 3FKSG 3RYCB 4W4LA 2OCCB 5CA1B 3R66A 4CH4A 2PI5A 3RYFB 5EC2C 2Q0AA 3VQVA 4O4JB 3K57A 2PZSA 5H6RA 4CH3A 2XAGA 4NKGB 1QHTA 1ZTEA 4ZI7B 4WFFA 3D8CA 1AJPA 1WAZA 2DOSA 4EB6B 1WPBA 2Y0PA 4AQYB 2IJHA 2GTAA 1N34B 3P32A 2BOBC 3J80N 1SC5B 1M5IA 3E8BA 4DUZO 2UUCB 4WBNB 1TAEA 4LC1A 3LSSA 5KAFZ 5EIBC 1N36O 2LGWA 4G2KA 1KYOF 5GTHZ 1M56B 4DV6O 4PA7A 5B3SB 5LMNO 3T1YO 3E8FA 5EBLC 2JS3A 2EX3A 4G27B 3K5LA 3DXRB 2UUAB 2R72A 3G6BA 3JD1A 2WA3A 4F6RB 5IE9A 2Q69A 3T2MA 3ZHRA 4YJ2A 1JVMA 4X64O 1R6NA 1FXKA 2LP7A 1JMKC 3CRRA 1XQ8A 3E8GA 4LF7O 4LFAB 5JVDA 3NXSA 4DV3B 3GVMA 4K3AA 3OMIB 2AGAA 4FLVA 3HR0A 4U7NA 4FLUA 3E8HA 4YXWG 3T1HB 4GT1A 1Q86W 2WLHA 1X4TA 3ABMC 4O2AB 1MZEA 1Y4MA 4Q20A 5IJ0B 4DR2O 2ZD9A 3L74H 1TUEB 1H2SB 2E76B 1NI8A 4KHPO 1S5HC 3AK3A 1YITV 3F5TA 4FZ1A 3F7VC 3ZN0A 4B3SB 1K73W 4IYIA 1OCZB 5GTIZ 1F51A 4UVBA 3SYAA 2QWPB 2EINC 2Q6AA 3TCUA 1NT2B 2ZCEA 5CB4B 3U10A 1J95A 4QE9A 2CH7A 3SYPA 2JJ2G 4I0XA 1MG1A 2OWOA 2E75B 5A9GA 2KG7A 5KHKA 1KP3A 3N2KA 5J2UA 2VQFB 3ZRSA 2CAZC 1L0NH 2BSKB 4UV8A 3CRQA 3CRMA 3L9DA 1D5NA 3LDDA 1HNWO 4DV4O 5EZYA 1HNXO 2GV9A 1L1FA 4X1IA 1MZFA 4IYHA 3AG4B 2ARHA 5LOVB 3D3QA 3HPLC 1R73A 3E35A 1VQ8V 4JI2B 1BL8A 2Y0IA 4CS2A 2HFEC 4X65B 5BR8B 1PPJH 2DYSB 3CCMV 3RYIB 4X20A 4JTDB 3AG1C 3ABKB 3OUFA 3CMAV 4DV7O 3UKMA 1VQMV 4WCEV 2OCCC 1KUQA 1N8RW 1NJIW 1UFIA 3RGBA 4FM1A 2YICA 2EJRA 3JYCA 3WB0A 3HKEB 4U3JB 4LFCB 3DC6A 1F7YA 1VF6C 1V9PA 1PNLA 1AROP 1QNMA 1R6KA 4RUEA 3Q4HA 2F4VB 2IJJA 1T5EA 4GYCB 4EFEA 1QBZA 3K79A 2QTSA 2Q9LA 1YDXA 2X6BA 1O9HA 2JJ1G 1Q43A 5CA0A 5J9PC 5CBGA 4LF4O 1H2MA 1S5JA 4OPAA 4DV1B 4DK1A 1MSDA 1HNZB 3FD9A 1OJHA 1R3LC 1S0VA 3EHBB 1WA8B 3ETEA 1AI4A 1TUBB 3IC7A 2A0LA 4O4HA 5IYZB 3OFNG 4I50B 4NTXA 1NR1A 3LNMB 5DM6V 3SGIA 2DWDC 4JI7B 1OCCC 4DV5O 1ZUQA 4TQFA 1XHZA 2XTAA 1FPOA 3P30A 4FLZA 1YEWA 2VS0A 1NVPB 1SERA 4X9QA 1F23A 1VP7A 2WLIA 2IJIA 1BE3H 1GM8A 1HDJA 2WLMA 4C7UA 2H94A 1SQBH 1P7BA 1V55B 2FB5A 2NNUA 2QKSA 5JJJB 4DR5B 1XNQB 4B08A 1TGOA 1W0KG 2EILC 2ZE8A 2ODMA 2Q8VA 2ADQB 5IY5C 4PV1B 3H9VA 4LH7A 2GSMB 4MS2A 1PNMA 2IU0A 1SQXH 1DF5A 5KHIA 3CB2A 4XDLA 1VARA 1OCZC 5ITZB 5LGNA 2O57A 5L3FA 1M93A 2IW5A 1VF6A 2N04A 2AZ2A 3SPCA 5CBFA 4X8AA 2QDOA 4FLYA 1BT8A 1YVWA 1XREA 1IZ3A 1SZTA 3CCLV 4PI0A 3G67A 5IWAB 4RQEA 2HVJC 1FFXB 4UCOA 4PA3A 3ASOB 4K0KO 2ITCC 5H5NA 3A8TA 2DYRB 2P5OA 4BIUA 5KMGA 3BY6A 2JGDA 3OE7G 3B77A 4J9YB 3AG7A 3FAVA 1VQNV 1JNBA 1URFA 3AG4C 1S76D 1FXKB 1AJNA 1IBLO 3RN4A 4JZ2A 1AJQA 3HKDA 5JVDB 1LUWA 2DYSC 4EEQA 2WPDG 3TETA 1MABG 3ABKC 2ADPA 2DW4A 1KB9F 4Q6GA 4FFBA 4JI6B 5FNVA 2Q68A 4UCVA 4KP4A 1P49A 1S77D 1XOUA 3A0HZ 4R50A 5CMUA 1NTKH 2LFRA 1DF4A 1NTMH 2AHYA 2ZR3A 5GONB 2YXLA 1KKDA 3UT5A 2UU9B 1AP5A 5LL6Y 1KMIZ 3ZCCA 4YY3B 2IBZH 3ABUA 4B3TO 4MW8A 3JAKA 2G38A 4MVUA 5K1PA 1OCOC 2QWNB 1SQGA 4UUJC 4CS4A 3L75H 4PI2A 4IHJB 4JI8B 4UVCA 2LW1A 2QKCA 2QWOB 2A9HA 2UXCO 3STZC 2OYQA 2JIZG 2UXBB 1JJ2U 4HZ3A 1RPRA 4JYAO 1VQ7V 4HAMA 1OV9A 2KG7B 3D3IA 4JYCA 3CD6V 2EBOA 3VQWA 4DR7B 3N2KB 2WSSG 5J2UB 4LF8B 2YIBD 3SPGA 5EZYB 2XAFA 3JATA 5KUMA 1XMOO 3K06A 1KECA 2JRIA 1Y76A 2R70A 4NTWA 1YHQV 2V7QG 2QM7A 3BCCH 4DR4B 1PM9A 3HB3B 2RQ6A 5J2TB 4H0LB 4X20B 1Q7YW 1M4UA 2ZDIC 4L8JA 1QLEC 2UXDO 1R3KC 5KAIZ 1Q3EA 5KX5A 1JQ0A 1V55C 4GX2A 5LMUO 2ZIMA 3JALA 3I55V 4JI1B 3RBZA 3Q4HB 4LFBB 1PP9H 1Z2GA 3ML0A 4GKKB 2N05A 3ABMB 2QEXV 5B5EZ 2YDEA 2RDCA 1J5EB 4X89A 4O4IA 2Q5ZA 2OT5A 2MK3A 1VF7A 4DR6O 1Q5OA 1DLBA 5B66Z 4P9PA 3QO5A 3K9AA 2EINB 3A0BZ 4MVRA 4B3RB 4NR1A 3CC7V 2A79B 1AR4A 1P7GA 2P90A 3ASOC 2ZKOA 1FJGO 3QTCA 3CHXA 3N27A 3CC2V 3T4DA 5DEDA 2XAQA 4LF5O 2ZE7A 3DSQA 1DGSA 4X66O 3AG2B 2UUBO 3VQXA 4R8CA 2P4KA 2CE4A 3OR6C 5K1XA 2WLIB 3FYIB 2LJ2A 3TXQA 3K59A 3ZJZA 3B8MA 3G6EV 5JQGA 3U0ZA 1BCCH 4DR3B 3P3NA 2QKAA 2F95B 4FLTA 3VOUA 4LWSB 1GN6A 1N36B 1JX9A 2V4DA 3CCRV 1F4NA 3AG1B 4DV6B 4JV5O 2ZDIA 3S3WA 5LMNB 1VQKV 1W0JG 3T1YB 5BMVB 3ZMSA 4TV9B 1XMQO 2E5LO 5CA3A 4ICGA 1GK9A 1JOYA 5LYJA 5F2VO 1I5YA 1SA0B 1I0HA 3GWKC 4FMTA 3QO8A 4X64B 3JD4A 4WFEA 2FMLA 3QG5A 3SPHA 4AHCA 4FLWA 1RM1C 4LF7B 5LHGA 2WLLA 4EKWA 4CH5A 3ASNB 2Q73A 3E22A 3ABLB 4HNAA 2WWWA 3E89A 3ZHTA 4MVZA 3S3XA 2ZNIA 1YXBA 1WLEA 2JGUA 4JI5B 3BAAA 1MOFA 1GAXA 4CH6A 2X7RB 2DN9A 3A0RA 2JGDB 1RSOA 2KKWA 5E79Z 3KCYA 4KXRA 3SYQA 4CS3A 2ATKC 4MVMA 4YIPA 1PV0A 1HR0B 1OCCB 2JVDA 3HKDB 2XT9A 2BCCH 4RUFA 1NH2D 3K03A 4OXSA 3RVZA 2YIDA 4FFBB 1OZ0A 4FIPC 1K4CC 1NZ6A 1COWG 1M9NA 3TGUH 1YJNV 5HFLA 5EK0A 1QVGU 4DUYO 3ZHUA 1FD9A 3U11A 4OGQB 2BOCC 1Q90D 1VQ4V 3APOA 2YUAA 3UO2A 4WFAV 4UCTA 1TVKA 3ZEDA 1GTOA 1M90W 1HW7A 3DGEA 1WP7A 4PA6A 3H1JH 1K4DC 3HKBA 1NR7A 1EN6A 4LNUB 1OHHG 2EILB 3JAKB 4DV4B 2FTKA 1XNRO 1GM7A 2RMKB 1W59A 5IY5B 5LGTA 3B4SA 4G28B 2ZE6A 1N34O 4I9WA 2LFSA 4I5SA 1PD3A 1ZWIC 5GW7A 4J80A 1B6QA 2Y4UA 3L70H 4LR3A 4DV7B 2AXTZ 4TV8B 4PDLA 1YZBA 4FVMA 1VQ5V 2F1MA 2B9ZA 2XNDG 5LA6A 3W7TA 2YEVA 5BXZA 2HR3A 2B5UA 3OGIB 1FXVA 3DTUB 2CTQA 2ZXWC 3AG3B 1NVPD 1V54C 4LCUC 4RQFA 1GN4A 2JK5C 1PL0A 2GUZA 3H01A 2HLDG 3BA9A 3AG2C 3JATB 1CP9A 1Y76B 2P7TC 3I5DA 4B7KA 4PDVA 2P06A 2EIJB 2PGGA 4JAVA 3RFRA 4LF4B 4I55A 3W7UA 1Q82W 4A5UB 4IIJA 3BHPA 2IH1C 1S5LZ 5KX5B 1GM9A 3T1HO 1IURA 1GKFA 4JAUA 2Q7EA 3WU2Z 2C2AA 4JYYA 1TA8A 4DV5B 1Q6IA 1LUVA 4UVAA 1NH2B 4GKJO 2DQ3A 2Y48A 2ZINA 3EFFK 4H37A 4ASUG 4O4IB 4MVQA 2E74B 4D7SA 2CDYA 3SJBC 3LSUA 4J7JA 1IBMB 3OW2U 3ASNC 1YTFD 4MTOA 1OCOB 3ABLC 3MAQA 4P2ZA 2Q7GA 1SKVA 4MT8A 4XDKA 4DW1A 1VF5B 1MA1A 4TQDA 4FPPA 2PYJA 2V1DA 2FYUH 4FLXA 4OX9O 4JAAA 4IL6Z 1NBMG 4R7CA 4JI4O 4DRXB 2GHYA 3N2GA 3RW0A 2VWJA 3PN1A 2HHHO 1KU9A 5LP6A 1KP2A 3E86A 3STLC 3W7XA 1H8HG 3WB2A 2LQTA 2B1GA 2HJFC 3ZHVA 1QVFU 2F93B 3MDSA 3SYCA 2YXYA 3C90A 3ZBHA 4MVSA 4KUMA 4K8ZA 4YJ3A 4K0KB 1QLEB 3WG7B 1AR5A 4GX0A 5C93A 3TK1A 1N33O 1KC8W 3H1IH 1Q6UA 1K33A 1GN2A 3CCEV 4NXMO 5LYJB 2WA4A 2R9IA 2RCVA 2W0FC 1SQVH 1L0LH 1AI6A 4QE7A 5FL7G 4X88A 1SS3A 1IBLB 1JR9A 5TISZ 3SJAC 1US6A 1YJ9V 2WLLB 2RNBA 3M8AA 4BIOA 4DV1O 1E1QG 2IJKA 4ZOLA 2OTLV 3RYCA 2ZT9B 5EIBD 2RN9A 3SJCC 4UCRA 3CCVV 1IDSA 1SETA 5HFMA 2X6CA 3PJSK 1VMGA 1LR1A 1ZX3A 3B09A 3AG3C 3OTFA 4RWUA 4LF9B 4NB5A 4O4JA 1RSOB 3ETQA 1IBKO 4X1YA 3G71V 4JF3A 1IVSA 1WPXA 1BQ0A 3L72H 1FS0G 3JAWA 4YHHO 1YTFB 3JCUZ 4ZI7A 1ZSPA 3L73H 3CC4V 4B3TB 2EIJC 2LW7A 3QO7A 3OGCC 4EB6A 3APQA 3MHSC 1QCEA 5L3CA 1IJGA 1YI2V 3AK2A 3FB5C 1AI5A 3RVYA 4DYLA 2VQEO 4YJ2B 5LGUA 3ZHQA 4PA9A 2UXCB 3L71H 2EULA 2EIMB 2BTQA 3K04A 1PL4A 4J42A 4PA4A 4DR5O 1XNQO 2QWQB 2HVKC 1THZA 4FK5C 1TVKB 4MW3A 5LXTA 2XOKG 5IJ9A 3ZMTA 3DXRA 3HKBB 3UM7A 2A7WA 4LH6A 2QWRB 3OT7A 3CWBH 3CX5F 3LSQA 4UB6Z 1XMOB 1B04A 2ZNJA 4E2LA 2XHBA 2D3OW 3KDRA 2IH3C 2PUSA 5E1AC 1XI1A 2UXDB 4B7EA 1WB8A 4MTFA 1CXZB 5IYBO 1N0JA 2YEVB 1RM1B 1EM1A 5JJNB 5LHHA 4IGGA 1BZKA 5LMUB 4WFGA 1I5XA 2CH7B 1EZVH 3CSXA 3G80A 4I0XB 4O2AA 1MSWD 1EZJA 4CBCA 4J7ZA 2GUZB 4B3MB 5IJ0A 4GLXA 4XBFA 1UPGA 1H38A 1DK1A 3W7WA 3OMAB 4J9ZB 1S3JA 3IGAC 5LHIA 2QSAA 1N0NA 2UXXA 4MVOA 1R1BA 3R65A 4X1IB 3ZHSA 4FM2A 2DMXA 4I55B 2QM4A 4DR6B 2YI9A 2CK3G 2P6JA 1I94O 5CB4A 2QGNA 3B40A 4IIJB 2Y69C 2YC0A 4AI8A 2AW9A 4FFKA 3K5MA 3RWRD 2Z3YA 3WG7C 1FJGB 2EJ7A 3IC9A 4NVPA 2UU9O 4LF5B 1FFTB 4O4LA 2K1EA 3CEIA 4X1KA 3BFRA 1SQQH 4X66B 1H5WA 2QE7G 4DV0O 1BHAA 2UUBB 2YIAA 2P4VA 5EYPA 5LOVA 1AR1B 4UXNA 1KQSU 1U96A 4Z1VA 1IXMA 3SJQC 3OMNB 2WLKA 1AP6A 3F7YC 1Y66A 3CE2A 3J81N 3RYIA 4RAIA 5CA0B 4DR1O 4K8XA 1H2GA 1OCRC 2QR4A 3EVKA 1RP3B 2XASA 5L3BA 4ZHQA 2RJZA 1H2NA 4I4TA 5B1AC 4JV5B 1HWYA 1H2KA 2KQXA 2P67A 3HKEA 5LBQA 3CCJV 4O4HB 4MTXA 4QGPA 2JDIG 4GCZA 4BWAA 3X2QC 4TOIA 3NR7A 1G4YB 4X62O 3OTOO 2ZXWB 1V54B 2EIKC 2VRZA 2PF4E 4UV9A 2ZM6O 3OEHG 1H2LA 4DV2O 1NKDA 3VBBA 1K5QA 3ZMVA 2Z5UA 1FAFA 1YF2A 2M6YA 1XHXA 1NTZH 4E4EA 2PI4A 4Z1MG 3CPWU 2EIMC 1WA8A 2CGNA 1TUBA 1Y6XA 4JI0O 4DUZB 4YJ3B 3FFQA 1QQCA 5BZBA 4TUYA 3ZRXA 3BA8A 3LUTB 4JI3O 4I50A 4NXNO 3ZMZA 3BVOA 3QF7A 4TSFG 4LF6O 3JCZA 2VWKA 2GTSA 3F5WC 3TJTA 4GKKO 1XDCA 1K7DA 3RYHA 5KUKA 2KB1A 1XBLA 5B1OA 2HJDA 5L3EA 4GX1A 3OD4A 5EBWC 2HP8A 1E79G 2NLJC 1GMGA 4OPHA 5EC1C 1RPOA 4LP8A 4EFBA 1BS3A 4J7KA 2HKOA 1EFRG 5H2FZ 3JARA 4B3RO 1FYJA 2X0LA 5FPOA 1EN4A 1H8EG 5H9CA 4CZZA 1FKAO 1MMMA 4DUYB 1JJOA 2Q7HA 3MHHC 1NS1A 4CC6A 4CC5A 1EN5A 5B1BB 4X1YB 1WP8A 3GB7C 1K97A 3JAWB 3JSLA 1VQ9V 1W2BU 2QM8A 5EBMC 5KMGB 1XNRB 2Q0OC 4JYBA 4BW9A 5ITZA 1N32O 4U3FH 2W0XA 4TWKA 1CPYA 5B1NA 4DR2B 1Y74A 3FAVB 3LDEA 4KHPB 1VQOV 3K0GA 2HG5C 4DR3O 2BTQB 1YSCA 4U7OA 1N4CA 1JCHA 4W4KA 1HP8A 3IAYA 2ITDC 1UJWB 1FFXA 1S72V 1WJZA 3FYEB 5FNVB 2XAHA 2XUMA 3GWOA 3M99B 5KA6A 4JASA 5LXTB 5IJ9B 1ZL8A 3OR7C 4MTGA 1KBHA 1K5SA 1GO3F 3O65A 1M57C 2CTRA 1F4MA 3KCXA 3THOA 3SPIA 1XL6A 3C3TA 3UT5B 2BE3A 4JTCB 1M1KW 4QIWF 2OIGA 4UCSA 1HNWB 1HNXB 3IJ4A 2YI8A 4AQYO 3EXAA 2ETNA 1YIJV 1X59A 1AILA 5JCOA 2UUCO 4JI5O 5C8YA 4IT5A 2Y4TA 1P84F 2L6LA 3ZRVA 1WN7A 4KFMA 4WFBV 2ZR2A 5GONA 4LBEC 4QPJA 4AILC 1SQPH 4GKJB 3ZRWA 3ETGA 5LP6C 1HR0O 1R3IC 3G4SV 3CRCA 2UUAO 3I56V 2N74A 4PHZA 4J11A 4IHJA 1BQZA 1AI7A 2JEXA 4FM0A 2H3OA 2LGQA 3M7MX 4Z2WA 2NR5A 4ZBMA 4LFAO 4UCUA 4DV3O 3E2EA 3HKCA 1GN3A 2CTPA 2PTMA 4OX9B 4HYOA 3JD3A 5KHJA 3AK1A 1B3QA 4O4LB 4X1KB 3JALB 1B06A 4JI4B 3JSNA 1AB3A 5JH7A 3FB6C 4DXWA 5EYPB 2HHHB 2FKXA 1K8AW 3CS5A 3E83A 5IYDO 4B3SO 1MNGA 1BMFG 4R6ZA 5J2TA 4J10A 3CYOA 2OCHA 4GX5A 4BIZA 5FLXN 3SR2C 3CJHA 3FB7C 4ZHQB 4I4TB 2EZPA 5IDJA 5B1BC 4BAYA 1N33B 2KSDA 2PYLA 3FB8C 4NXMB 2WLJA 2VQFO 2UXNA 1CEZA 1G8MA 4XDJA 1BSMA 3T1CA 1RFYA 2IU3A 4JGSA 2YS8A 4JI2O 4D7TA 1K92A 4X65O 5BR8O 1M56C 4L87A 1JFFA 4TUYB 5JQGB 3UQ8A 1D2DA 3T4ZA 4H13B 4JZGA 4YIOA 5B3SC 2H8PC 2QTOA 2Y69B 5CN0A 1EBOA 5KA5A 1IBKB
chains in the Genus database with same CATH topology
1N0JA 1LUVA 1Y67A 1EM1A 3AK3A 1GN3A 1MSDA 2QKAA 1IXBA 1GN6A 3AK1A 1IDSA 2CDYA 1PM9A 3LSUA 3C3SA 2GDSA 1ZTEA 1VEWA 1B06A 1EN6A 4E4EA 3RN4A 4GUNA 1ZUQA 1N0NA 4JZ2A 1MA1A 1LUWA 5A9GA 1XUQA 1MNGA 2ADPA 1ZSPA 1I0HA 4X9QA 1WB7A 3C3TA 3AK2A 3K9SA 2AW9A 4FFKA 3TJTA 1D5NA 1XDCA 1JA8A 3QVNA 4F6EA 1I08A 3DC5A 4C7UA 1PL4A 3IC9A 1GN4A 1ZLZA 1AP5A 3CEIA 3BFRA 1BS3A 1KKCA 1AVMA 3MDSA 2ADQB 1BSMA 1IX9A 1EN4A 1AR4A 1XILA 1P7GA 5AG2A 2QKCA 1MMMA 1AP6A 1VARA 4YIPA 3OT7A 1AR5A 4BR6A 3KKYA 3DC6A 1EN5A 1SZXA 1QNMA 3EVKA 3KDRA 1GN2A 1BT8A 4JZGA 4YIOA 1XREA 2RCVA 1WB8A 4JYYA 2P4KA 2CE4A 1JR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0J A;  1LUV A;  1Y67 A;  1EM1 A;  3AK3 A;  1GN3 A;  1MSD A;  2QKA A;  1IXB A;  1GN6 A;  3AK1 A;  1IDS A;  2CDY A;  1PM9 A;  3LSU A;  3C3S A;  2GDS A;  1ZTE A;  1VEW A;  1B06 A;  1EN6 A;  4E4E A;  3RN4 A;  4GUN A;  1ZUQ A;  1N0N A;  4JZ2 A;  1MA1 A;  1LUW A;  5A9G A;  1XUQ A;  1MNG A;  2ADP A;  1ZSP A;  1I0H A;  4X9Q A;  1WB7 A;  3C3T A;  3AK2 A;  3K9S A;  2AW9 A;  4FFK A;  3TJT A;  1D5N A;  1XDC A;  1JA8 A;  3QVN A;  4F6E A;  1I08 A;  3DC5 A;  4C7U A;  1PL4 A;  3IC9 A;  1GN4 A;  1ZLZ A;  1AP5 A;  3CEI A;  3BFR A;  1BS3 A;  1KKC A;  1AVM A;  3MDS A;  2ADQ B;  1BSM A;  1IX9 A;  1EN4 A;  1AR4 A;  1XIL A;  1P7G A;  5AG2 A;  2QKC A;  1MMM A;  1AP6 A;  1VAR A;  4YIP A;  3OT7 A;  1AR5 A;  4BR6 A;  3KKY A;  3DC6 A;  1EN5 A;  1SZX A;  1QNM A;  3EVK A;  1GN2 A;  1BT8 A;  4JZG A;  4YIO A;  1XRE A;  2RCV A;  1WB8 A;  4JYY A;  2P4K A;  2CE4 A;  1JR9 A; 
#chains in the Genus database with same CATH topology
 1Y67 A;  2EZO A;  2WAM A;  2BTO A;  3RYH B;  4YHH B;  4LFC O;  2NN4 A;  4ZKI A;  1ENV A;  3W7S A;  1VQ6 V;  2F4V O;  3H1K H;  1IXB A;  4RO2 A;  4H33 A;  3JAS A;  2GDS A;  2VQE B;  1IBM O;  1SQF A;  1VEW A;  4NYK A;  2M7W A;  4O2B A;  5A2Q N;  3JAR B;  2YIB A;  1ROP A;  1JPX A;  1D5A A;  5DN6 G;  2FL4 A;  4ZIB A;  4I9Q A;  4LWS A;  4WFH A;  3OM3 B;  3E22 B;  1HNZ O;  3ZN1 A;  4HNA B;  2K9P A;  4F4L A;  5CA1 A;  1WB7 A;  1OCR B;  4KL1 A;  1NU1 H;  5BMV A;  3H1L H;  3K9S A;  1YJW V;  4TV9 A;  1QLN A;  5B1A B;  1VQL V;  3RYF A;  5KLV H;  1P4R A;  2QJ1 A;  4F6E A;  4JI7 O;  1SA0 A;  4TT3 G;  1Y74 B;  3K0D A;  3BPZ A;  1FOU A;  3X2Q B;  4BW5 A;  4J41 A;  2W6I G;  3UO3 A;  2EIK B;  4PDM A;  3CCU V;  1AVM A;  4ABM A;  5BY1 A;  2IM9 A;  2ZQM A;  1IX9 A;  1FXH A;  2GBO A;  3CXH F;  1XIL A;  5JWP A;  3CCS V;  3D36 C;  2E3C A;  4WF9 V;  4WBN A;  2A3Q A;  3LNN A;  2F23 A;  2L35 A;  3K08 A;  4JYA B;  1ZL8 B;  1I7F A;  3B8N A;  3ZS8 C;  2AHZ A;  1BHB A;  3ABT A;  1PKX A;  1BGY H;  2CGO A;  2DE0 X;  3J7A U;  1QR9 A;  2DQ0 A;  3ZMU A;  2D2C B;  2B1I A;  1K3E A;  5L3D A;  4F6R A;  2QA4 V;  1K34 A;  5FPR A;  2Q4P A;  4FJC C;  2ZE5 A;  1I94 B;  3ZIA G;  3SDL A;  5D5Q A;  3QNE A;  5D5P A;  1GRJ A;  2R9R B;  3BRC A;  5C8Y B;  1Z5W A;  4UFZ A;  1R6T A;  4FZ0 A;  2CUG A;  4LF9 O;  4DO2 A;  3H1H H;  4GUN A;  5IWA O;  5LA6 B;  2F43 G;  2JEU A;  2Z0A A;  1KD1 W;  3VQY A;  2WLN A;  1WNS A;  4HBN A;  1XUQ A;  3ZRW B;  1G1X B;  3WFV A;  2P22 C;  3KG2 A;  4LNU A;  4DV0 B;  1ORQ C;  1DTO A;  3ETD A;  4I7Z B;  1NQT A;  1QU7 A;  1YCI A;  3WB1 A;  4NTY A;  3TXS A;  4JTA B;  2A06 H;  3CCQ V;  1XEQ A;  2JS5 A;  4QPK A;  2XAJ A;  4DW0 A;  5KHH A;  3ZX6 A;  4JPR A;  2OTJ V;  3JD0 A;  1O9G A;  4PD4 F;  3DC5 A;  4K35 A;  4TV8 A;  3A2F A;  4DR1 B;  1VQP V;  3B2E E;  5DEC A;  4MSW C;  4PDR A;  3HKC B;  4QJF B;  4JI6 O;  1LNQ A;  5CBH A;  3ICX A;  4UB8 Z;  4N23 A;  1SRY A;  1QR8 A;  5H6Q A;  1SF9 A;  3D36 A;  1K9M W;  5JH7 B;  1Q81 W;  4X62 B;  4BR6 A;  3KKY A;  3OTO B;  1Z5V A;  1PNK A;  2ZM6 B;  1GH6 A;  2BSK A;  4DV2 B;  3O9O A;  4GZR B;  5L3G A;  4YY3 O;  1M57 B;  3CJH B;  2Q67 A;  3OEE G;  1U97 A;  1JA8 A;  4JI8 O;  1L8D A;  4P9O A;  3IFX A;  2AZ0 A;  3K58 A;  1SES A;  4JI0 B;  3JD2 A;  3P3P A;  2UXB O;  2CTW A;  2F66 C;  4JI3 B;  3CXC U;  4NXN B;  3SPJ A;  1G6U A;  4PEL A;  4LF6 B;  2W6J G;  4B3M O;  3C3S A;  4PJ0 Z;  4DR7 O;  3KZI Z;  1Q6H A;  4LF8 O;  1R3J C;  4U3J A;  2PY5 A;  5IYC O;  3SYO A;  1XMQ B;  3K5O A;  2E5L B;  3MD0 A;  2MW2 B;  3N2G B;  1XL4 A;  3LDC A;  2ZIO A;  5LP6 B;  2HEP A;  3K5N A;  4H44 B;  1A32 A;  2YXH A;  4DR4 O;  3CRA A;  1JFF B;  4P30 A;  1ZAU A;  3QVN A;  3BAB A;  3FX7 A;  1I08 A;  2DYR C;  2DWE C;  3UCS C;  4N21 A;  2R9A A;  5JJE B;  1ZLZ A;  3RT3 C;  3AEI A;  1Q8I A;  2YSU B;  5IYZ A;  1KKC A;  3CP1 A;  4DRX A;  4JI1 O;  4LFB O;  1FXK C;  3BEH A;  4D6T H;  1N32 B;  2DJV A;  3JAS B;  3OUS A;  5AG2 A;  5KHG A;  2LO1 A;  5IT9 N;  4O2B B;  4DK0 A;  3JAM N;  1J5E O;  3CME V;  1VIB A;  1SZX A;  4QNH B;  2ILM A;  2X6A A;  3K3W A;  5JCO C;  1E1R G;  3OAA G;  2OIE A;  4ZOL B;  3FKS G;  3RYC B;  4W4L A;  2OCC B;  5CA1 B;  3R66 A;  4CH4 A;  2PI5 A;  3RYF B;  5EC2 C;  2Q0A A;  3VQV A;  4O4J B;  3K57 A;  2PZS A;  5H6R A;  4CH3 A;  2XAG A;  4NKG B;  1QHT A;  1ZTE A;  4ZI7 B;  4WFF A;  3D8C A;  1AJP A;  1WAZ A;  2DOS A;  4EB6 B;  1WPB A;  2Y0P A;  4AQY B;  2IJH A;  2GTA A;  1N34 B;  3P32 A;  2BOB C;  3J80 N;  1SC5 B;  1M5I A;  3E8B A;  4DUZ O;  2UUC B;  4WBN B;  1TAE A;  4LC1 A;  3LSS A;  5KAF Z;  5EIB C;  1N36 O;  2LGW A;  4G2K A;  1KYO F;  5GTH Z;  1M56 B;  4DV6 O;  4PA7 A;  5B3S B;  5LMN O;  3T1Y O;  3E8F A;  5EBL C;  2JS3 A;  2EX3 A;  4G27 B;  3K5L A;  3DXR B;  2UUA B;  2R72 A;  3G6B A;  3JD1 A;  2WA3 A;  4F6R B;  5IE9 A;  2Q69 A;  3T2M A;  3ZHR A;  4YJ2 A;  1JVM A;  4X64 O;  1R6N A;  1FXK A;  2LP7 A;  1JMK C;  3CRR A;  1XQ8 A;  3E8G A;  4LF7 O;  4LFA B;  5JVD A;  3NXS A;  4DV3 B;  3GVM A;  4K3A A;  3OMI B;  2AGA A;  4FLV A;  3HR0 A;  4U7N A;  4FLU A;  3E8H A;  4YXW G;  3T1H B;  4GT1 A;  1Q86 W;  2WLH A;  1X4T A;  3ABM C;  4O2A B;  1MZE A;  1Y4M A;  4Q20 A;  5IJ0 B;  4DR2 O;  2ZD9 A;  3L74 H;  1TUE B;  1H2S B;  2E76 B;  1NI8 A;  4KHP O;  1S5H C;  3AK3 A;  1YIT V;  3F5T A;  4FZ1 A;  3F7V C;  3ZN0 A;  4B3S B;  1K73 W;  4IYI A;  1OCZ B;  5GTI Z;  1F51 A;  4UVB A;  3SYA A;  2QWP B;  2EIN C;  2Q6A A;  3TCU A;  1NT2 B;  2ZCE A;  5CB4 B;  3U10 A;  1J95 A;  4QE9 A;  2CH7 A;  3SYP A;  2JJ2 G;  4I0X A;  1MG1 A;  2OWO A;  2E75 B;  5A9G A;  2KG7 A;  5KHK A;  1KP3 A;  3N2K A;  5J2U A;  2VQF B;  3ZRS A;  2CAZ C;  1L0N H;  2BSK B;  4UV8 A;  3CRQ A;  3CRM A;  3L9D A;  1D5N A;  3LDD A;  1HNW O;  4DV4 O;  5EZY A;  1HNX O;  2GV9 A;  1L1F A;  4X1I A;  1MZF A;  4IYH A;  3AG4 B;  2ARH A;  5LOV B;  3D3Q A;  3HPL C;  1R73 A;  3E35 A;  1VQ8 V;  4JI2 B;  1BL8 A;  2Y0I A;  4CS2 A;  2HFE C;  4X65 B;  5BR8 B;  1PPJ H;  2DYS B;  3CCM V;  3RYI B;  4X20 A;  4JTD B;  3AG1 C;  3ABK B;  3OUF A;  3CMA V;  4DV7 O;  3UKM A;  1VQM V;  4WCE V;  2OCC C;  1KUQ A;  1N8R W;  1NJI W;  1UFI A;  3RGB A;  4FM1 A;  2YIC A;  2EJR A;  3JYC A;  3WB0 A;  3HKE B;  4U3J B;  4LFC B;  3DC6 A;  1F7Y A;  1VF6 C;  1V9P A;  1PNL A;  1ARO P;  1QNM A;  1R6K A;  4RUE A;  3Q4H A;  2F4V B;  2IJJ A;  1T5E A;  4GYC B;  4EFE A;  1QBZ A;  3K79 A;  2QTS A;  2Q9L A;  1YDX A;  2X6B A;  1O9H A;  2JJ1 G;  1Q43 A;  5CA0 A;  5J9P C;  5CBG A;  4LF4 O;  1H2M A;  1S5J A;  4OPA A;  4DV1 B;  4DK1 A;  1MSD A;  1HNZ B;  3FD9 A;  1OJH A;  1R3L C;  1S0V A;  3EHB B;  1WA8 B;  3ETE A;  1AI4 A;  1TUB B;  3IC7 A;  2A0L A;  4O4H A;  5IYZ B;  3OFN G;  4I50 B;  4NTX A;  1NR1 A;  3LNM B;  5DM6 V;  3SGI A;  2DWD C;  4JI7 B;  1OCC C;  4DV5 O;  1ZUQ A;  4TQF A;  1XHZ A;  2XTA A;  1FPO A;  3P30 A;  4FLZ A;  1YEW A;  2VS0 A;  1NVP B;  1SER A;  4X9Q A;  1F23 A;  1VP7 A;  2WLI A;  2IJI A;  1BE3 H;  1GM8 A;  1HDJ A;  2WLM A;  4C7U A;  2H94 A;  1SQB H;  1P7B A;  1V55 B;  2FB5 A;  2NNU A;  2QKS A;  5JJJ B;  4DR5 B;  1XNQ B;  4B08 A;  1TGO A;  1W0K G;  2EIL C;  2ZE8 A;  2ODM A;  2Q8V A;  2ADQ B;  5IY5 C;  4PV1 B;  3H9V A;  4LH7 A;  2GSM B;  4MS2 A;  1PNM A;  2IU0 A;  1SQX H;  1DF5 A;  5KHI A;  3CB2 A;  4XDL A;  1VAR A;  1OCZ C;  5ITZ B;  5LGN A;  2O57 A;  5L3F A;  1M93 A;  2IW5 A;  1VF6 A;  2N04 A;  2AZ2 A;  3SPC A;  5CBF A;  4X8A A;  2QDO A;  4FLY A;  1BT8 A;  1YVW A;  1XRE A;  1IZ3 A;  1SZT A;  3CCL V;  4PI0 A;  3G67 A;  5IWA B;  4RQE A;  2HVJ C;  1FFX B;  4UCO A;  4PA3 A;  3ASO B;  4K0K O;  2ITC C;  5H5N A;  3A8T A;  2DYR B;  2P5O A;  4BIU A;  5KMG A;  3BY6 A;  2JGD A;  3OE7 G;  3B77 A;  4J9Y B;  3AG7 A;  3FAV A;  1VQN V;  1JNB A;  1URF A;  3AG4 C;  1S76 D;  1FXK B;  1AJN A;  1IBL O;  3RN4 A;  4JZ2 A;  1AJQ A;  3HKD A;  5JVD B;  1LUW A;  2DYS C;  4EEQ A;  2WPD G;  3TET A;  1MAB G;  3ABK C;  2ADP A;  2DW4 A;  1KB9 F;  4Q6G A;  4FFB A;  4JI6 B;  5FNV A;  2Q68 A;  4UCV A;  4KP4 A;  1P49 A;  1S77 D;  1XOU A;  3A0H Z;  4R50 A;  5CMU A;  1NTK H;  2LFR A;  1DF4 A;  1NTM H;  2AHY A;  2ZR3 A;  5GON B;  2YXL A;  1KKD A;  3UT5 A;  2UU9 B;  1AP5 A;  5LL6 Y;  1KMI Z;  3ZCC A;  4YY3 B;  2IBZ H;  3ABU A;  4B3T O;  4MW8 A;  3JAK A;  2G38 A;  4MVU A;  5K1P A;  1OCO C;  2QWN B;  1SQG A;  4UUJ C;  4CS4 A;  3L75 H;  4PI2 A;  4IHJ B;  4JI8 B;  4UVC A;  2LW1 A;  2QKC A;  2QWO B;  2A9H A;  2UXC O;  3STZ C;  2OYQ A;  2JIZ G;  2UXB B;  1JJ2 U;  4HZ3 A;  1RPR A;  4JYA O;  1VQ7 V;  4HAM A;  1OV9 A;  2KG7 B;  3D3I A;  4JYC A;  3CD6 V;  2EBO A;  3VQW A;  4DR7 B;  3N2K B;  2WSS G;  5J2U B;  4LF8 B;  2YIB D;  3SPG A;  5EZY B;  2XAF A;  3JAT A;  5KUM A;  1XMO O;  3K06 A;  1KEC A;  2JRI A;  1Y76 A;  2R70 A;  4NTW A;  1YHQ V;  2V7Q G;  2QM7 A;  3BCC H;  4DR4 B;  1PM9 A;  3HB3 B;  2RQ6 A;  5J2T B;  4H0L B;  4X20 B;  1Q7Y W;  1M4U A;  2ZDI C;  4L8J A;  1QLE C;  2UXD O;  1R3K C;  5KAI Z;  1Q3E A;  5KX5 A;  1JQ0 A;  1V55 C;  4GX2 A;  5LMU O;  2ZIM A;  3JAL A;  3I55 V;  4JI1 B;  3RBZ A;  3Q4H B;  4LFB B;  1PP9 H;  1Z2G A;  3ML0 A;  4GKK B;  2N05 A;  3ABM B;  2QEX V;  5B5E Z;  2YDE A;  2RDC A;  1J5E B;  4X89 A;  4O4I A;  2Q5Z A;  2OT5 A;  2MK3 A;  1VF7 A;  4DR6 O;  1Q5O A;  1DLB A;  5B66 Z;  4P9P A;  3QO5 A;  3K9A A;  2EIN B;  3A0B Z;  4MVR A;  4B3R B;  4NR1 A;  3CC7 V;  2A79 B;  1AR4 A;  1P7G A;  2P90 A;  3ASO C;  2ZKO A;  1FJG O;  3QTC A;  3CHX A;  3N27 A;  3CC2 V;  3T4D A;  5DED A;  2XAQ A;  4LF5 O;  2ZE7 A;  3DSQ A;  1DGS A;  4X66 O;  3AG2 B;  2UUB O;  3VQX A;  4R8C A;  2P4K A;  2CE4 A;  3OR6 C;  5K1X A;  2WLI B;  3FYI B;  2LJ2 A;  3TXQ A;  3K59 A;  3ZJZ A;  3B8M A;  3G6E V;  5JQG A;  3U0Z A;  1BCC H;  4DR3 B;  3P3N A;  2QKA A;  2F95 B;  4FLT A;  3VOU A;  4LWS B;  1GN6 A;  1N36 B;  1JX9 A;  2V4D A;  3CCR V;  1F4N A;  3AG1 B;  4DV6 B;  4JV5 O;  2ZDI A;  3S3W A;  5LMN B;  1VQK V;  1W0J G;  3T1Y B;  5BMV B;  3ZMS A;  4TV9 B;  1XMQ O;  2E5L O;  5CA3 A;  4ICG A;  1GK9 A;  1JOY A;  5LYJ A;  5F2V O;  1I5Y A;  1SA0 B;  1I0H A;  3GWK C;  4FMT A;  3QO8 A;  4X64 B;  3JD4 A;  4WFE A;  2FML A;  3QG5 A;  3SPH A;  4AHC A;  4FLW A;  1RM1 C;  4LF7 B;  5LHG A;  2WLL A;  4EKW A;  4CH5 A;  3ASN B;  2Q73 A;  3E22 A;  3ABL B;  4HNA A;  2WWW A;  3E89 A;  3ZHT A;  4MVZ A;  3S3X A;  2ZNI A;  1YXB A;  1WLE A;  2JGU A;  4JI5 B;  3BAA A;  1MOF A;  1GAX A;  4CH6 A;  2X7R B;  2DN9 A;  3A0R A;  2JGD B;  1RSO A;  2KKW A;  5E79 Z;  3KCY A;  4KXR A;  3SYQ A;  4CS3 A;  2ATK C;  4MVM A;  4YIP A;  1PV0 A;  1HR0 B;  1OCC B;  2JVD A;  3HKD B;  2XT9 A;  2BCC H;  4RUF A;  1NH2 D;  3K03 A;  4OXS A;  3RVZ A;  2YID A;  4FFB B;  1OZ0 A;  4FIP C;  1K4C C;  1NZ6 A;  1COW G;  1M9N A;  3TGU H;  1YJN V;  5HFL A;  5EK0 A;  1QVG U;  4DUY O;  3ZHU A;  1FD9 A;  3U11 A;  4OGQ B;  2BOC C;  1Q90 D;  1VQ4 V;  3APO A;  2YUA A;  3UO2 A;  4WFA V;  4UCT A;  1TVK A;  3ZED A;  1GTO A;  1M90 W;  1HW7 A;  3DGE A;  1WP7 A;  4PA6 A;  3H1J H;  1K4D C;  3HKB A;  1NR7 A;  1EN6 A;  4LNU B;  1OHH G;  2EIL B;  3JAK B;  4DV4 B;  2FTK A;  1XNR O;  1GM7 A;  2RMK B;  1W59 A;  5IY5 B;  5LGT A;  3B4S A;  4G28 B;  2ZE6 A;  1N34 O;  4I9W A;  2LFS A;  4I5S A;  1PD3 A;  1ZWI C;  5GW7 A;  4J80 A;  1B6Q A;  2Y4U A;  3L70 H;  4LR3 A;  4DV7 B;  2AXT Z;  4TV8 B;  4PDL A;  1YZB A;  4FVM A;  1VQ5 V;  2F1M A;  2B9Z A;  2XND G;  5LA6 A;  3W7T A;  2YEV A;  5BXZ A;  2HR3 A;  2B5U A;  3OGI B;  1FXV A;  3DTU B;  2CTQ A;  2ZXW C;  3AG3 B;  1NVP D;  1V54 C;  4LCU C;  4RQF A;  1GN4 A;  2JK5 C;  1PL0 A;  2GUZ A;  3H01 A;  2HLD G;  3BA9 A;  3AG2 C;  3JAT B;  1CP9 A;  1Y76 B;  2P7T C;  3I5D A;  4B7K A;  4PDV A;  2P06 A;  2EIJ B;  2PGG A;  4JAV A;  3RFR A;  4LF4 B;  4I55 A;  3W7U A;  1Q82 W;  4A5U B;  4IIJ A;  3BHP A;  2IH1 C;  1S5L Z;  5KX5 B;  1GM9 A;  3T1H O;  1IUR A;  1GKF A;  4JAU A;  2Q7E A;  3WU2 Z;  2C2A A;  4JYY A;  1TA8 A;  4DV5 B;  1Q6I A;  1LUV A;  4UVA A;  1NH2 B;  4GKJ O;  2DQ3 A;  2Y48 A;  2ZIN A;  3EFF K;  4H37 A;  4ASU G;  4O4I B;  4MVQ A;  2E74 B;  4D7S A;  2CDY A;  3SJB C;  3LSU A;  4J7J A;  1IBM B;  3OW2 U;  3ASN C;  1YTF D;  4MTO A;  1OCO B;  3ABL C;  3MAQ A;  4P2Z A;  2Q7G A;  1SKV A;  4MT8 A;  4XDK A;  4DW1 A;  1VF5 B;  1MA1 A;  4TQD A;  4FPP A;  2PYJ A;  2V1D A;  2FYU H;  4FLX A;  4OX9 O;  4JAA A;  4IL6 Z;  1NBM G;  4R7C A;  4JI4 O;  4DRX B;  2GHY A;  3N2G A;  3RW0 A;  2VWJ A;  3PN1 A;  2HHH O;  1KU9 A;  5LP6 A;  1KP2 A;  3E86 A;  3STL C;  3W7X A;  1H8H G;  3WB2 A;  2LQT A;  2B1G A;  2HJF C;  3ZHV A;  1QVF U;  2F93 B;  3MDS A;  3SYC A;  2YXY A;  3C90 A;  3ZBH A;  4MVS A;  4KUM A;  4K8Z A;  4YJ3 A;  4K0K B;  1QLE B;  3WG7 B;  1AR5 A;  4GX0 A;  5C93 A;  3TK1 A;  1N33 O;  1KC8 W;  3H1I H;  1Q6U A;  1K33 A;  1GN2 A;  3CCE V;  4NXM O;  5LYJ B;  2WA4 A;  2R9I A;  2RCV A;  2W0F C;  1SQV H;  1L0L H;  1AI6 A;  4QE7 A;  5FL7 G;  4X88 A;  1SS3 A;  1IBL B;  1JR9 A;  5TIS Z;  3SJA C;  1US6 A;  1YJ9 V;  2WLL B;  2RNB A;  3M8A A;  4BIO A;  4DV1 O;  1E1Q G;  2IJK A;  4ZOL A;  2OTL V;  3RYC A;  2ZT9 B;  5EIB D;  2RN9 A;  3SJC C;  4UCR A;  3CCV V;  1IDS A;  1SET A;  5HFM A;  2X6C A;  3PJS K;  1VMG A;  1LR1 A;  1ZX3 A;  3B09 A;  3AG3 C;  3OTF A;  4RWU A;  4LF9 B;  4NB5 A;  4O4J A;  1RSO B;  3ETQ A;  1IBK O;  4X1Y A;  3G71 V;  4JF3 A;  1IVS A;  1WPX A;  1BQ0 A;  3L72 H;  1FS0 G;  3JAW A;  4YHH O;  1YTF B;  3JCU Z;  4ZI7 A;  1ZSP A;  3L73 H;  3CC4 V;  4B3T B;  2EIJ C;  2LW7 A;  3QO7 A;  3OGC C;  4EB6 A;  3APQ A;  3MHS C;  1QCE A;  5L3C A;  1IJG A;  1YI2 V;  3AK2 A;  3FB5 C;  1AI5 A;  3RVY A;  4DYL A;  2VQE O;  4YJ2 B;  5LGU A;  3ZHQ A;  4PA9 A;  2UXC B;  3L71 H;  2EUL A;  2EIM B;  2BTQ A;  3K04 A;  1PL4 A;  4J42 A;  4PA4 A;  4DR5 O;  1XNQ O;  2QWQ B;  2HVK C;  1THZ A;  4FK5 C;  1TVK B;  4MW3 A;  5LXT A;  2XOK G;  5IJ9 A;  3ZMT A;  3DXR A;  3HKB B;  3UM7 A;  2A7W A;  4LH6 A;  2QWR B;  3OT7 A;  3CWB H;  3CX5 F;  3LSQ A;  4UB6 Z;  1XMO B;  1B04 A;  2ZNJ A;  4E2L A;  2XHB A;  2D3O W;  3KDR A;  2IH3 C;  2PUS A;  5E1A C;  1XI1 A;  2UXD B;  4B7E A;  1WB8 A;  4MTF A;  1CXZ B;  5IYB O;  1N0J A;  2YEV B;  1RM1 B;  1EM1 A;  5JJN B;  5LHH A;  4IGG A;  1BZK A;  5LMU B;  4WFG A;  1I5X A;  2CH7 B;  1EZV H;  3CSX A;  3G80 A;  4I0X B;  4O2A A;  1MSW D;  1EZJ A;  4CBC A;  4J7Z A;  2GUZ B;  4B3M B;  5IJ0 A;  4GLX A;  4XBF A;  1UPG A;  1H38 A;  1DK1 A;  3W7W A;  3OMA B;  4J9Z B;  1S3J A;  3IGA C;  5LHI A;  2QSA A;  1N0N A;  2UXX A;  4MVO A;  1R1B A;  3R65 A;  4X1I B;  3ZHS A;  4FM2 A;  2DMX A;  4I55 B;  2QM4 A;  4DR6 B;  2YI9 A;  2CK3 G;  2P6J A;  1I94 O;  5CB4 A;  2QGN A;  3B40 A;  4IIJ B;  2Y69 C;  2YC0 A;  4AI8 A;  2AW9 A;  4FFK A;  3K5M A;  3RWR D;  2Z3Y A;  3WG7 C;  1FJG B;  2EJ7 A;  3IC9 A;  4NVP A;  2UU9 O;  4LF5 B;  1FFT B;  4O4L A;  2K1E A;  3CEI A;  4X1K A;  3BFR A;  1SQQ H;  4X66 B;  1H5W A;  2QE7 G;  4DV0 O;  1BHA A;  2UUB B;  2YIA A;  2P4V A;  5EYP A;  5LOV A;  1AR1 B;  4UXN A;  1KQS U;  1U96 A;  4Z1V A;  1IXM A;  3SJQ C;  3OMN B;  2WLK A;  1AP6 A;  3F7Y C;  1Y66 A;  3CE2 A;  3J81 N;  3RYI A;  4RAI A;  5CA0 B;  4DR1 O;  4K8X A;  1H2G A;  1OCR C;  2QR4 A;  3EVK A;  1RP3 B;  2XAS A;  5L3B A;  4ZHQ A;  2RJZ A;  1H2N A;  4I4T A;  5B1A C;  4JV5 B;  1HWY A;  1H2K A;  2KQX A;  2P67 A;  3HKE A;  5LBQ A;  3CCJ V;  4O4H B;  4MTX A;  4QGP A;  2JDI G;  4GCZ A;  4BWA A;  3X2Q C;  4TOI A;  3NR7 A;  1G4Y B;  4X62 O;  3OTO O;  2ZXW B;  1V54 B;  2EIK C;  2VRZ A;  2PF4 E;  4UV9 A;  2ZM6 O;  3OEH G;  1H2L A;  4DV2 O;  1NKD A;  3VBB A;  1K5Q A;  3ZMV A;  2Z5U A;  1FAF A;  1YF2 A;  2M6Y A;  1XHX A;  1NTZ H;  4E4E A;  2PI4 A;  4Z1M G;  3CPW U;  2EIM C;  1WA8 A;  2CGN A;  1TUB A;  1Y6X A;  4JI0 O;  4DUZ B;  4YJ3 B;  3FFQ A;  1QQC A;  5BZB A;  4TUY A;  3ZRX A;  3BA8 A;  3LUT B;  4JI3 O;  4I50 A;  4NXN O;  3ZMZ A;  3BVO A;  3QF7 A;  4TSF G;  4LF6 O;  3JCZ A;  2VWK A;  2GTS A;  3F5W C;  3TJT A;  4GKK O;  1XDC A;  1K7D A;  3RYH A;  5KUK A;  2KB1 A;  1XBL A;  5B1O A;  2HJD A;  5L3E A;  4GX1 A;  3OD4 A;  5EBW C;  2HP8 A;  1E79 G;  2NLJ C;  1GMG A;  4OPH A;  5EC1 C;  1RPO A;  4LP8 A;  4EFB A;  1BS3 A;  4J7K A;  2HKO A;  1EFR G;  5H2F Z;  3JAR A;  4B3R O;  1FYJ A;  2X0L A;  5FPO A;  1EN4 A;  1H8E G;  5H9C A;  4CZZ A;  1FKA O;  1MMM A;  4DUY B;  1JJO A;  2Q7H A;  3MHH C;  1NS1 A;  4CC6 A;  4CC5 A;  1EN5 A;  5B1B B;  4X1Y B;  1WP8 A;  3GB7 C;  1K97 A;  3JAW B;  3JSL A;  1VQ9 V;  1W2B U;  2QM8 A;  5EBM C;  5KMG B;  1XNR B;  2Q0O C;  4JYB A;  4BW9 A;  5ITZ A;  1N32 O;  4U3F H;  2W0X A;  4TWK A;  1CPY A;  5B1N A;  4DR2 B;  1Y74 A;  3FAV B;  3LDE A;  4KHP B;  1VQO V;  3K0G A;  2HG5 C;  4DR3 O;  2BTQ B;  1YSC A;  4U7O A;  1N4C A;  1JCH A;  4W4K A;  1HP8 A;  3IAY A;  2ITD C;  1UJW B;  1FFX A;  1S72 V;  1WJZ A;  3FYE B;  5FNV B;  2XAH A;  2XUM A;  3GWO A;  3M99 B;  5KA6 A;  4JAS A;  5LXT B;  5IJ9 B;  1ZL8 A;  3OR7 C;  4MTG A;  1KBH A;  1K5S A;  1GO3 F;  3O65 A;  1M57 C;  2CTR A;  1F4M A;  3KCX A;  3THO A;  3SPI A;  1XL6 A;  3C3T A;  3UT5 B;  2BE3 A;  4JTC B;  1M1K W;  4QIW F;  2OIG A;  4UCS A;  1HNW B;  1HNX B;  3IJ4 A;  2YI8 A;  4AQY O;  3EXA A;  2ETN A;  1YIJ V;  1X59 A;  1AIL A;  5JCO A;  2UUC O;  4JI5 O;  5C8Y A;  4IT5 A;  2Y4T A;  1P84 F;  2L6L A;  3ZRV A;  1WN7 A;  4KFM A;  4WFB V;  2ZR2 A;  5GON A;  4LBE C;  4QPJ A;  4AIL C;  1SQP H;  4GKJ B;  3ZRW A;  3ETG A;  5LP6 C;  1HR0 O;  1R3I C;  3G4S V;  3CRC A;  2UUA O;  3I56 V;  2N74 A;  4PHZ A;  4J11 A;  4IHJ A;  1BQZ A;  1AI7 A;  2JEX A;  4FM0 A;  2H3O A;  2LGQ A;  3M7M X;  4Z2W A;  2NR5 A;  4ZBM A;  4LFA O;  4UCU A;  4DV3 O;  3E2E A;  3HKC A;  1GN3 A;  2CTP A;  2PTM A;  4OX9 B;  4HYO A;  3JD3 A;  5KHJ A;  3AK1 A;  1B3Q A;  4O4L B;  4X1K B;  3JAL B;  1B06 A;  4JI4 B;  3JSN A;  1AB3 A;  5JH7 A;  3FB6 C;  4DXW A;  5EYP B;  2HHH B;  2FKX A;  1K8A W;  3CS5 A;  3E83 A;  5IYD O;  4B3S O;  1MNG A;  1BMF G;  4R6Z A;  5J2T A;  4J10 A;  3CYO A;  2OCH A;  4GX5 A;  4BIZ A;  5FLX N;  3SR2 C;  3CJH A;  3FB7 C;  4ZHQ B;  4I4T B;  2EZP A;  5IDJ A;  5B1B C;  4BAY A;  1N33 B;  2KSD A;  2PYL A;  3FB8 C;  4NXM B;  2WLJ A;  2VQF O;  2UXN A;  1CEZ A;  1G8M A;  4XDJ A;  1BSM A;  3T1C A;  1RFY A;  2IU3 A;  4JGS A;  2YS8 A;  4JI2 O;  4D7T A;  1K92 A;  4X65 O;  5BR8 O;  1M56 C;  4L87 A;  1JFF A;  4TUY B;  5JQG B;  3UQ8 A;  1D2D A;  3T4Z A;  4H13 B;  4JZG A;  4YIO A;  5B3S C;  2H8P C;  2QTO A;  2Y69 B;  5CN0 A;  1EBO A;  5KA5 A;  1IBK B; 
#chains in the Genus database with same CATH homology
 1N0J A;  1LUV A;  1Y67 A;  1EM1 A;  3AK3 A;  1GN3 A;  1MSD A;  2QKA A;  1IXB A;  1GN6 A;  3AK1 A;  1IDS A;  2CDY A;  1PM9 A;  3LSU A;  3C3S A;  2GDS A;  1ZTE A;  1VEW A;  1B06 A;  1EN6 A;  4E4E A;  3RN4 A;  4GUN A;  1ZUQ A;  1N0N A;  4JZ2 A;  1MA1 A;  1LUW A;  5A9G A;  1XUQ A;  1MNG A;  2ADP A;  1ZSP A;  1I0H A;  4X9Q A;  1WB7 A;  3C3T A;  3AK2 A;  3K9S A;  2AW9 A;  4FFK A;  3TJT A;  1D5N A;  1XDC A;  1JA8 A;  3QVN A;  4F6E A;  1I08 A;  3DC5 A;  4C7U A;  1PL4 A;  3IC9 A;  1GN4 A;  1ZLZ A;  1AP5 A;  3CEI A;  3BFR A;  1BS3 A;  1KKC A;  1AVM A;  3MDS A;  2ADQ B;  1BSM A;  1IX9 A;  1EN4 A;  1AR4 A;  1XIL A;  1P7G A;  5AG2 A;  2QKC A;  1MMM A;  1AP6 A;  1VAR A;  4YIP A;  3OT7 A;  1AR5 A;  4BR6 A;  3KKY A;  3DC6 A;  1EN5 A;  1SZX A;  1QNM A;  3EVK A;  3KDR A;  1GN2 A;  1BT8 A;  4JZG A;  4YIO A;  1XRE A;  2RCV A;  1WB8 A;  4JYY A;  2P4K A;  2CE4 A;  1JR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...