1MSDA

Comparison of the crystal structures of genetically engineered human manganese superoxide dismutase and manganese superoxide dismutase from thermus thermophilus. differences in dimer-dimer interactions.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the crystal structures of genetically engineered human manganese superoxide dismutase and manganese superoxide dismutase from Thermus thermophilus: differences in dimer-dimer interaction.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase (superoxide acceptor)
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
total genus 67
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1992-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1msdA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1msdA02
2CDYA 1MMMA 3AK1A 1ZLZA 3KKYA 2P4KA 3CEIA 1SZXA 1GN6A 4JYYA 2RCVA 4C7UA 1IDSA 2QKAA 1EN5A 3LSUA 4X9QA 1D5NA 3OT7A 2QKCA 1XUQA 1I08A 1AR5A 1EN4A 4BR6A 1PM9A 1EM1A 5A9GA 1XREA 1MNGA 1JA8A 1JR9A 1QNMA 1LUWA 1LUVA 3IC9A 1BSMA 1IX9A 1VEWA 1VARA 1WB7A 1GN4A 2ADQB 1GN2A 3AK3A 2GDSA 1I0HA 3EVKA 1ZUQA 1B06A 3AK2A 3RN4A 4JZGA 1AVMA 1MA1A 3DC6A 1KKCA 3TJTA 1PL4A 1GN3A 3K9SA 1EN6A 3MDSA 1Y67A 1XDCA 1MSDA 2ADPA 1ZSPA 4F6EA 1ZTEA 4YIOA 2AW9A 1XILA 1N0JA 3DC5A 3C3TA 4FFKA 4JZ2A 1BT8A 2CE4A 3BFRA 1WB8A 1AR4A 1AP5A 3C3SA 3QVNA 4GUNA 4YIPA 4E4EA 1P7GA 1AP6A 1BS3A 1IXBA 1N0NA 5AG2A
chains in the Genus database with same CATH superfamily
3IGAC 2LGQA 5FLXN 3MD0A 1RSOA 3CCLV 3T1YB 1Y4MA 5L3FA 3CHXA 2X6CA 1Q3EA 1HR0B 2EINC 3RT3C 2JS5A 1KQSU 4DV3B 1XHXA 4JTCB 4JGSA 1NH2D 2G38A 1XOUA 4I4TB 1FS0G 4G2KA 1XNRO 1FJGB 1EN4A 1JPXA 3SDLA 1MNGA 4JI5O 5IE9A 3TETA 1JR9A 2L35A 4UV8A 3THOA 2ZM6B 2Q0OC 3ASNC 4PDRA 3F7VC 3SGIA 1FOUA 5JCOC 4DV6O 1PPJH 3DTUB 3ZMUA 4K0KO 1VQ8V 4XDLA 3ABUA 3BABA 1B3QA 2ZDIA 1KU9A 1O9HA 4PA4A 3CC7V 2Z0AA 1AJPA 2Q67A 1Z5WA 4L87A 1RPRA 5IJ9A 1VQPV 4O4HA 2GUZB 1GN3A 1FXKA 3SJCC 4FLYA 1F4MA 1UJWB 2XAGA 1XMQB 4BIOA 1ZSPA 2ZE8A 4DR1O 3J81N 1ZTEA 4F6RB 1OJHA 1HP8A 3E8FA 3AG7A 1XMOO 1FFTB 2P22C 4RQEA 1YXBA 3QVNA 1P84F 1NTMH 4JAVA 4K0KB 3RYHB 2QGNA 1S5JA 1A32A 4JI0B 4CS3A 3GB7C 3E8BA 4AHCA 5DECA 5EC1C 3BRCA 2XUMA 3AK1A 5CB4A 2P4KA 4GKKO 2Q8VA 4B3SB 3LDDA 3QG5A 4W4LA 5LHGA 3P3NA 1Q6IA 2IJHA 4EKWA 2ZR2A 2EJ7A 3SR2C 1VMGA 3GWKC 1EN5A 5HFLA 4DYLA 1M56C 4CH4A 5J2TB 3KDRA 2PUSA 3OAAG 5KA5A 1KBHA 1EM1A 4DUZO 1YZBA 3VOUA 5FPRA 3ZS8C 1QVGU 1KP2A 3BA9A 1RFYA 4JYCA 3W7XA 3AG1B 1IX9A 1NBMG 3HPLC 2UXDB 3T1HB 3ETGA 1WN7A 2P5OA 5E1AC 4J11A 4GKKB 4LFCO 4MVOA 5B1NA 5IYBO 4LFBO 1K5QA 3JAWA 5KX5A 3JARA 3JCZA 3ABTA 1HNXB 5J2UB 4DV5B 4R7CA 1AVMA 2Y0IA 2DWDC 4ZHQB 5LGTA 2A79B 3JSNA 4DV7B 3AEIA 3A2FA 1QR9A 1MSDA 2Y0PA 4KL1A 1FYJA 4O4JB 4J10A 2JDIG 3JAKB 1UFIA 4PA7A 2HFEC 4MTFA 2YXYA 1K73W 1VQ5V 5IT9N 1P7GA 3C90A 3TK1A 2OCHA 1K4CC 2UUCO 1WNSA 2YICA 3ZMVA 2F4VO 3L71H 2BTQB 2RQ6A 4PHZA 2Q9LA 4I9WA 4G28B 1EZJA 5BR8B 4MVMA 5GTHZ 4FVMA 4DV7O 4LNUA 3SJAC 1Q7YW 2YIBA 1QLEB 1B04A 1BGYH 3LSSA 4PDMA 2X7RB 4JF3A 5L3CA 2EIJC 1M90W 1Y76B 4CH6A 1XUQA 4NR1A 3FYIB 1KYOF 3CYOA 4CH5A 2VQEB 3A8TA 5DM6V 2ZXWC 2Y69B 4R50A 2UXBB 1JFFA 1HNWB 5EIBD 1ORQC 2F66C 2VWKA 4DR3O 1XMQO 3JCUZ 4TT3G 2XHBA 1JCHA 3N2KA 3CRMA 4FPPA 4TSFG 2X6BA 1AJQA 1GN4A 3M99B 1M1KW 3JATB 1JOYA 4U3JB 1XMOB 2GSMB 2HVJC 3G67A 4BW5A 3STLC 2DYRB 5JVDA 4O2BB 1AI6A 4D7SA 5CN0A 4PA9A 3HKEA 4UCTA 4X1KA 4JI4B 4LF8O 3L73H 4ZBMA 1Y67A 2P90A 1XDCA 3W7SA 4DR5O 3ASNB 1CXZB 3A0HZ 1XHZA 4TQFA 4PV1B 3BPZA 2IW5A 4B7EA 1SS3A 3APQA 2VS0A 2X6AA 3C3TA 3DC5A 4X1KB 5F2VO 1FKAO 1ZL8B 1GMGA 2WA3A 4U3FH 4H33A 4LH6A 2GBOA 3ML0A 2YC0A 3C3SA 4H0LB 2AHYA 1N34O 1WA8B 2ODMA 4DK0A 1YVWA 1BS3A 3RYIB 2LGWA 1QQCA 2EZPA 5LXTA 3H01A 2ZE6A 5BMVA 3A0BZ 2GHYA 3W7TA 4X62B 5L3DA 1SZXA 3JAKA 4X20B 4JI4O 4DR6O 3CC4V 4JYYA 5CA0B 1VQ7V 5B66Z 1R1BA 5BZBA 2JEXA 3T2MA 5BXZA 2EZOA 4B3TO 5JWPA 4DV0B 3UM7A 4LFCB 1D5NA 1SQQH 1JNBA 2GTAA 3JASB 1Y76A 3ZN0A 4MSWC 1FJGO 4OPHA 3RGBA 1RP3B 2LW7A 3OUSA 2M7WA 5J2UA 2N04A 4LNUB 1WLEA 3H1IH 1Q82W 1LUWA 4QPJA 2DOSA 2P7TC 4O4LB 3CD6V 4DV6B 2A7WA 2QM4A 4BW9A 1H38A 1J95A 3NR7A 3EXAA 1YJ9V 4RQFA 1OCCB 2HJFC 4Q6GA 1X59A 3WB0A 3K9AA 2BSKB 1VF5B 2FL4A 2Q4PA 2OTJV 3MHSC 3X2QB 5IWAB 2KG7B 4GZRB 4X8AA 3SYPA 3QO7A 4JAUA 4NYKA 1ZWIC 1RM1B 1P49A 4KP4A 1S5HC 2KSDA 4X1IB 2KG7A 5B5EZ 2LJ2A 2ITCC 2ATKC 4I7ZB 4DV2O 5LMNB 1L8DA 4WBNB 5H9CA 3CE2A 1WJZA 2A3QA 4E4EA 2ETNA 1AP6A 1IXBA 2QWPB 2E74B 4UVCA 4CS4A 2EINB 2Q7EA 3D3IA 3D8CA 3ETDA 1SKVA 4LC1A 3OW2U 4LR3A 2Q7GA 5JQGA 3FFQA 5FL7G 4LFAO 3KKYA 3CEIA 1HNWO 1IZ3A 2FMLA 2RCVA 4OPAA 5CBHA 2BOCC 3RW0A 1OV9A 1VQKV 1B6QA 4ZKIA 4WFGA 4FFBB 4B08A 3T4DA 3ZBHA 1ZX3A 3M7MX 3HKCA 5D5QA 1K34A 1R3IC 4QJFB 3Q4HA 2JGUA 1AI7A 4KHPB 5LP6C 3R65A 4FM1A 5LXTB 1RM1C 4BIZA 3RYIA 5LL6Y 2VQFB 4UVAA 3E83A 4LFAB 2VRZA 4LFBB 4LP8A 1TVKB 1H5WA 4J9YB 2Q73A 3D36A 3EVKA 4J7ZA 4X89A 1BQ0A 4E2LA 3RN4A 3G80A 1GKFA 2WLNA 2JJ2G 4H44B 4RO2A 4IYIA 5EBWC 1FXKC 1V55C 5LYJB 3MDSA 3WU2Z 3LNMB 1YJWV 3ZX6A 4HYOA 4F6EA 3TXSA 1EZVH 4P9OA 1NJIW 4PI0A 4FFKA 4LWSB 1N34B 3JALB 2PGGA 1Y6XA 4UVBA 1VF6A 3E22A 1R3LC 5KHKA 2AXTZ 2QTSA 4PDLA 4IL6Z 1SERA 1AP5A 4TOIA 3CP1A 3SPCA 4LF5O 1YITV 4MTOA 1BQZA 1QBZA 2QKSA 3E22B 3ZRWB 3FB8C 3RYFA 1JFFB 2NNUA 3UT5A 3ZN1A 3OMIB 2PYJA 4J7KA 2WSSG 1LR1A 1SA0A 2N74A 4W4KA 4HBNA 3CJHA 3DGEA 1IVSA 5ITZA 3O9OA 3ETEA 4X1YB 4B7KA 1N4CA 2QKAA 1N36B 3ZHTA 5LOVB 3LSUA 1VP7A 3N27A 2KB1A 2LP7A 4I0XA 3KZIZ 2QSAA 2GTSA 5EC2C 5A9GA 2N05A 1NVPD 1SA0B 3CCSV 5JVDB 4IT5A 1S77D 1RSOB 2BTQA 1V55B 3NXSA 1M5IA 4MVSA 3WB2A 1YEWA 3IC9A 3SYOA 4Z1MG 3CCQV 1QU7A 1S76D 1HNZO 2XASA 3RVZA 2F93B 2ZE7A 1Q43A 1YJNV 4LF7O 3HKDB 4ZI7B 3CMEV 2ZNIA 3ZRSA 4LWSA 4EFBA 3CMAV 2UXBO 2ZR3A 4FFBA 2HG5C 4JZGA 2LQTA 3VQWA 2UUAO 1GO3F 3K9SA 4UCOA 1VF6C 1FXVA 3FAVA 2UU9O 3JD3A 2EBOA 3UO2A 2YXLA 4FK5C 5H6QA 3U10A 5LP6A 4DW0A 3H1JH 5EIBC 3BVOA 2V7QG 1S3JA 5JJEB 3W7UA 4LF8B 3I55V 1NU1H 2EIJB 3KCYA 1XNQB 3GWOA 5LHHA 4TV8B 4QE7A 1N0NA 3LDCA 4GX0A 3RWRD 2XT9A 4WBNA 2EILC 3JAMN 2OT5A 2CK3G 2ZDIC 4PELA 4BAYA 5E79Z 1G1XB 2UUAB 1K5SA 3BAAA 1FPOA 1Q90D 2Q68A 1YI2V 4ZI7A 4DR4B 1FFXB 4RUFA 1W59A 3L74H 2H94A 4DW1A 1QLNA 4IGGA 4Q20A 2BTOA 4B3RB 2P4VA 3K5NA 4ZHQA 4BR6A 3CWBH 2QDOA 4GX2A 1NTKH 2D2CB 1I94B 1TAEA 2WLIA 3OE7G 1DF4A 3JYCA 3TGUH 4JI7O 3TCUA 4B3TB 3JAWB 3OGCC 1VQOV 3ZHSA 3RYHA 2F23A 1V54B 2QM8A 2ZIOA 4P2ZA 1FAFA 4D6TH 2IJIA 1TUBA 1YTFD 1AI4A 3CCEV 4O4IB 2E5LO 1PV0A 1BL8A 2PTMA 3CJHB 2HJDA 3H1LH 5EBLC 3ASOC 1NKDA 4FLXA 4F6RA 2WLLB 3VQXA 3K06A 5IY5B 1W0KG 3CCVV 2XAJA 4N21A 5IJ0B 4YJ2B 1TGOA 3G71V 1TA8A 1M4UA 3BEHA 1Q8IA 1YIJV 1E1QG 1EFRG 1T5EA 4OXSA 3CRRA 5BMVB 3Q4HB 1ROPA 3SPIA 2UXXA 4YHHB 4DR2O 4PI2A 1U96A 3F5TA 4GKJO 2W0FC 4D7TA 2XTAA 4XDKA 4P30A 4LF4B 3B40A 1BE3H 1R6KA 3JD4A 2E3CA 1SZTA 2UUBB 5KHHA 5FNVB 1MZFA 5LP6B 1AR1B 3E86A 2KKWA 2QJ1A 5EZYB 1MG1A 4C7UA 2DYSC 3JASA 5GW7A 2CTRA 1N8RW 4U7OA 4QE9A 2IU3A 2L6LA 3CB2A 2B5UA 2QE7G 4DR2B 4DRXA 4YY3O 1I08A 1PNLA 3CCUV 1OCRC 3HR0A 4R6ZA 1K4DC 1Z5VA 2HEPA 4GKJB 3B4SA 1QHTA 4DR1B 3ABLC 2UU9B 4J7JA 1GH6A 3CCRV 2CTWA 3K5LA 3WG7C 4ZOLB 2GV9A 1IBLO 1MABG 3VQVA 4FM0A 4NXNO 4QIWF 2BOBC 2Y4TA 5CA1A 2IJKA 3UCSC 1HWYA 2FYUH 3DC6A 1UPGA 3ZRXA 5JH7A 3QTCA 4YY3B 3FD9A 3PN1A 4PD4F 1SRYA 3ZMTA 4J9ZB 4WFAV 4JV5B 4L8JA 3CXHF 4DK1A 2ZKOA 3ZMZA 2ZE5A 3RYFB 3BFRA 4NTWA 3H1KH 4J42A 4TUYB 5LBQA 1QCEA 1QLEC 1GAXA 2EULA 1KMIZ 1SQGA 5FPOA 4GX1A 3LNNA 3OFNG 4FMTA 2GUZA 4O2AA 4OX9O 4MVQA 1GN6A 5IWAO 3E89A 5CMUA 1IBMO 1IDSA 2EX3A 3ZMSA 4TWKA 1HNXO 4TV8A 1CP9A 4JI3O 1SF9A 2NN4A 3N2GA 5JJNB 5BY1A 4KFMA 1AR5A 2CH7A 2JGDA 5LMNO 2B1IA 1JA8A 4MVUA 1S0VA 4I4TA 1IBKO 3ZHQA 3ABKB 4IHJB 1RPOA 1VEWA 1IJGA 1VARA 2RNBA 5B1BB 1DLBA 4OX9B 2ZIMA 2ZM6O 3AK3A 2GDSA 4ICGA 3HKCB 3X2QC 3W7WA 5LMUO 5CA3A 4JPRA 1YHQV 3JATA 1F4NA 2WLKA 4JI2B 3B8NA 1PL4A 5IYDO 5B1OA 4UCVA 1AILA 4J41A 4JAAA 1MSWD 4NTXA 1G6UA 4RAIA 3B2EE 2K1EA 5CB4B 1M93A 1NZ6A 3H9VA 1Q6UA 3CS5A 4JYAB 5KAIZ 1XNQO 4GUNA 1H2SB 5LA6B 5LOVA 1THZA 4MVRA 3APOA 3CRCA 1OZ0A 5LMUB 5ITZB 2HP8A 3ZCCA 2XOKG 2OCCC 1Q6HA 2IH3C 2VWJA 3IAYA 3CRAA 4FLTA 4JASA 3MAQA 3QF7A 1PD3A 1QR8A 3UT5B 3CX5F 3K3WA 3K5MA 4U3JA 3AG3C 3B8MA 2OTLV 4PA3A 1PKXA 1F7YA 1Y66A 2EIKB 2HLDG 2QKCA 5IJ9B 4FLVA 1N33B 1Q5OA 1E79G 3EFFK 1QVFU 1O9GA 4YJ2A 5IJ0A 2IM9A 3ZJZA 4JI7B 1G4YB 3L70H 2WLLA 2WAMA 4U7NA 4LF5B 1YSCA 4UXNA 1WPBA 1MZEA 4HZ3A 3IFXA 1SQXH 1GRJA 1JX9A 4UCRA 2LW1A 2DE0X 3ABKC 1BMFG 3H1HH 5L3GA 4GYCB 2RN9A 3ZEDA 4GCZA 1SC5B 3AK2A 3OEHG 3STZC 2IH1C 1JJOA 3TJTA 3JD2A 2CTPA 2F1MA 4PA6A 1KUQA 2BCCH 3P3PA 4WFBV 4R8CA 4KUMA 1ENVA 3CC2V 4UCUA 4MS2A 3K03A 5GONA 4TV9B 2AW9A 2ZD9A 1PP9H 4HAMA 5IDJA 4QGPA 2QWQB 2UUCB 2AZ2A 2W6IG 1EBOA 1DTOA 2UXNA 1WPXA 1SETA 1URFA 4YIPA 3FYEB 5D5PA 2EIKC 4FLUA 1NVPB 5BR8O 1VF7A 2P06A 5CBGA 3AG3B 1K9MW 3R66A 2QEXV 3RYCB 2DN9A 3U0ZA 1R6TA 2CDYA 3OR7C 4F4LA 3OGIB 2OCCB 1H2GA 1XI1A 5HFMA 4LF6B 1NS1A 1OCZC 1IBKB 5KUMA 4JI3B 5B1BC 4LF9B 3D36C 2QA4V 5K1PA 4AQYO 3OT7A 3J80N 3N2GB 1K3EA 2Q0AA 1VQNV 1JVMA 1R3KC 2R70A 4MTXA 3K58A 2Y69C 1H8EG 3OEEG 2WLJA 1OCOC 3FAVB 5KA6A 4X1IA 1QNMA 4KXRA 1LUVA 3AG2C 3OTOO 1S5LZ 4N23A 3SYQA 3QO8A 2VQEO 3K0DA 4MT8A 1XQ8A 4B3SO 4JI1O 4X20A 4NTYA 5IYZB 4O4HB 3IC7A 1N32B 5JCOA 1GN2A 1WP8A 4DR3B 2JVDA 4AILC 3OMNB 2A9HA 3SPHA 3UQ8A 4QNHB 4JYBA 3OTFA 4J80A 1NR1A 3JSLA 2R72A 3OUFA 3WFVA 3FX7A 2HVKC 1COWG 5KHJA 1NH2B 3O65A 1M57B 4B3RO 4FLWA 1W0JG 2E75B 5JH7B 1I94O 4JZ2A 4DR5B 2DQ3A 2Z3YA 1R3JC 4K8XA 1W2BU 3J7AU 1GK9A 3HKEB 1N32O 4UB8Z 5H5NA 2XNDG 4X62O 4JI6O 1D2DA 4DV5O 4JV5O 2Z5UA 4DR6B 3CSXA 5CA0A 2YS8A 5C93A 1US6A 2JIZG 1YCIA 3B77A 4UV9A 4YXWG 3N2KB 5GTIZ 2JK5C 2YUAA 2KQXA 4YJ3A 4TV9A 3I5DA 5GONB 4ZIBA 3RFRA 3WG7B 2MK3A 1JMKC 5EYPB 1WA8A 3JALA 3AG1C 3BCCH 4PJ0Z 2LFRA 2OWOA 2CGNA 2PI5A 4WFFA 3JARB 5KX5B 4X65B 2YIAA 4MW8A 1J5EB 4K8ZA 5KUKA 1VQ4V 4WFHA 3DSQA 4LH7A 4NVPA 5EZYA 1AB3A 3FB6C 5H6RA 4DV4B 4NXMO 3K5OA 1BSMA 4LF4O 2K9PA 3CRQA 1I5XA 2ADQB 4ZOLA 2AZ0A 2YEVA 2F4VB 5DEDA 1K97A 4EEQA 4GLXA 1MA1A 2QR4A 2D3OW 4EFEA 1GM7A 3RVYA 2ARHA 1NQTA 2AGAA 3SJQC 2EJRA 3U11A 5KMGA 3ABMC 1YTFB 1K7DA 4MVZA 2ZT9B 3ASOB 4DRXB 4YIOA 3SPGA 1N36O 2QTOA 1H8HG 4LF6O 2QWRB 2H8PC 3A0RA 4JI2O 4JI5B 4LBEC 1KECA 4Z1VA 2B9ZA 4IIJA 1AR4A 5LHIA 2XAFA 3E35A 5J9PC 1CEZA 4X66B 4O4IA 2A0LA 2Q69A 4AQYB 2V4DA 1DF5A 4X64B 2ILMA 2UXCO 3K79A 3GVMA 5L3BA 3OR6C 3AG4C 1PNKA 4NB5A 4JYAO 1M9NA 2F95B 5B1AB 3S3WA 2Q5ZA 4CC5A 1AI5A 2HHHB 4LF9O 4CZZA 4B3MB 2WLHA 3OMAB 3CCMV 1D5AA 4HNAA 4DO2A 3L72H 2DQ0A 3KG2A 5KAFZ 1N33O 4OGQB 3P32A 1F23A 4RUEA 4IYHA 5A2QN 2Q7HA 1XREA 2YI8A 1NTZH 4O4JA 4X88A 2YEVB 3ABMB 1WAZA 5KHIA 4KHPO 2DYSB 2ZQMA 3KCXA 2PI4A 1PNMA 2NR5A 1VQ6V 3UO3A 4FLZA 4JI0O 1BZKA 3ABLB 5JQGB 1K92A 5LA6A 1ZUQA 2VQFO 4I9QA 4O4LA 4DV0O 2HKOA 4DUYO 4I55A 1L0LH 1Y74B 1AROP 1DGSA 4BIUA 1DK1A 4YJ3B 1FXHA 4I50B 2JJ1G 3AG4B 4DV1O 2CE4A 2FTKA 3SJBC 1GM8A 5J2TA 4H13B 2JS3A 1OCRB 2YXHA 3K59A 1FXKB 4K3AA 1SQFA 4CC6A 2XAHA 3SYAA 2UXDO 2BSKA 1HR0O 2IU0A 4GX5A 2NLJC 3CPWU 2IBZH 2PYLA 4IHJA 4EB6B 4I50A 1ZLZA 3IJ4A 2P67A 3LSQA 4JTDB 3FB5C 5B3SB 2Q6AA 1BHAA 2DWEC 1SQPH 2ZINA 2CH7B 1Y74A 2B1GA 1ZAUA 1ZL8A 5DN6G 1KD1W 4X9QA 3TXQA 2R9AA 2A06H 2Y48A 3SPJA 4I0XB 3ZHUA 3DXRA 5B3SC 3B09A 1XNRB 4JTAB 4DR7O 3BA8A 1LNQA 2JRIA 1OHHG 5CA1B 4ASUG 3F5WC 1SQVH 3ICXA 1WP7A 3OTOB 3VBBA 2P6JA 1V9PA 4A5UB 4O2AB 2WPDG 3CXCU 3E2EA 3LUTB 4JI1B 2E76B 1GTOA 2MW2B 3ZRWA 2CGOA 2CUGA 5IY5C 3HKDA 1H2MA 2DYRC 4NKGB 3K0GA 4XBFA 1I0HA 3PJSK 4ABMA 2EIMC 2QM7A 3QO5A 2EILB 5K1XA 2XAQA 1KKCA 2YI9A 1X4TA 2YDEA 1FD9A 4JI8O 2WLMA 1SQBH 3MHHC 1IURA 3CCJV 2Y4UA 1EN6A 3E8GA 3AG2B 4X64O 4DR7B 2F43G 4I55B 1Z2GA 1N0JA 4PDVA 1VIBA 2HHHO 4FZ1A 4Z2WA 1BT8A 1I5YA 3DXRB 4X1YA 1XL4A 3HB3B 4G27B 3M8AA 3ZHVA 1VQMV 4XDJA 1XEQA 1MOFA 1VQ9V 4QPKA 4IIJB 4LCUC 4FZ0A 5AG2A 5LGNA 1JQ0A 2ZNJA 4DR4O 1MMMA 3WB1A 2DMXA 4EB6A 2RMKB 4JI8B 4RWUA 3UKMA 1L0NH 2H3OA 5JJJB 4DUZB 1BHBA 5C8YB 4AI8A 4NXNB 1V54C 3QNEA 1YDXA 2RJZA 3FB7C 4UFZA 2CAZC 1I7FA 1S72V 3E8HA 3T1HO 2BE3A 1Q81W 2CTQA 3LDEA 5EBMC 4DV3O 1NR7A 4H37A 2EIMB 5LYJA 1OCCC 3G4SV 2OIGA 4GT1A 1TUBB 3JD0A 3T1YO 5FNVA 4UB6Z 2PY5A 2E5LB 2DW4A 1WB7A 4X65O 1R73A 1TVKA 4K35A 4DUYB 4DXWA 1B06A 3D3QA 2WLIB 1M57C 3ZRVA 4CH3A 4DV4O 4NXMB 3RYCA 3K04A 4CS2A 1VQLV 4I5SA 5LGUA 1CPYA 1P4RA 3K08A 3VQYA 2W6JG 3F7YC 4YHHO 2LO1A 5C8YA 2ADPA 3BY6A 1E1RG 3T4ZA 1NI8A 1K8AW 4DV1B 1FFXA 3OD4A 3S3XA 5KHGA 5EK0A 4FIPC 3ZHRA 1HNZB 2PZSA 1IXMA 1H2KA 4WCEV 4LF7B 4UUJC 5TISZ 3BHPA 2FB5A 1KB9F 1L1FA 5KLVH 2UXCB 2OIEA 5H2FZ 1JJ2U 2WA4A 2JGDB 1U97A 2ZCEA 1PL0A 4CBCA 1H2NA 1XL6A 2FKXA 4X66O 2UUBO 3L75H 2QWNB 2RDCA 1HW7A 2LFSA 3FKSG 2O57A 3T1CA 5EYPA 1BCCH 3SYCA 2R9RB 3ETQA 2R9IA 1KC8W 1KKDA 1OCOB 1Q86W 1PM9A 4B3MO 5IYZA 4DV2B 1KP3A 1P7BA 5L3EA 3G6EV 1R6NA 2YIBD 1AJNA 3JD1A 4BWAA 1IBLB 2M6YA 4JI6B 3K57A 1F51A 2DJVA 1YF2A 4HNAB 2OYQA 2AHZA 2PF4E 4WFEA 3L9DA 2HR3A 3OM3B 5IYCO 2ZXWB 4FJCC 1XBLA 1H2LA 1SESA 1G8MA 1M56B 2IJJA 3ZIAG 5CBFA 1TUEB 3EHBB 1NT2B 3P30A 2V1DA 2ITDC 4FM2A 2WWWA 4TQDA 1XILA 4P9PA 1J5EO 1OCZB 2YIDA 5B1AC 4WF9V 4MTGA 1HDJA 2QWOB 1WB8A 2W0XA 4O2BA 2X0LA 3I56V 4MW3A 2C2AA 2JEUA 2YSUB 5KMGB 3G6BA 1K33A 3RBZA 3HKBB 3HKBA 1GM9A 4TUYA 4UCSA 1IBMB
chains in the Genus database with same CATH topology
2CDYA 1MMMA 3AK1A 1ZLZA 3KKYA 2P4KA 3CEIA 1SZXA 1GN6A 4JYYA 2RCVA 4C7UA 1IDSA 2QKAA 1EN5A 3LSUA 4X9QA 1D5NA 3OT7A 2QKCA 1XUQA 3KDRA 1I08A 1AR5A 1EN4A 4BR6A 1PM9A 1EM1A 5A9GA 1XREA 1MNGA 1JA8A 1JR9A 1QNMA 1LUWA 1LUVA 3IC9A 1BSMA 1IX9A 1VEWA 1VARA 1WB7A 1GN4A 2ADQB 1GN2A 3AK3A 2GDSA 1I0HA 3EVKA 1ZUQA 1B06A 3AK2A 3RN4A 4JZGA 1AVMA 1MA1A 3DC6A 1KKCA 3TJTA 1PL4A 1GN3A 3K9SA 1EN6A 3MDSA 1Y67A 1XDCA 1MSDA 2ADPA 1ZSPA 4F6EA 1ZTEA 4YIOA 2AW9A 1XILA 1N0JA 3DC5A 3C3TA 4FFKA 4JZ2A 1BT8A 2CE4A 3BFRA 1WB8A 1AR4A 1AP5A 3C3SA 3QVNA 4GUNA 4YIPA 4E4EA 1P7GA 1AP6A 1BS3A 1IXBA 1N0NA 5AG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CDY A;  1MMM A;  3AK1 A;  1ZLZ A;  3KKY A;  2P4K A;  3CEI A;  1SZX A;  1GN6 A;  4JYY A;  2RCV A;  4C7U A;  1IDS A;  2QKA A;  1EN5 A;  3LSU A;  4X9Q A;  1D5N A;  3OT7 A;  2QKC A;  1XUQ A;  1I08 A;  1AR5 A;  1EN4 A;  4BR6 A;  1PM9 A;  1EM1 A;  5A9G A;  1XRE A;  1MNG A;  1JA8 A;  1JR9 A;  1QNM A;  1LUW A;  1LUV A;  3IC9 A;  1BSM A;  1IX9 A;  1VEW A;  1VAR A;  1WB7 A;  1GN4 A;  2ADQ B;  1GN2 A;  3AK3 A;  2GDS A;  1I0H A;  3EVK A;  1ZUQ A;  1B06 A;  3AK2 A;  3RN4 A;  4JZG A;  1AVM A;  1MA1 A;  3DC6 A;  1KKC A;  3TJT A;  1PL4 A;  1GN3 A;  3K9S A;  1EN6 A;  3MDS A;  1Y67 A;  1XDC A;  1MSD A;  2ADP A;  1ZSP A;  4F6E A;  1ZTE A;  4YIO A;  2AW9 A;  1XIL A;  1N0J A;  3DC5 A;  3C3T A;  4FFK A;  4JZ2 A;  1BT8 A;  2CE4 A;  3BFR A;  1WB8 A;  1AR4 A;  1AP5 A;  3C3S A;  3QVN A;  4GUN A;  4YIP A;  4E4E A;  1P7G A;  1AP6 A;  1BS3 A;  1IXB A;  1N0N A;  5AG2 A; 
#chains in the Genus database with same CATH topology
 3IGA C;  2LGQ A;  5FLX N;  3MD0 A;  1RSO A;  3CCL V;  3T1Y B;  1Y4M A;  5L3F A;  3CHX A;  2X6C A;  1Q3E A;  1HR0 B;  2EIN C;  3RT3 C;  2JS5 A;  1KQS U;  4DV3 B;  1XHX A;  4JTC B;  4JGS A;  1NH2 D;  2G38 A;  1XOU A;  4I4T B;  1FS0 G;  4G2K A;  1XNR O;  1FJG B;  1EN4 A;  1JPX A;  3SDL A;  1MNG A;  4JI5 O;  5IE9 A;  3TET A;  1JR9 A;  2L35 A;  4UV8 A;  3THO A;  2ZM6 B;  2Q0O C;  3ASN C;  4PDR A;  3F7V C;  3SGI A;  1FOU A;  5JCO C;  4DV6 O;  1PPJ H;  3DTU B;  3ZMU A;  4K0K O;  1VQ8 V;  4XDL A;  3ABU A;  3BAB A;  1B3Q A;  2ZDI A;  1KU9 A;  1O9H A;  4PA4 A;  3CC7 V;  2Z0A A;  1AJP A;  2Q67 A;  1Z5W A;  4L87 A;  1RPR A;  5IJ9 A;  1VQP V;  4O4H A;  2GUZ B;  1GN3 A;  1FXK A;  3SJC C;  4FLY A;  1F4M A;  1UJW B;  2XAG A;  1XMQ B;  4BIO A;  1ZSP A;  2ZE8 A;  4DR1 O;  3J81 N;  1ZTE A;  4F6R B;  1OJH A;  1HP8 A;  3E8F A;  3AG7 A;  1XMO O;  1FFT B;  2P22 C;  4RQE A;  1YXB A;  3QVN A;  1P84 F;  1NTM H;  4JAV A;  4K0K B;  3RYH B;  2QGN A;  1S5J A;  1A32 A;  4JI0 B;  4CS3 A;  3GB7 C;  3E8B A;  4AHC A;  5DEC A;  5EC1 C;  3BRC A;  2XUM A;  3AK1 A;  5CB4 A;  2P4K A;  4GKK O;  2Q8V A;  4B3S B;  3LDD A;  3QG5 A;  4W4L A;  5LHG A;  3P3N A;  1Q6I A;  2IJH A;  4EKW A;  2ZR2 A;  2EJ7 A;  3SR2 C;  1VMG A;  3GWK C;  1EN5 A;  5HFL A;  4DYL A;  1M56 C;  4CH4 A;  5J2T B;  3KDR A;  2PUS A;  3OAA G;  5KA5 A;  1KBH A;  1EM1 A;  4DUZ O;  1YZB A;  3VOU A;  5FPR A;  3ZS8 C;  1QVG U;  1KP2 A;  3BA9 A;  1RFY A;  4JYC A;  3W7X A;  3AG1 B;  1IX9 A;  1NBM G;  3HPL C;  2UXD B;  3T1H B;  3ETG A;  1WN7 A;  2P5O A;  5E1A C;  4J11 A;  4GKK B;  4LFC O;  4MVO A;  5B1N A;  5IYB O;  4LFB O;  1K5Q A;  3JAW A;  5KX5 A;  3JAR A;  3JCZ A;  3ABT A;  1HNX B;  5J2U B;  4DV5 B;  4R7C A;  1AVM A;  2Y0I A;  2DWD C;  4ZHQ B;  5LGT A;  2A79 B;  3JSN A;  4DV7 B;  3AEI A;  3A2F A;  1QR9 A;  1MSD A;  2Y0P A;  4KL1 A;  1FYJ A;  4O4J B;  4J10 A;  2JDI G;  3JAK B;  1UFI A;  4PA7 A;  2HFE C;  4MTF A;  2YXY A;  1K73 W;  1VQ5 V;  5IT9 N;  1P7G A;  3C90 A;  3TK1 A;  2OCH A;  1K4C C;  2UUC O;  1WNS A;  2YIC A;  3ZMV A;  2F4V O;  3L71 H;  2BTQ B;  2RQ6 A;  4PHZ A;  2Q9L A;  4I9W A;  4G28 B;  1EZJ A;  5BR8 B;  4MVM A;  5GTH Z;  4FVM A;  4DV7 O;  4LNU A;  3SJA C;  1Q7Y W;  2YIB A;  1QLE B;  1B04 A;  1BGY H;  3LSS A;  4PDM A;  2X7R B;  4JF3 A;  5L3C A;  2EIJ C;  1M90 W;  1Y76 B;  4CH6 A;  1XUQ A;  4NR1 A;  3FYI B;  1KYO F;  3CYO A;  4CH5 A;  2VQE B;  3A8T A;  5DM6 V;  2ZXW C;  2Y69 B;  4R50 A;  2UXB B;  1JFF A;  1HNW B;  5EIB D;  1ORQ C;  2F66 C;  2VWK A;  4DR3 O;  1XMQ O;  3JCU Z;  4TT3 G;  2XHB A;  1JCH A;  3N2K A;  3CRM A;  4FPP A;  4TSF G;  2X6B A;  1AJQ A;  1GN4 A;  3M99 B;  1M1K W;  3JAT B;  1JOY A;  4U3J B;  1XMO B;  2GSM B;  2HVJ C;  3G67 A;  4BW5 A;  3STL C;  2DYR B;  5JVD A;  4O2B B;  1AI6 A;  4D7S A;  5CN0 A;  4PA9 A;  3HKE A;  4UCT A;  4X1K A;  4JI4 B;  4LF8 O;  3L73 H;  4ZBM A;  1Y67 A;  2P90 A;  1XDC A;  3W7S A;  4DR5 O;  3ASN B;  1CXZ B;  3A0H Z;  1XHZ A;  4TQF A;  4PV1 B;  3BPZ A;  2IW5 A;  4B7E A;  1SS3 A;  3APQ A;  2VS0 A;  2X6A A;  3C3T A;  3DC5 A;  4X1K B;  5F2V O;  1FKA O;  1ZL8 B;  1GMG A;  2WA3 A;  4U3F H;  4H33 A;  4LH6 A;  2GBO A;  3ML0 A;  2YC0 A;  3C3S A;  4H0L B;  2AHY A;  1N34 O;  1WA8 B;  2ODM A;  4DK0 A;  1YVW A;  1BS3 A;  3RYI B;  2LGW A;  1QQC A;  2EZP A;  5LXT A;  3H01 A;  2ZE6 A;  5BMV A;  3A0B Z;  2GHY A;  3W7T A;  4X62 B;  5L3D A;  1SZX A;  3JAK A;  4X20 B;  4JI4 O;  4DR6 O;  3CC4 V;  4JYY A;  5CA0 B;  1VQ7 V;  5B66 Z;  1R1B A;  5BZB A;  2JEX A;  3T2M A;  5BXZ A;  2EZO A;  4B3T O;  5JWP A;  4DV0 B;  3UM7 A;  4LFC B;  1D5N A;  1SQQ H;  1JNB A;  2GTA A;  3JAS B;  1Y76 A;  3ZN0 A;  4MSW C;  1FJG O;  4OPH A;  3RGB A;  1RP3 B;  2LW7 A;  3OUS A;  2M7W A;  5J2U A;  2N04 A;  4LNU B;  1WLE A;  3H1I H;  1Q82 W;  1LUW A;  4QPJ A;  2DOS A;  2P7T C;  4O4L B;  3CD6 V;  4DV6 B;  2A7W A;  2QM4 A;  4BW9 A;  1H38 A;  1J95 A;  3NR7 A;  3EXA A;  1YJ9 V;  4RQF A;  1OCC B;  2HJF C;  4Q6G A;  1X59 A;  3WB0 A;  3K9A A;  2BSK B;  1VF5 B;  2FL4 A;  2Q4P A;  2OTJ V;  3MHS C;  3X2Q B;  5IWA B;  2KG7 B;  4GZR B;  4X8A A;  3SYP A;  3QO7 A;  4JAU A;  4NYK A;  1ZWI C;  1RM1 B;  1P49 A;  4KP4 A;  1S5H C;  2KSD A;  4X1I B;  2KG7 A;  5B5E Z;  2LJ2 A;  2ITC C;  2ATK C;  4I7Z B;  4DV2 O;  5LMN B;  1L8D A;  4WBN B;  5H9C A;  3CE2 A;  1WJZ A;  2A3Q A;  4E4E A;  2ETN A;  1AP6 A;  1IXB A;  2QWP B;  2E74 B;  4UVC A;  4CS4 A;  2EIN B;  2Q7E A;  3D3I A;  3D8C A;  3ETD A;  1SKV A;  4LC1 A;  3OW2 U;  4LR3 A;  2Q7G A;  5JQG A;  3FFQ A;  5FL7 G;  4LFA O;  3KKY A;  3CEI A;  1HNW O;  1IZ3 A;  2FML A;  2RCV A;  4OPA A;  5CBH A;  2BOC C;  3RW0 A;  1OV9 A;  1VQK V;  1B6Q A;  4ZKI A;  4WFG A;  4FFB B;  4B08 A;  3T4D A;  3ZBH A;  1ZX3 A;  3M7M X;  3HKC A;  5D5Q A;  1K34 A;  1R3I C;  4QJF B;  3Q4H A;  2JGU A;  1AI7 A;  4KHP B;  5LP6 C;  3R65 A;  4FM1 A;  5LXT B;  1RM1 C;  4BIZ A;  3RYI A;  5LL6 Y;  2VQF B;  4UVA A;  3E83 A;  4LFA B;  2VRZ A;  4LFB B;  4LP8 A;  1TVK B;  1H5W A;  4J9Y B;  2Q73 A;  3D36 A;  3EVK A;  4J7Z A;  4X89 A;  1BQ0 A;  4E2L A;  3RN4 A;  3G80 A;  1GKF A;  2WLN A;  2JJ2 G;  4H44 B;  4RO2 A;  4IYI A;  5EBW C;  1FXK C;  1V55 C;  5LYJ B;  3MDS A;  3WU2 Z;  3LNM B;  1YJW V;  3ZX6 A;  4HYO A;  4F6E A;  3TXS A;  1EZV H;  4P9O A;  1NJI W;  4PI0 A;  4FFK A;  4LWS B;  1N34 B;  3JAL B;  2PGG A;  1Y6X A;  4UVB A;  1VF6 A;  3E22 A;  1R3L C;  5KHK A;  2AXT Z;  2QTS A;  4PDL A;  4IL6 Z;  1SER A;  1AP5 A;  4TOI A;  3CP1 A;  3SPC A;  4LF5 O;  1YIT V;  4MTO A;  1BQZ A;  1QBZ A;  2QKS A;  3E22 B;  3ZRW B;  3FB8 C;  3RYF A;  1JFF B;  2NNU A;  3UT5 A;  3ZN1 A;  3OMI B;  2PYJ A;  4J7K A;  2WSS G;  1LR1 A;  1SA0 A;  2N74 A;  4W4K A;  4HBN A;  3CJH A;  3DGE A;  1IVS A;  5ITZ A;  3O9O A;  3ETE A;  4X1Y B;  4B7K A;  1N4C A;  2QKA A;  1N36 B;  3ZHT A;  5LOV B;  3LSU A;  1VP7 A;  3N27 A;  2KB1 A;  2LP7 A;  4I0X A;  3KZI Z;  2QSA A;  2GTS A;  5EC2 C;  5A9G A;  2N05 A;  1NVP D;  1SA0 B;  3CCS V;  5JVD B;  4IT5 A;  1S77 D;  1RSO B;  2BTQ A;  1V55 B;  3NXS A;  1M5I A;  4MVS A;  3WB2 A;  1YEW A;  3IC9 A;  3SYO A;  4Z1M G;  3CCQ V;  1QU7 A;  1S76 D;  1HNZ O;  2XAS A;  3RVZ A;  2F93 B;  2ZE7 A;  1Q43 A;  1YJN V;  4LF7 O;  3HKD B;  4ZI7 B;  3CME V;  2ZNI A;  3ZRS A;  4LWS A;  4EFB A;  3CMA V;  2UXB O;  2ZR3 A;  4FFB A;  2HG5 C;  4JZG A;  2LQT A;  3VQW A;  2UUA O;  1GO3 F;  3K9S A;  4UCO A;  1VF6 C;  1FXV A;  3FAV A;  2UU9 O;  3JD3 A;  2EBO A;  3UO2 A;  2YXL A;  4FK5 C;  5H6Q A;  3U10 A;  5LP6 A;  4DW0 A;  3H1J H;  5EIB C;  3BVO A;  2V7Q G;  1S3J A;  5JJE B;  3W7U A;  4LF8 B;  3I55 V;  1NU1 H;  2EIJ B;  3KCY A;  1XNQ B;  3GWO A;  5LHH A;  4TV8 B;  4QE7 A;  1N0N A;  3LDC A;  4GX0 A;  3RWR D;  2XT9 A;  4WBN A;  2EIL C;  3JAM N;  2OT5 A;  2CK3 G;  2ZDI C;  4PEL A;  4BAY A;  5E79 Z;  1G1X B;  2UUA B;  1K5S A;  3BAA A;  1FPO A;  1Q90 D;  2Q68 A;  1YI2 V;  4ZI7 A;  4DR4 B;  1FFX B;  4RUF A;  1W59 A;  3L74 H;  2H94 A;  4DW1 A;  1QLN A;  4IGG A;  4Q20 A;  2BTO A;  4B3R B;  2P4V A;  3K5N A;  4ZHQ A;  4BR6 A;  3CWB H;  2QDO A;  4GX2 A;  1NTK H;  2D2C B;  1I94 B;  1TAE A;  2WLI A;  3OE7 G;  1DF4 A;  3JYC A;  3TGU H;  4JI7 O;  3TCU A;  4B3T B;  3JAW B;  3OGC C;  1VQO V;  3ZHS A;  3RYH A;  2F23 A;  1V54 B;  2QM8 A;  2ZIO A;  4P2Z A;  1FAF A;  4D6T H;  2IJI A;  1TUB A;  1YTF D;  1AI4 A;  3CCE V;  4O4I B;  2E5L O;  1PV0 A;  1BL8 A;  2PTM A;  3CJH B;  2HJD A;  3H1L H;  5EBL C;  3ASO C;  1NKD A;  4FLX A;  4F6R A;  2WLL B;  3VQX A;  3K06 A;  5IY5 B;  1W0K G;  3CCV V;  2XAJ A;  4N21 A;  5IJ0 B;  4YJ2 B;  1TGO A;  3G71 V;  1TA8 A;  1M4U A;  3BEH A;  1Q8I A;  1YIJ V;  1E1Q G;  1EFR G;  1T5E A;  4OXS A;  3CRR A;  5BMV B;  3Q4H B;  1ROP A;  3SPI A;  2UXX A;  4YHH B;  4DR2 O;  4PI2 A;  1U96 A;  3F5T A;  4GKJ O;  2W0F C;  4D7T A;  2XTA A;  4XDK A;  4P30 A;  4LF4 B;  3B40 A;  1BE3 H;  1R6K A;  3JD4 A;  2E3C A;  1SZT A;  2UUB B;  5KHH A;  5FNV B;  1MZF A;  5LP6 B;  1AR1 B;  3E86 A;  2KKW A;  2QJ1 A;  5EZY B;  1MG1 A;  4C7U A;  2DYS C;  3JAS A;  5GW7 A;  2CTR A;  1N8R W;  4U7O A;  4QE9 A;  2IU3 A;  2L6L A;  3CB2 A;  2B5U A;  2QE7 G;  4DR2 B;  4DRX A;  4YY3 O;  1I08 A;  1PNL A;  3CCU V;  1OCR C;  3HR0 A;  4R6Z A;  1K4D C;  1Z5V A;  2HEP A;  4GKJ B;  3B4S A;  1QHT A;  4DR1 B;  3ABL C;  2UU9 B;  4J7J A;  1GH6 A;  3CCR V;  2CTW A;  3K5L A;  3WG7 C;  4ZOL B;  2GV9 A;  1IBL O;  1MAB G;  3VQV A;  4FM0 A;  4NXN O;  4QIW F;  2BOB C;  2Y4T A;  5CA1 A;  2IJK A;  3UCS C;  1HWY A;  2FYU H;  3DC6 A;  1UPG A;  3ZRX A;  5JH7 A;  3QTC A;  4YY3 B;  3FD9 A;  3PN1 A;  4PD4 F;  1SRY A;  3ZMT A;  4J9Z B;  4WFA V;  4JV5 B;  4L8J A;  3CXH F;  4DK1 A;  2ZKO A;  3ZMZ A;  2ZE5 A;  3RYF B;  3BFR A;  4NTW A;  3H1K H;  4J42 A;  4TUY B;  5LBQ A;  1QCE A;  1QLE C;  1GAX A;  2EUL A;  1KMI Z;  1SQG A;  5FPO A;  4GX1 A;  3LNN A;  3OFN G;  4FMT A;  2GUZ A;  4O2A A;  4OX9 O;  4MVQ A;  1GN6 A;  5IWA O;  3E89 A;  5CMU A;  1IBM O;  1IDS A;  2EX3 A;  3ZMS A;  4TWK A;  1HNX O;  4TV8 A;  1CP9 A;  4JI3 O;  1SF9 A;  2NN4 A;  3N2G A;  5JJN B;  5BY1 A;  4KFM A;  1AR5 A;  2CH7 A;  2JGD A;  5LMN O;  2B1I A;  1JA8 A;  4MVU A;  1S0V A;  4I4T A;  1IBK O;  3ZHQ A;  3ABK B;  4IHJ B;  1RPO A;  1VEW A;  1IJG A;  1VAR A;  2RNB A;  5B1B B;  1DLB A;  4OX9 B;  2ZIM A;  2ZM6 O;  3AK3 A;  2GDS A;  4ICG A;  3HKC B;  3X2Q C;  3W7W A;  5LMU O;  5CA3 A;  4JPR A;  1YHQ V;  3JAT A;  1F4N A;  2WLK A;  4JI2 B;  3B8N A;  1PL4 A;  5IYD O;  5B1O A;  4UCV A;  1AIL A;  4J41 A;  4JAA A;  1MSW D;  4NTX A;  1G6U A;  4RAI A;  3B2E E;  2K1E A;  5CB4 B;  1M93 A;  1NZ6 A;  3H9V A;  1Q6U A;  3CS5 A;  4JYA B;  5KAI Z;  1XNQ O;  4GUN A;  1H2S B;  5LA6 B;  5LOV A;  1THZ A;  4MVR A;  3APO A;  3CRC A;  1OZ0 A;  5LMU B;  5ITZ B;  2HP8 A;  3ZCC A;  2XOK G;  2OCC C;  1Q6H A;  2IH3 C;  2VWJ A;  3IAY A;  3CRA A;  4FLT A;  4JAS A;  3MAQ A;  3QF7 A;  1PD3 A;  1QR8 A;  3UT5 B;  3CX5 F;  3K3W A;  3K5M A;  4U3J A;  3AG3 C;  3B8M A;  2OTL V;  4PA3 A;  1PKX A;  1F7Y A;  1Y66 A;  2EIK B;  2HLD G;  2QKC A;  5IJ9 B;  4FLV A;  1N33 B;  1Q5O A;  1E79 G;  3EFF K;  1QVF U;  1O9G A;  4YJ2 A;  5IJ0 A;  2IM9 A;  3ZJZ A;  4JI7 B;  1G4Y B;  3L70 H;  2WLL A;  2WAM A;  4U7N A;  4LF5 B;  1YSC A;  4UXN A;  1WPB A;  1MZE A;  4HZ3 A;  3IFX A;  1SQX H;  1GRJ A;  1JX9 A;  4UCR A;  2LW1 A;  2DE0 X;  3ABK C;  1BMF G;  3H1H H;  5L3G A;  4GYC B;  2RN9 A;  3ZED A;  4GCZ A;  1SC5 B;  3AK2 A;  3OEH G;  3STZ C;  2IH1 C;  1JJO A;  3TJT A;  3JD2 A;  2CTP A;  2F1M A;  4PA6 A;  1KUQ A;  2BCC H;  3P3P A;  4WFB V;  4R8C A;  4KUM A;  1ENV A;  3CC2 V;  4UCU A;  4MS2 A;  3K03 A;  5GON A;  4TV9 B;  2AW9 A;  2ZD9 A;  1PP9 H;  4HAM A;  5IDJ A;  4QGP A;  2QWQ B;  2UUC B;  2AZ2 A;  2W6I G;  1EBO A;  1DTO A;  2UXN A;  1WPX A;  1SET A;  1URF A;  4YIP A;  3FYE B;  5D5P A;  2EIK C;  4FLU A;  1NVP B;  5BR8 O;  1VF7 A;  2P06 A;  5CBG A;  3AG3 B;  1K9M W;  3R66 A;  2QEX V;  3RYC B;  2DN9 A;  3U0Z A;  1R6T A;  2CDY A;  3OR7 C;  4F4L A;  3OGI B;  2OCC B;  1H2G A;  1XI1 A;  5HFM A;  4LF6 B;  1NS1 A;  1OCZ C;  1IBK B;  5KUM A;  4JI3 B;  5B1B C;  4LF9 B;  3D36 C;  2QA4 V;  5K1P A;  4AQY O;  3OT7 A;  3J80 N;  3N2G B;  1K3E A;  2Q0A A;  1VQN V;  1JVM A;  1R3K C;  2R70 A;  4MTX A;  3K58 A;  2Y69 C;  1H8E G;  3OEE G;  2WLJ A;  1OCO C;  3FAV B;  5KA6 A;  4X1I A;  1QNM A;  4KXR A;  1LUV A;  3AG2 C;  3OTO O;  1S5L Z;  4N23 A;  3SYQ A;  3QO8 A;  2VQE O;  3K0D A;  4MT8 A;  1XQ8 A;  4B3S O;  4JI1 O;  4X20 A;  4NTY A;  5IYZ B;  4O4H B;  3IC7 A;  1N32 B;  5JCO A;  1GN2 A;  1WP8 A;  4DR3 B;  2JVD A;  4AIL C;  3OMN B;  2A9H A;  3SPH A;  3UQ8 A;  4QNH B;  4JYB A;  3OTF A;  4J80 A;  1NR1 A;  3JSL A;  2R72 A;  3OUF A;  3WFV A;  3FX7 A;  2HVK C;  1COW G;  5KHJ A;  1NH2 B;  3O65 A;  1M57 B;  4B3R O;  4FLW A;  1W0J G;  2E75 B;  5JH7 B;  1I94 O;  4JZ2 A;  4DR5 B;  2DQ3 A;  2Z3Y A;  1R3J C;  4K8X A;  1W2B U;  3J7A U;  1GK9 A;  3HKE B;  1N32 O;  4UB8 Z;  5H5N A;  2XND G;  4X62 O;  4JI6 O;  1D2D A;  4DV5 O;  4JV5 O;  2Z5U A;  4DR6 B;  3CSX A;  5CA0 A;  2YS8 A;  5C93 A;  1US6 A;  2JIZ G;  1YCI A;  3B77 A;  4UV9 A;  4YXW G;  3N2K B;  5GTI Z;  2JK5 C;  2YUA A;  2KQX A;  4YJ3 A;  4TV9 A;  3I5D A;  5GON B;  4ZIB A;  3RFR A;  3WG7 B;  2MK3 A;  1JMK C;  5EYP B;  1WA8 A;  3JAL A;  3AG1 C;  3BCC H;  4PJ0 Z;  2LFR A;  2OWO A;  2CGN A;  2PI5 A;  4WFF A;  3JAR B;  5KX5 B;  4X65 B;  2YIA A;  4MW8 A;  1J5E B;  4K8Z A;  5KUK A;  1VQ4 V;  4WFH A;  3DSQ A;  4LH7 A;  4NVP A;  5EZY A;  1AB3 A;  3FB6 C;  5H6R A;  4DV4 B;  4NXM O;  3K5O A;  1BSM A;  4LF4 O;  2K9P A;  3CRQ A;  1I5X A;  2ADQ B;  4ZOL A;  2AZ0 A;  2YEV A;  2F4V B;  5DED A;  1K97 A;  4EEQ A;  4GLX A;  1MA1 A;  2QR4 A;  2D3O W;  4EFE A;  1GM7 A;  3RVY A;  2ARH A;  1NQT A;  2AGA A;  3SJQ C;  2EJR A;  3U11 A;  5KMG A;  3ABM C;  1YTF B;  1K7D A;  4MVZ A;  2ZT9 B;  3ASO B;  4DRX B;  4YIO A;  3SPG A;  1N36 O;  2QTO A;  1H8H G;  4LF6 O;  2QWR B;  2H8P C;  3A0R A;  4JI2 O;  4JI5 B;  4LBE C;  1KEC A;  4Z1V A;  2B9Z A;  4IIJ A;  1AR4 A;  5LHI A;  2XAF A;  3E35 A;  5J9P C;  1CEZ A;  4X66 B;  4O4I A;  2A0L A;  2Q69 A;  4AQY B;  2V4D A;  1DF5 A;  4X64 B;  2ILM A;  2UXC O;  3K79 A;  3GVM A;  5L3B A;  3OR6 C;  3AG4 C;  1PNK A;  4NB5 A;  4JYA O;  1M9N A;  2F95 B;  5B1A B;  3S3W A;  2Q5Z A;  4CC5 A;  1AI5 A;  2HHH B;  4LF9 O;  4CZZ A;  4B3M B;  2WLH A;  3OMA B;  3CCM V;  1D5A A;  4HNA A;  4DO2 A;  3L72 H;  2DQ0 A;  3KG2 A;  5KAF Z;  1N33 O;  4OGQ B;  3P32 A;  1F23 A;  4RUE A;  4IYH A;  5A2Q N;  2Q7H A;  1XRE A;  2YI8 A;  1NTZ H;  4O4J A;  4X88 A;  2YEV B;  3ABM B;  1WAZ A;  5KHI A;  4KHP O;  2DYS B;  2ZQM A;  3KCX A;  2PI4 A;  1PNM A;  2NR5 A;  1VQ6 V;  3UO3 A;  4FLZ A;  4JI0 O;  1BZK A;  3ABL B;  5JQG B;  1K92 A;  5LA6 A;  1ZUQ A;  2VQF O;  4I9Q A;  4O4L A;  4DV0 O;  2HKO A;  4DUY O;  4I55 A;  1L0L H;  1Y74 B;  1ARO P;  1DGS A;  4BIU A;  1DK1 A;  4YJ3 B;  1FXH A;  4I50 B;  2JJ1 G;  3AG4 B;  4DV1 O;  2CE4 A;  2FTK A;  3SJB C;  1GM8 A;  5J2T A;  4H13 B;  2JS3 A;  1OCR B;  2YXH A;  3K59 A;  1FXK B;  4K3A A;  1SQF A;  4CC6 A;  2XAH A;  3SYA A;  2UXD O;  2BSK A;  1HR0 O;  2IU0 A;  4GX5 A;  2NLJ C;  3CPW U;  2IBZ H;  2PYL A;  4IHJ A;  4EB6 B;  4I50 A;  1ZLZ A;  3IJ4 A;  2P67 A;  3LSQ A;  4JTD B;  3FB5 C;  5B3S B;  2Q6A A;  1BHA A;  2DWE C;  1SQP H;  2ZIN A;  2CH7 B;  1Y74 A;  2B1G A;  1ZAU A;  1ZL8 A;  5DN6 G;  1KD1 W;  4X9Q A;  3TXQ A;  2R9A A;  2A06 H;  2Y48 A;  3SPJ A;  4I0X B;  3ZHU A;  3DXR A;  5B3S C;  3B09 A;  1XNR B;  4JTA B;  4DR7 O;  3BA8 A;  1LNQ A;  2JRI A;  1OHH G;  5CA1 B;  4ASU G;  3F5W C;  1SQV H;  3ICX A;  1WP7 A;  3OTO B;  3VBB A;  2P6J A;  1V9P A;  4A5U B;  4O2A B;  2WPD G;  3CXC U;  3E2E A;  3LUT B;  4JI1 B;  2E76 B;  1GTO A;  2MW2 B;  3ZRW A;  2CGO A;  2CUG A;  5IY5 C;  3HKD A;  1H2M A;  2DYR C;  4NKG B;  3K0G A;  4XBF A;  1I0H A;  3PJS K;  4ABM A;  2EIM C;  2QM7 A;  3QO5 A;  2EIL B;  5K1X A;  2XAQ A;  1KKC A;  2YI9 A;  1X4T A;  2YDE A;  1FD9 A;  4JI8 O;  2WLM A;  1SQB H;  3MHH C;  1IUR A;  3CCJ V;  2Y4U A;  1EN6 A;  3E8G A;  3AG2 B;  4X64 O;  4DR7 B;  2F43 G;  4I55 B;  1Z2G A;  1N0J A;  4PDV A;  1VIB A;  2HHH O;  4FZ1 A;  4Z2W A;  1BT8 A;  1I5Y A;  3DXR B;  4X1Y A;  1XL4 A;  3HB3 B;  4G27 B;  3M8A A;  3ZHV A;  1VQM V;  4XDJ A;  1XEQ A;  1MOF A;  1VQ9 V;  4QPK A;  4IIJ B;  4LCU C;  4FZ0 A;  5AG2 A;  5LGN A;  1JQ0 A;  2ZNJ A;  4DR4 O;  1MMM A;  3WB1 A;  2DMX A;  4EB6 A;  2RMK B;  4JI8 B;  4RWU A;  3UKM A;  1L0N H;  2H3O A;  5JJJ B;  4DUZ B;  1BHB A;  5C8Y B;  4AI8 A;  4NXN B;  1V54 C;  3QNE A;  1YDX A;  2RJZ A;  3FB7 C;  4UFZ A;  2CAZ C;  1I7F A;  1S72 V;  3E8H A;  3T1H O;  2BE3 A;  1Q81 W;  2CTQ A;  3LDE A;  5EBM C;  4DV3 O;  1NR7 A;  4H37 A;  2EIM B;  5LYJ A;  1OCC C;  3G4S V;  2OIG A;  4GT1 A;  1TUB B;  3JD0 A;  3T1Y O;  5FNV A;  4UB6 Z;  2PY5 A;  2E5L B;  2DW4 A;  1WB7 A;  4X65 O;  1R73 A;  1TVK A;  4K35 A;  4DUY B;  4DXW A;  1B06 A;  3D3Q A;  2WLI B;  1M57 C;  3ZRV A;  4CH3 A;  4DV4 O;  4NXM B;  3RYC A;  3K04 A;  4CS2 A;  1VQL V;  4I5S A;  5LGU A;  1CPY A;  1P4R A;  3K08 A;  3VQY A;  2W6J G;  3F7Y C;  4YHH O;  2LO1 A;  5C8Y A;  2ADP A;  3BY6 A;  1E1R G;  3T4Z A;  1NI8 A;  1K8A W;  4DV1 B;  1FFX A;  3OD4 A;  3S3X A;  5KHG A;  5EK0 A;  4FIP C;  3ZHR A;  1HNZ B;  2PZS A;  1IXM A;  1H2K A;  4WCE V;  4LF7 B;  4UUJ C;  5TIS Z;  3BHP A;  2FB5 A;  1KB9 F;  1L1F A;  5KLV H;  2UXC B;  2OIE A;  5H2F Z;  1JJ2 U;  2WA4 A;  2JGD B;  1U97 A;  2ZCE A;  1PL0 A;  4CBC A;  1H2N A;  1XL6 A;  2FKX A;  4X66 O;  2UUB O;  3L75 H;  2QWN B;  2RDC A;  1HW7 A;  2LFS A;  3FKS G;  2O57 A;  3T1C A;  5EYP A;  1BCC H;  3SYC A;  2R9R B;  3ETQ A;  2R9I A;  1KC8 W;  1KKD A;  1OCO B;  1Q86 W;  1PM9 A;  4B3M O;  5IYZ A;  4DV2 B;  1KP3 A;  1P7B A;  5L3E A;  3G6E V;  1R6N A;  2YIB D;  1AJN A;  3JD1 A;  4BWA A;  1IBL B;  2M6Y A;  4JI6 B;  3K57 A;  1F51 A;  2DJV A;  1YF2 A;  4HNA B;  2OYQ A;  2AHZ A;  2PF4 E;  4WFE A;  3L9D A;  2HR3 A;  3OM3 B;  5IYC O;  2ZXW B;  4FJC C;  1XBL A;  1H2L A;  1SES A;  1G8M A;  1M56 B;  2IJJ A;  3ZIA G;  5CBF A;  1TUE B;  3EHB B;  1NT2 B;  3P30 A;  2V1D A;  2ITD C;  4FM2 A;  2WWW A;  4TQD A;  1XIL A;  4P9P A;  1J5E O;  1OCZ B;  2YID A;  5B1A C;  4WF9 V;  4MTG A;  1HDJ A;  2QWO B;  1WB8 A;  2W0X A;  4O2B A;  2X0L A;  3I56 V;  4MW3 A;  2C2A A;  2JEU A;  2YSU B;  5KMG B;  3G6B A;  1K33 A;  3RBZ A;  3HKB B;  3HKB A;  1GM9 A;  4TUY A;  4UCS A;  1IBM B; 
#chains in the Genus database with same CATH homology
 2CDY A;  1MMM A;  3AK1 A;  1ZLZ A;  3KKY A;  2P4K A;  3CEI A;  1SZX A;  1GN6 A;  4JYY A;  2RCV A;  4C7U A;  1IDS A;  2QKA A;  1EN5 A;  3LSU A;  4X9Q A;  1D5N A;  3OT7 A;  2QKC A;  1XUQ A;  3KDR A;  1I08 A;  1AR5 A;  1EN4 A;  4BR6 A;  1PM9 A;  1EM1 A;  5A9G A;  1XRE A;  1MNG A;  1JA8 A;  1JR9 A;  1QNM A;  1LUW A;  1LUV A;  3IC9 A;  1BSM A;  1IX9 A;  1VEW A;  1VAR A;  1WB7 A;  1GN4 A;  2ADQ B;  1GN2 A;  3AK3 A;  2GDS A;  1I0H A;  3EVK A;  1ZUQ A;  1B06 A;  3AK2 A;  3RN4 A;  4JZG A;  1AVM A;  1MA1 A;  3DC6 A;  1KKC A;  3TJT A;  1PL4 A;  1GN3 A;  3K9S A;  1EN6 A;  3MDS A;  1Y67 A;  1XDC A;  1MSD A;  2ADP A;  1ZSP A;  4F6E A;  1ZTE A;  4YIO A;  2AW9 A;  1XIL A;  1N0J A;  3DC5 A;  3C3T A;  4FFK A;  4JZ2 A;  1BT8 A;  2CE4 A;  3BFR A;  1WB8 A;  1AR4 A;  1AP5 A;  3C3S A;  3QVN A;  4GUN A;  4YIP A;  4E4E A;  1P7G A;  1AP6 A;  1BS3 A;  1IXB A;  1N0N A;  5AG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...