1MSDA

Comparison of the crystal structures of genetically engineered human manganese superoxide dismutase and manganese superoxide dismutase from thermus thermophilus. differences in dimer-dimer interactions.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Comparison of the crystal structures of genetically engineered human manganese superoxide dismutase and manganese superoxide dismutase from Thermus thermophilus: differences in dimer-dimer interaction.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase (superoxide acceptor)
total genus 67
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1992-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1msdA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1msdA02
2AW9A 5A9GA 1GN2A 3TJTA 3C3TA 4BR6A 1EN4A 3K9SA 4YIPA 1LUWA 1BS3A 3KKYA 3AK3A 1AR4A 3C3SA 4JYYA 3MDSA 1IX9A 1LUVA 1N0NA 1XDCA 4JZGA 1AR5A 3AK1A 1I0HA 2ADPA 1IXBA 4C7UA 1P7GA 2QKAA 4FFKA 1ZTEA 3OT7A 1EN5A 1VEWA 1IDSA 1ZSPA 1AVMA 3IC9A 1PL4A 1I08A 2GDSA 1GN4A 1VARA 3QVNA 3RN4A 1AP6A 1AP5A 2CE4A 1QNMA 3CEIA 2P4KA 2RCVA 1EM1A 2ADQB 1SZXA 1Y67A 4GUNA 1PM9A 3DC6A 1ZLZA 4YIOA 1BT8A 1EN6A 1MSDA 1JA8A 4X9QA 1KKCA 1N0JA 4E4EA 1JR9A 1ZUQA 3EVKA 3LSUA 1MA1A 1XUQA 1BSMA 2CDYA 1XREA 1GN3A 1B06A 3DC5A 2QKCA 3AK2A 1XILA 5AG2A 1WB8A 1WB7A 1D5NA 3BFRA 4F6EA 1MMMA 4JZ2A 1MNGA 1GN6A
chains in the Genus database with same CATH superfamily
1SKVA 3RYHB 2WLHA 3CJHB 5FLXN 1FAFA 1R6KA 3LDCA 4FLWA 3ZRVA 3OTOB 5LP6C 3CCEV 4I4TB 3RFRA 4OPHA 1CXZB 4UCOA 4N23A 3ASOB 4YIPA 4UVCA 1PKXA 3SJAC 1DK1A 1E79G 4W4KA 1XL4A 4NTWA 3CHXA 4QPJA 4CZZA 2B5UA 3E35A 3AK1A 4O4IB 2ADPA 1AI5A 1S72V 4X64B 4C7UA 3CCMV 2CH7A 1ZTEA 2YEVB 2VQFO 4UVAA 5CMUA 4J80A 1TUBB 4DR6O 3OW2U 4K3AA 3HKCA 4FPPA 3CRRA 3EXAA 3N2GA 4MTGA 1YIJV 2YI9A 3ZHUA 4DR2B 4DYLA 4HYOA 3ZRWA 3K5MA 3FD9A 1FXVA 4CH5A 3QO5A 5IYZB 4JI7O 4WF9V 2Q9LA 5KHKA 5D5QA 2WLLA 2XASA 3IFXA 4DV5O 4JI8O 3LNNA 2LW7A 2QTSA 3HKEA 1VQMV 1OCRB 1RSOA 3JAMN 3CCQV 1XNQO 1M90W 4LFBB 5JCOA 4JI4O 3C90A 3AK2A 4XDJA 3ETDA 3OMAB 4FFBA 5HFMA 4WFAV 1YVWA 2LW1A 3MHSC 4LCUC 1MSWD 2A0LA 2BCCH 3RYCB 1U97A 3UO2A 3E86A 1H2GA 2E76B 3T1CA 4PDLA 1S5HC 4DW1A 3NR7A 3C3TA 1SA0B 3TGUH 2ZE5A 4CS3A 2F43G 4TV9B 4WBNB 3I5DA 1FFXB 3OEHG 2ZIMA 3EFFK 3FFQA 3MDSA 4FLXA 2UUCB 4Q6GA 1YJ9V 1M57C 4DR5O 2ZE8A 2DN9A 3KZIZ 2MW2B 4DR3O 1FD9A 3APOA 2ZR2A 4IL6Z 4DV0B 2UUBO 3OD4A 4B7EA 3ZMUA 3ABMB 4X65O 1NBMG 4K0KO 2GDSA 3KCYA 4DV4O 4F6RB 1VQPV 4DUZB 4DR1B 3H9VA 4JI5O 5FL7G 1ZL8A 2LGQA 1WP8A 1JPXA 4DR7B 3AG2B 1JX9A 3K9AA 4JI6O 3BAAA 2UU9B 4D7TA 1SZXA 1Y66A 4MVQA 1Q90D 2X6CA 5EZYB 4DV6O 3G80A 2LP7A 1TA8A 4LF6B 4LF9O 5LA6B 4RWUA 3RGBA 5KX5A 4KHPO 5EC1C 1QVFU 4H44B 3JD3A 4D7SA 1M5IA 1NI8A 4B3SO 1KECA 2AZ0A 2GV9A 2IBZH 4K8ZA 3JCZA 1KP3A 5IDJA 3MD0A 4PV1B 1GH6A 1MA1A 4BW9A 4GYCB 2ZKOA 3OTOO 1K4CC 2JVDA 3L70H 1D5AA 1XILA 4MVOA 1O9HA 3CRAA 4MVSA 1RPRA 1N33O 5LL6Y 1FS0G 2QJ1A 2HJDA 4MTOA 3SJCC 1YSCA 1N34O 3TJTA 5DEDA 4TQDA 1EN4A 4EB6A 1LUWA 4X1YB 3RW0A 2RDCA 5B1BC 1I5XA 2ZE6A 1W0KG 5IYBO 1BQZA 2QWPB 4J9YB 3N2KB 3L75H 3ZN0A 1IXBA 1YXBA 1EN5A 4DR2O 1GKFA 1WA8A 3A8TA 3I56V 4G2KA 1YCIA 2Y4UA 5EYPA 1GMGA 3O9OA 3JD2A 5C8YB 3B2EE 2DYSC 1K9MW 2Y0PA 1A32A 2WPDG 1XMOO 4GX2A 4B3RB 3U11A 1K33A 1U96A 3QTCA 1V55B 1AP5A 2MK3A 3AG1B 1GM7A 2E3CA 4Q20A 3K5LA 2N04A 3RYIB 4DK0A 2DYRB 4IHJA 3Q4HA 2BTQA 2P7TC 1LNQA 4PI0A 3D3IA 2IU0A 1BT8A 3CCVV 3QO8A 1S3JA 2VQEB 1NH2B 1KB9F 2P06A 4FLVA 2WA3A 2PF4E 3K04A 2ITCC 4HNAA 2GHYA 2KB1A 1OCZB 5H6QA 1B06A 2QKCA 3W7WA 5EBLC 5FNVA 1BCCH 2BOBC 3P3NA 5IJ9B 3GWKC 3OTFA 4JI1B 3CWBH 3E8GA 2EIKC 2UUCO 4EKWA 1B6QA 5GONA 1KC8W 5J2TB 1L0NH 4DV0O 2GTAA 4DV3O 3G67A 1XOUA 4ZI7B 4U3JB 4GX1A 2LFRA 4U7OA 1G1XB 3A0HZ 2M6YA 4RUFA 3ML0A 5D5PA 4GX0A 4WFEA 2XOKG 3E8HA 3JALB 2QSAA 3OE7G 4DR1O 1ZAUA 2EILB 4DXWA 4PDVA 5BY1A 3B09A 3F5TA 1XQ8A 1NH2D 1VQLV 3CB2A 4B08A 3BCCH 2QM8A 3HKDB 1GRJA 1PL4A 2UU9O 3UT5A 2V1DA 1UFIA 5KUKA 2JIZG 4QJFB 5CBFA 4LF6O 4P2ZA 3SYCA 4F4LA 4PDMA 3ETEA 1S5LZ 4LF5B 1N4CA 1JJOA 1Q6IA 2GBOA 2HVJC 5CB4B 5CA0B 4EFBA 4UCTA 3E8BA 4OX9O 1N32B 4DV7B 1QLNA 1PD3A 3U0ZA 4NTYA 1XI1A 1UPGA 3X2QC 4I55A 3ZBHA 1QBZA 2XUMA 4YY3B 2YIAA 5FPOA 5LXTA 4JAAA 3TCUA 4WFFA 1YTFD 1F23A 4FVMA 1HWYA 2FL4A 3LDDA 2ZD9A 1LR1A 3WG7B 4LWSB 1TUEB 3K0GA 2NNUA 4R50A 1P4RA 2ZIOA 1E1QG 3A2FA 2Q73A 3UKMA 3BA8A 1AJQA 5AG2A 2OYQA 4J10A 2EIJC 2XAFA 2R9AA 3W7TA 2ZXWC 4KL1A 1CP9A 1KBHA 2GSMB 4GLXA 2Q68A 4JI7B 3WU2Z 1EBOA 2ZDIA 5H9CA 4DV5B 4UCSA 1IBLO 2HFEC 1AR4A 2IJIA 5IE9A 2PI5A 2JJ1G 3ABKB 4B3RO 2WAMA 1P7BA 3VQYA 1SRYA 3IC9A 2CUGA 1FXKB 2XAGA 3ASNB 3B77A 4IIJA 1V54B 1B04A 4O4JB 1KUQA 4TV8A 1VARA 3CJHA 3CMAV 2ITDC 2O57A 1WNSA 2BSKB 4X20B 1AP6A 5F2VO 4I4TA 2YS8A 2VQEO 2ZR3A 3TXQA 4BW5A 5LMNO 5LGTA 4EEQA 3P30A 2Q8VA 1YJWV 1P49A 4AI8A 1NKDA 1H2SB 1PM9A 3O65A 4O4IA 1P84F 1T5EA 4O4HA 1YHQV 4JI1O 2YEVA 2Q67A 3GVMA 4GX5A 2XAJA 1TUBA 3SPIA 1FKAO 4PA9A 2ZDIC 2CDYA 3FAVB 4X65B 5DN6G 2LFSA 4HZ3A 2NR5A 3CCUV 3F5WC 3IAYA 1S5JA 1D5NA 1HNXB 1W59A 3SJQC 4JI5B 1HP8A 4MVUA 4ZOLB 1GM8A 2IH3C 3L9DA 3CS5A 1IVSA 4MW3A 5IYZA 3WFVA 1BZKA 1H8EG 1VQ6V 5CBHA 1MZEA 3FKSG 4DV6B 3K9SA 4LF9B 2EJ7A 2Q5ZA 4O2BB 3WB0A 5GW7A 2N74A 1IX9A 1OJHA 3SR2C 4B3SB 4UVBA 2V7QG 2JGDB 4PA6A 2R72A 3BA9A 1GO3F 4LF5O 4DV2B 1YZBA 1PP9H 3BHPA 2P5OA 4TQFA 4TT3G 4ZHQB 1VQ4V 2A9HA 2YICA 4LH6A 1OHHG 4AQYO 1N32O 4DV7O 2WWWA 2KKWA 4MTFA 5TISZ 4CC6A 1GAXA 2AHZA 5J2UA 3OUSA 3RYCA 1NTMH 1V9PA 1N33B 1X59A 1URFA 3SYPA 1FFTB 4PHZA 4YY3O 1Q7YW 1SA0A 3H01A 3K59A 3ZMVA 1N34B 4NYKA 2ETNA 4TV9A 4O4HB 4WBNA 1F4MA 2L6LA 1FFXA 1SQBH 2IU3A 1BHAA 4JV5B 1KU9A 3FB6C 4GUNA 5LP6B 1G4YB 2EZPA 2QR4A 1ZLZA 4FIPC 2Y69C 5LYJB 4B3MB 2DMXA 2C2AA 5B3SC 3STZC 1ZUQA 2HLDG 1SQVH 4YJ3B 5CA1B 1M1KW 1XUQA 1VF7A 2H3OA 4CBCA 4F6RA 3CCSV 2QWOB 2X7RB 3AG4B 5JWPA 3TK1A 1OZ0A 1US6A 2IJJA 4GT1A 1Z2GA 1XMOB 3LUTB 4TSFG 5GTIZ 3D3QA 5L3CA 1M56C 5BMVB 4CS2A 5EZYA 2IH1C 5K1PA 3BY6A 2UUAB 4BWAA 2CTPA 5LA6A 4NKGB 3UCSC 3M7MX 1YDXA 1R6TA 2Y4TA 3G6EV 4CC5A 2QKSA 3ABUA 1NTKH 2XTAA 5DM6V 5J2UB 2Q4PA 4FJCC 3MAQA 1ZSPA 4HAMA 2F4VO 5B1AC 5JVDB 2KQXA 5LHIA 4NTXA 1NTZH 3WB1A 2EIMC 3OEEG 3VOUA 3ABMC 3R65A 2UXCO 4X1YA 4DV3B 3K08A 5B1NA 4DW0A 1EM1A 2LO1A 1R3IC 4JI2O 2EULA 4MSWC 1VQ5V 3JATB 3N2KA 3RVZA 3H1HH 5LMUO 1SS3A 5KHGA 1HNXO 4LFAB 3D36A 3T4ZA 3SPCA 1K7DA 4FM0A 2PGGA 1BQ0A 5IWAB 1M57B 5HFLA 2XAHA 2YIBD 4XDLA 5C8YA 4DUYB 1FJGB 1PV0A 5JCOC 1K34A 3HKBB 3P3PA 1PNLA 4UXNA 3T4DA 5H6RA 3JAWB 4UCRA 1K92A 1NVPD 3WB2A 1QLEC 3RYIA 3JYCA 3SJBC 1XL6A 5E79Z 1RP3B 4OX9B 1AILA 1K8AW 3SYOA 5KA6A 4DV2O 3H1JH 3PJSK 2DJVA 3JASB 2XNDG 3KKYA 1JNBA 1SC5B 3BABA 1K5SA 4JYYA 1VQ9V 1D2DA 2OTJV 2XT9A 4AILC 3M99B 1NQTA 2M7WA 2JRIA 1XDCA 2L35A 4Z1MG 3A0BZ 2LGWA 4H37A 4UV8A 4R7CA 3JCUZ 2WLJA 2P6JA 4Z1VA 3FB5C 2R70A 2DWEC 3RYFB 1F4NA 3LDEA 4J9ZB 5IJ9A 1PL0A 1NZ6A 1JQ0A 2N05A 2IW5A 1K4DC 3SPGA 3SYAA 5IT9N 1HNWO 5KHJA 4BIOA 4JV5O 2BE3A 4FMTA 3D8CA 4JI0O 3VQWA 1M4UA 3JSNA 1JFFB 2QM7A 4B3MO 3OGCC 3J80N 3E22B 1Q81W 4QNHB 5J2TA 3ZEDA 1NR1A 2Q0AA 4ZI7A 2JGUA 4U3JA 2ZT9B 3L74H 2KG7B 2GTSA 5JH7B 5IJ0B 1IBLB 1W2BU 2FTKA 2W0FC 1Q86W 2VWJA 1NR7A 3JALA 3UQ8A 2UXNA 3ZX6A 1JA8A 4QPKA 1QVGU 2G38A 5B1BB 2E5LO 3CXCU 2DE0X 5ITZB 3HKDA 2HHHO 1HNZB 2F23A 2CTWA 1H5WA 3SPHA 2IM9A 3RVYA 4DR4O 3W7SA 2UUAO 1F51A 4RO2A 3CMEV 3E89A 5KAIZ 2ZQMA 3T1HO 4QE7A 5CB4A 5CA0A 4JTAB 5IY5C 1OCCB 2DYSB 1M93A 3ABLC 2JEXA 5LMNB 2EINB 2ODMA 4BR6A 3FYEB 3S3XA 4JPRA 4UUJC 3FB8C 3HPLC 4L87A 4WFGA 1L1FA 4LWSA 1DLBA 3QO7A 4GCZA 2CAZC 2P67A 4BAYA 4RQFA 3TXSA 1P7GA 4P30A 4FLTA 3K79A 3L71H 4O4LB 4KUMA 2WA4A 4G28B 1NU1H 4I9WA 5LOVB 2QEXV 2YSUB 5EBWC 1YTFB 1TGOA 5J9PC 3ZHVA 3R66A 2JEUA 2A7WA 2IJHA 1MG1A 2RN9A 2QWNB 1K73W 4LFAO 2UXBO 2OIGA 5IWAO 4X62B 1YITV 1HDJA 4PJ0Z 1DTOA 4KP4A 4DUYO 1FJGO 4JI3B 4FK5C 1RM1C 1J95A 1ZWIC 2OCCB 1EFRG 2RMKB 4ABMA 1MSDA 1KKCA 1BMFG 3CYOA 1VF6A 1N0JA 4LNUB 3J81N 1Q43A 1JR9A 3K58A 3QNEA 1FXKA 3DTUB 3VQXA 4O4JA 3VBBA 4AQYB 4FM2A 4X89A 2Z0AA 2ZE7A 1WB8A 2BSKA 1IBKO 4X20A 4N21A 2LJ2A 1Q6HA 4JZ2A 4DV1O 3KCXA 1KKDA 1KQSU 5A9GA 2B1IA 2ATKC 1MZFA 2BTOA 4J11A 1S76D 1IZ3A 1XBLA 4WFBV 2BOCC 3AK3A 1GTOA 4X1KB 4RQEA 1YF2A 1FOUA 4R8CA 3X2QB 1AR5A 1I0HA 3B8NA 4J7KA 3T2MA 4P9PA 2UXDB 3ZIAG 3FAVA 4H13B 1JCHA 4L8JA 5EC2C 4X66O 3OGIB 2FYUH 3ZHSA 1VP7A 3NXSA 2PY5A 2EJRA 2JJ2G 2YIDA 1Z5VA 2ZM6B 1G6UA 4ZOLA 4YJ2A 1HW7A 1TVKB 1SQPH 5KA5A 4WCEV 4R6ZA 3K5OA 2CE4A 3ASNC 2YXYA 3E2EA 1QR9A 5L3FA 1VMGA 1E1RG 2ZXWB 1CPYA 4DK1A 4O2BA 1HNZO 2AGAA 3BPZA 4NXMO 3JARB 3ZMSA 5LGNA 2HEPA 3RBZA 1NT2B 5JQGB 2ZNIA 2JGDA 4FLYA 1DF4A 3CC2V 4K35A 2VRZA 4UV9A 4YHHB 5DECA 4FZ1A 1S77D 3CD6V 4B3TO 4ZHQA 4OGQB 4LR3A 4TUYB 3GB7C 1WN7A 2F4VB 1BSMA 3AG3C 3H1IH 1Q3EA 1XREA 4PA3A 3DC5A 1WB7A 1Q5OA 1VF5B 1MNGA 1GN6A 4PD4F 2Y0IA 2HP8A 4ZBMA 4JYAB 2GUZB 2AW9A 2UXCB 2CTRA 5FPRA 1GN2A 5B1OA 1SQQH 5LP6A 4FM1A 4LF8B 5LYJA 3T1YB 4JI2B 2XAQA 3C3SA 5LMUB 1B3QA 2YXLA 2JS3A 4PA4A 1WJZA 1XMQB 4MTXA 4YJ2B 4JTCB 4YJ3A 5CA1A 1VIBA 4FFKA 3THOA 1AJPA 1OCOC 1WPBA 2JDIG 2ILMA 1YJNV 2HG5C 5KMGB 4X62O 3UM7A 4X1IB 1H2NA 4JI3O 3JD0A 5E1AC 3VQVA 1IBMB 3DGEA 5BMVA 2KSDA 4O2AB 4HBNA 3CCLV 3ASOC 1ENVA 2DQ0A 1QNMA 4G27B 2RCVA 1AI6A 3ABTA 4TOIA 4LF4B 5BXZA 2RQ6A 4J7ZA 3HR0A 2QM4A 2YIBA 4H0LB 1WAZA 4YIOA 1K3EA 2WLNA 1EN6A 1H2MA 3DSQA 3UO3A 2Q6AA 4D6TH 2QTOA 1Q82W 2OWOA 4IYHA 5KLVH 2QWQB 2QA4V 3JD1A 5JVDA 3JAKA 1AI4A 1HNWB 3IJ4A 3OM3B 1DF5A 1Y74B 4JI0B 1QHTA 2Z3YA 1S0VA 1MOFA 3APQA 2W6IG 3AG4C 1O9GA 1ORQC 3M8AA 3OAAG 2UXDO 2EZOA 4CH3A 4PELA 3JATA 4P9OA 4DRXB 1BS3A 3ZHTA 4I0XB 3DXRB 3F7YC 3CXHF 1SQFA 2R9IA 1OCRC 2ZM6O 2E5LB 1KD1W 2A79B 4JZGA 2V4DA 3CC4V 1Y76B 1PPJH 2Y69B 2WLIB 2HHHB 2QKAA 4PI2A 3HKBA 2K1EA 4I5SA 1M9NA 5B3SB 4I50B 3LNMB 1IDSA 3JAWA 1XEQA 4JYCA 4DR4B 2YUAA 1N36B 2DOSA 3T1HB 1GN4A 2Q0OC 3SDLA 4WFHA 2FMLA 3SGIA 4ZKIA 2X0LA 3FX7A 4H33A 1VQ8V 4YHHO 3E83A 3JASA 4J42A 1DGSA 3CEIA 2P22C 3W7XA 1IXMA 1NVPB 1Y4MA 1Y67A 3CPWU 3LSQA 5KHHA 2JS5A 3JAKB 1M56B 3JD4A 2ZCEA 2Q7EA 1L8DA 3H1LH 1R3JC 2ZNJA 1K97A 4X9QA 1QR8A 4JASA 5KHIA 1YEWA 2CGNA 3RYFA 4JYAO 3LSSA 2FKXA 4X8AA 2YC0A 2CH7B 3CRQA 3EHBB 4J41A 4LF8O 3T1YO 1JFFA 3TETA 1BL8A 4FZ0A 3E22A 3AG2C 2FB5A 1HR0B 5B1AB 1YI2V 1H2KA 3HKCB 1H2LA 3CRMA 1IURA 3B4SA 2KG7A 1XMQO 2UXBB 5JH7A 5IJ0A 3N2GB 2A06H 2EIMB 4NB5A 3ZHRA 3SPJA 3CX5F 1MABG 1SERA 3K3WA 4LFCB 3ZRWB 4QGPA 1BGYH 2X6AA 3K5NA 4FLUA 1SF9A 4DO2A 2K9PA 4PDRA 2WLLB 2HJFC 1G8MA 5ITZA 2UXXA 3E8FA 2HVKC 4I9QA 4QIWF 1IBMO 5LBQA 1K5QA 4NVPA 5IYCO 3CCRV 3HKEB 5EBMC 3ZRSA 4LF7O 1RSOB 1NS1A 4MVRA 2PTMA 4LF4O 1IBKB 5LHGA 4DV1B 2QE7G 4Z2WA 3QVNA 1VQOV 5B5EZ 4FFBB 4MS2A 3ZMZA 3W7UA 1QU7A 5EIBC 3G6BA 2E74B 4UB6Z 1QLEB 3B8MA 1XHZA 2P4KA 4KFMA 3F7VC 1R73A 4LP8A 5JJNB 4K8XA 4GKJB 4CH6A 4XBFA 3D36C 2B9ZA 4IYIA 2NLJC 1Y6XA 1ZX3A 2W0XA 5H2FZ 4O4LA 1XNRB 4E4EA 3CE2A 3GWOA 1H38A 3KG2A 5LOVA 2CGOA 4B7KA 4X64O 4X66B 5CA3A 3OR7C 5L3EA 3P32A 2RJZA 5CN0A 1V55C 3AG1C 3BFRA 2PYJA 1XHXA 1R3LC 4F6EA 2ZINA 4ZIBA 4NXNB 4JYBA 4J7JA 2DYRC 3STLC 3ETQA 2DQ3A 1ZL8B 1FYJA 3FB7C 4NXMB 1AI7A 3AG7A 4MW8A 1WLEA 2PUSA 1JMKC 3BEHA 1N36O 5L3GA 1SESA 2F95B 1OCCC 4LH7A 4LNUA 1QCEA 2EINC 2NN4A 1JVMA 4B3TB 2Q7GA 5KX5B 1OCZC 4BIZA 3CCJV 4YXWG 3KDRA 3FYIB 1I94B 5L3BA 1KMIZ 1VEWA 1X4TA 4LFBO 1I08A 3A0RA 4KXRA 2OIEA 2DW4A 3OFNG 5JJJB 1CEZA 1BE3H 3L72H 5LHHA 5EIBD 3RN4A 2F93B 3OMIB 4I7ZB 2IJKA 2OT5A 4TWKA 2WSSG 2HR3A 3MHHC 1SZTA 5IY5B 3J7AU 2A3QA 1KP2A 4X1KA 3ABLB 3H1KH 1R1BA 1FXHA 5BR8B 3DC6A 4FLZA 2E75B 2EILC 2F1MA 4U3FH 4EB6B 5EK0A 4MT8A 2QDOA 4GKKB 1WPXA 1W0JG 1I5YA 1HR0O 4ASUG 3HB3B 1WP7A 2R9RB 4BIUA 2F66C 2YXHA 2EIKB 4E2LA 1PNKA 2OCCC 3AEIA 4W4LA 1TVKA 4RUEA 5C93A 3ICXA 1GN3A 2OTLV 1WA8B 1TAEA 4LFCO 2CTQA 3ZRXA 1EZVH 4JF3A 5EYPB 1H8HG 1MMMA 4DUZO 4UCUA 3QF7A 2WLKA 1J5EB 1EZJA 3IC7A 4DR7O 5CBGA 3JARA 2P90A 4OXSA 1I7FA 2H8PC 3ZN1A 2PZSA 5JQGA 4MVZA 2RNBA 4IHJB 1F7YA 2VS0A 3Q4HB 2BTQB 1SETA 3G71V 1LUVA 3WG7C 1N0NA 4TUYA 3ZCCA 1RM1B 1PNMA 2AXTZ 3OR6C 2AZ2A 3OT7A 3ZJZA 1AJNA 2PI4A 3G4SV 3U10A 3QG5A 1AR1B 2Z5UA 4HNAB 1SQGA 4ICGA 2GUZA 4LBEC 1QQCA 1OV9A 3JSLA 5FNVB 4GKJO 2B1GA 1SQXH 2VQFB 1VQ7V 3K03A 1XNRO 1GM9A 4DR6B 5LGUA 1UJWB 3RT3C 1COWG 3BVOA 5GONB 2W6JG 3ABKC 4NR1A 1THZA 1VF6C 3CP1A 3CSXA 4NXNO 1L0LH 1VQKV 1FXKC 3IGAC 3I55V 2CK3G 1V54C 2EIJB 5KMGA 3K57A 1RPOA 4JAUA 3B40A 4X1IA 4LC1A 4JTDB 1JOYA 4JI8B 2EBOA 2YI8A 1NJIW 4OPAA 3OUFA 3CRCA 4RAIA 1R6NA 4O2AA 3PN1A 2H94A 3UT5B 2QGNA 2XHBA 5IYDO 4MVMA 4U7NA 2LQTA 1XNQB 4EFEA 1R3KC 2HKOA 4JI4B 1I94O 3SYQA 1BHBA 4X88A 1VQNV 5K1XA 4AHCA 3RYHA 4I55B 4A5UB 2EX3A 5GTHZ 5LXTB 2Y48A 3L73H 3S3WA 3N27A 2DWDC 2D2CB 1AVMA 2AHYA 1Y74A 2ARHA 4JAVA 5KUMA 4GZRB 4QE9A 3ZMTA 1N8RW 4DR5B 3K0DA 2OCHA 3AG3B 3ETGA 5BR8O 4IGGA 3K06A 4UCVA 3RWRD 4DR3B 2VWKA 2P4VA 1GK9A 1KYOF 5B66Z 1FPOA 2UUBB 4GKKO 4UB8Z 4CH4A 5BZBA 4DRXA 4I0XA 3DXRA 4K0KB 2ADQB 3CC7V 1Z5WA 1AROP 2D3OW 4DV4B 5L3DA 4UFZA 4CS4A 1Q6UA 2YDEA 1Y76A 4XDKA 2WLIA 5KAFZ 3OMNB 1Q8IA 4I50A 3BRCA 2Q7HA 1AB3A 4JI6B 1ROPA 4LF7B 3EVKA 3LSUA 4IT5A 4PA7A 1RFYA 1J5EO 2Q69A 2PYLA 2QWRB 3ZHQA 2WLMA 1IJGA 4JGSA 4KHPB 1OCOB 5JJEB 5H5NA 1JJ2U 2X6BA 3ZS8C 4IIJB 2JK5C 5A2QN 4TV8B
chains in the Genus database with same CATH topology
2AW9A 5A9GA 1GN2A 3TJTA 3C3TA 4BR6A 1EN4A 3K9SA 4YIPA 1LUWA 1BS3A 3KKYA 3AK3A 1AR4A 3C3SA 4JYYA 3MDSA 1IX9A 1LUVA 1N0NA 1XDCA 4JZGA 1AR5A 3AK1A 1I0HA 2ADPA 1IXBA 4C7UA 1P7GA 2QKAA 4FFKA 1ZTEA 3KDRA 3OT7A 1EN5A 1VEWA 1IDSA 1ZSPA 1AVMA 3IC9A 1PL4A 1I08A 2GDSA 1GN4A 1VARA 3QVNA 3RN4A 1AP6A 1AP5A 2CE4A 1QNMA 3CEIA 2P4KA 2RCVA 1EM1A 2ADQB 1SZXA 1Y67A 4GUNA 1PM9A 3DC6A 1ZLZA 4YIOA 1BT8A 1EN6A 1MSDA 1JA8A 4X9QA 1KKCA 1N0JA 4E4EA 1JR9A 1ZUQA 3EVKA 3LSUA 1MA1A 1XUQA 1BSMA 2CDYA 1XREA 1GN3A 1B06A 3DC5A 2QKCA 3AK2A 1XILA 5AG2A 1WB8A 1WB7A 1D5NA 3BFRA 4F6EA 1MMMA 4JZ2A 1MNGA 1GN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AW9 A;  5A9G A;  1GN2 A;  3TJT A;  3C3T A;  4BR6 A;  1EN4 A;  3K9S A;  4YIP A;  1LUW A;  1BS3 A;  3KKY A;  3AK3 A;  1AR4 A;  3C3S A;  4JYY A;  3MDS A;  1IX9 A;  1LUV A;  1N0N A;  1XDC A;  4JZG A;  1AR5 A;  3AK1 A;  1I0H A;  2ADP A;  1IXB A;  4C7U A;  1P7G A;  2QKA A;  4FFK A;  1ZTE A;  3OT7 A;  1EN5 A;  1VEW A;  1IDS A;  1ZSP A;  1AVM A;  3IC9 A;  1PL4 A;  1I08 A;  2GDS A;  1GN4 A;  1VAR A;  3QVN A;  3RN4 A;  1AP6 A;  1AP5 A;  2CE4 A;  1QNM A;  3CEI A;  2P4K A;  2RCV A;  1EM1 A;  2ADQ B;  1SZX A;  1Y67 A;  4GUN A;  1PM9 A;  3DC6 A;  1ZLZ A;  4YIO A;  1BT8 A;  1EN6 A;  1MSD A;  1JA8 A;  4X9Q A;  1KKC A;  1N0J A;  4E4E A;  1JR9 A;  1ZUQ A;  3EVK A;  3LSU A;  1MA1 A;  1XUQ A;  1BSM A;  2CDY A;  1XRE A;  1GN3 A;  1B06 A;  3DC5 A;  2QKC A;  3AK2 A;  1XIL A;  5AG2 A;  1WB8 A;  1WB7 A;  1D5N A;  3BFR A;  4F6E A;  1MMM A;  4JZ2 A;  1MNG A;  1GN6 A; 
#chains in the Genus database with same CATH topology
 1SKV A;  3RYH B;  2WLH A;  3CJH B;  5FLX N;  1FAF A;  1R6K A;  3LDC A;  4FLW A;  3ZRV A;  3OTO B;  5LP6 C;  3CCE V;  4I4T B;  3RFR A;  4OPH A;  1CXZ B;  4UCO A;  4N23 A;  3ASO B;  4YIP A;  4UVC A;  1PKX A;  3SJA C;  1DK1 A;  1E79 G;  4W4K A;  1XL4 A;  4NTW A;  3CHX A;  4QPJ A;  4CZZ A;  2B5U A;  3E35 A;  3AK1 A;  4O4I B;  2ADP A;  1AI5 A;  1S72 V;  4X64 B;  4C7U A;  3CCM V;  2CH7 A;  1ZTE A;  2YEV B;  2VQF O;  4UVA A;  5CMU A;  4J80 A;  1TUB B;  4DR6 O;  3OW2 U;  4K3A A;  3HKC A;  4FPP A;  3CRR A;  3EXA A;  3N2G A;  4MTG A;  1YIJ V;  2YI9 A;  3ZHU A;  4DR2 B;  4DYL A;  4HYO A;  3ZRW A;  3K5M A;  3FD9 A;  1FXV A;  4CH5 A;  3QO5 A;  5IYZ B;  4JI7 O;  4WF9 V;  2Q9L A;  5KHK A;  5D5Q A;  2WLL A;  2XAS A;  3IFX A;  4DV5 O;  4JI8 O;  3LNN A;  2LW7 A;  2QTS A;  3HKE A;  1VQM V;  1OCR B;  1RSO A;  3JAM N;  3CCQ V;  1XNQ O;  1M90 W;  4LFB B;  5JCO A;  4JI4 O;  3C90 A;  3AK2 A;  4XDJ A;  3ETD A;  3OMA B;  4FFB A;  5HFM A;  4WFA V;  1YVW A;  2LW1 A;  3MHS C;  4LCU C;  1MSW D;  2A0L A;  2BCC H;  3RYC B;  1U97 A;  3UO2 A;  3E86 A;  1H2G A;  2E76 B;  3T1C A;  4PDL A;  1S5H C;  4DW1 A;  3NR7 A;  3C3T A;  1SA0 B;  3TGU H;  2ZE5 A;  4CS3 A;  2F43 G;  4TV9 B;  4WBN B;  3I5D A;  1FFX B;  3OEH G;  2ZIM A;  3EFF K;  3FFQ A;  3MDS A;  4FLX A;  2UUC B;  4Q6G A;  1YJ9 V;  1M57 C;  4DR5 O;  2ZE8 A;  2DN9 A;  3KZI Z;  2MW2 B;  4DR3 O;  1FD9 A;  3APO A;  2ZR2 A;  4IL6 Z;  4DV0 B;  2UUB O;  3OD4 A;  4B7E A;  3ZMU A;  3ABM B;  4X65 O;  1NBM G;  4K0K O;  2GDS A;  3KCY A;  4DV4 O;  4F6R B;  1VQP V;  4DUZ B;  4DR1 B;  3H9V A;  4JI5 O;  5FL7 G;  1ZL8 A;  2LGQ A;  1WP8 A;  1JPX A;  4DR7 B;  3AG2 B;  1JX9 A;  3K9A A;  4JI6 O;  3BAA A;  2UU9 B;  4D7T A;  1SZX A;  1Y66 A;  4MVQ A;  1Q90 D;  2X6C A;  5EZY B;  4DV6 O;  3G80 A;  2LP7 A;  1TA8 A;  4LF6 B;  4LF9 O;  5LA6 B;  4RWU A;  3RGB A;  5KX5 A;  4KHP O;  5EC1 C;  1QVF U;  4H44 B;  3JD3 A;  4D7S A;  1M5I A;  1NI8 A;  4B3S O;  1KEC A;  2AZ0 A;  2GV9 A;  2IBZ H;  4K8Z A;  3JCZ A;  1KP3 A;  5IDJ A;  3MD0 A;  4PV1 B;  1GH6 A;  1MA1 A;  4BW9 A;  4GYC B;  2ZKO A;  3OTO O;  1K4C C;  2JVD A;  3L70 H;  1D5A A;  1XIL A;  4MVO A;  1O9H A;  3CRA A;  4MVS A;  1RPR A;  1N33 O;  5LL6 Y;  1FS0 G;  2QJ1 A;  2HJD A;  4MTO A;  3SJC C;  1YSC A;  1N34 O;  3TJT A;  5DED A;  4TQD A;  1EN4 A;  4EB6 A;  1LUW A;  4X1Y B;  3RW0 A;  2RDC A;  5B1B C;  1I5X A;  2ZE6 A;  1W0K G;  5IYB O;  1BQZ A;  2QWP B;  4J9Y B;  3N2K B;  3L75 H;  3ZN0 A;  1IXB A;  1YXB A;  1EN5 A;  4DR2 O;  1GKF A;  1WA8 A;  3A8T A;  3I56 V;  4G2K A;  1YCI A;  2Y4U A;  5EYP A;  1GMG A;  3O9O A;  3JD2 A;  5C8Y B;  3B2E E;  2DYS C;  1K9M W;  2Y0P A;  1A32 A;  2WPD G;  1XMO O;  4GX2 A;  4B3R B;  3U11 A;  1K33 A;  1U96 A;  3QTC A;  1V55 B;  1AP5 A;  2MK3 A;  3AG1 B;  1GM7 A;  2E3C A;  4Q20 A;  3K5L A;  2N04 A;  3RYI B;  4DK0 A;  2DYR B;  4IHJ A;  3Q4H A;  2BTQ A;  2P7T C;  1LNQ A;  4PI0 A;  3D3I A;  2IU0 A;  1BT8 A;  3CCV V;  3QO8 A;  1S3J A;  2VQE B;  1NH2 B;  1KB9 F;  2P06 A;  4FLV A;  2WA3 A;  2PF4 E;  3K04 A;  2ITC C;  4HNA A;  2GHY A;  2KB1 A;  1OCZ B;  5H6Q A;  1B06 A;  2QKC A;  3W7W A;  5EBL C;  5FNV A;  1BCC H;  2BOB C;  3P3N A;  5IJ9 B;  3GWK C;  3OTF A;  4JI1 B;  3CWB H;  3E8G A;  2EIK C;  2UUC O;  4EKW A;  1B6Q A;  5GON A;  1KC8 W;  5J2T B;  1L0N H;  4DV0 O;  2GTA A;  4DV3 O;  3G67 A;  1XOU A;  4ZI7 B;  4U3J B;  4GX1 A;  2LFR A;  4U7O A;  1G1X B;  3A0H Z;  2M6Y A;  4RUF A;  3ML0 A;  5D5P A;  4GX0 A;  4WFE A;  2XOK G;  3E8H A;  3JAL B;  2QSA A;  3OE7 G;  4DR1 O;  1ZAU A;  2EIL B;  4DXW A;  4PDV A;  5BY1 A;  3B09 A;  3F5T A;  1XQ8 A;  1NH2 D;  1VQL V;  3CB2 A;  4B08 A;  3BCC H;  2QM8 A;  3HKD B;  1GRJ A;  1PL4 A;  2UU9 O;  3UT5 A;  2V1D A;  1UFI A;  5KUK A;  2JIZ G;  4QJF B;  5CBF A;  4LF6 O;  4P2Z A;  3SYC A;  4F4L A;  4PDM A;  3ETE A;  1S5L Z;  4LF5 B;  1N4C A;  1JJO A;  1Q6I A;  2GBO A;  2HVJ C;  5CB4 B;  5CA0 B;  4EFB A;  4UCT A;  3E8B A;  4OX9 O;  1N32 B;  4DV7 B;  1QLN A;  1PD3 A;  3U0Z A;  4NTY A;  1XI1 A;  1UPG A;  3X2Q C;  4I55 A;  3ZBH A;  1QBZ A;  2XUM A;  4YY3 B;  2YIA A;  5FPO A;  5LXT A;  4JAA A;  3TCU A;  4WFF A;  1YTF D;  1F23 A;  4FVM A;  1HWY A;  2FL4 A;  3LDD A;  2ZD9 A;  1LR1 A;  3WG7 B;  4LWS B;  1TUE B;  3K0G A;  2NNU A;  4R50 A;  1P4R A;  2ZIO A;  1E1Q G;  3A2F A;  2Q73 A;  3UKM A;  3BA8 A;  1AJQ A;  5AG2 A;  2OYQ A;  4J10 A;  2EIJ C;  2XAF A;  2R9A A;  3W7T A;  2ZXW C;  4KL1 A;  1CP9 A;  1KBH A;  2GSM B;  4GLX A;  2Q68 A;  4JI7 B;  3WU2 Z;  1EBO A;  2ZDI A;  5H9C A;  4DV5 B;  4UCS A;  1IBL O;  2HFE C;  1AR4 A;  2IJI A;  5IE9 A;  2PI5 A;  2JJ1 G;  3ABK B;  4B3R O;  2WAM A;  1P7B A;  3VQY A;  1SRY A;  3IC9 A;  2CUG A;  1FXK B;  2XAG A;  3ASN B;  3B77 A;  4IIJ A;  1V54 B;  1B04 A;  4O4J B;  1KUQ A;  4TV8 A;  1VAR A;  3CJH A;  3CMA V;  2ITD C;  2O57 A;  1WNS A;  2BSK B;  4X20 B;  1AP6 A;  5F2V O;  4I4T A;  2YS8 A;  2VQE O;  2ZR3 A;  3TXQ A;  4BW5 A;  5LMN O;  5LGT A;  4EEQ A;  3P30 A;  2Q8V A;  1YJW V;  1P49 A;  4AI8 A;  1NKD A;  1H2S B;  1PM9 A;  3O65 A;  4O4I A;  1P84 F;  1T5E A;  4O4H A;  1YHQ V;  4JI1 O;  2YEV A;  2Q67 A;  3GVM A;  4GX5 A;  2XAJ A;  1TUB A;  3SPI A;  1FKA O;  4PA9 A;  2ZDI C;  2CDY A;  3FAV B;  4X65 B;  5DN6 G;  2LFS A;  4HZ3 A;  2NR5 A;  3CCU V;  3F5W C;  3IAY A;  1S5J A;  1D5N A;  1HNX B;  1W59 A;  3SJQ C;  4JI5 B;  1HP8 A;  4MVU A;  4ZOL B;  1GM8 A;  2IH3 C;  3L9D A;  3CS5 A;  1IVS A;  4MW3 A;  5IYZ A;  3WFV A;  1BZK A;  1H8E G;  1VQ6 V;  5CBH A;  1MZE A;  3FKS G;  4DV6 B;  3K9S A;  4LF9 B;  2EJ7 A;  2Q5Z A;  4O2B B;  3WB0 A;  5GW7 A;  2N74 A;  1IX9 A;  1OJH A;  3SR2 C;  4B3S B;  4UVB A;  2V7Q G;  2JGD B;  4PA6 A;  2R72 A;  3BA9 A;  1GO3 F;  4LF5 O;  4DV2 B;  1YZB A;  1PP9 H;  3BHP A;  2P5O A;  4TQF A;  4TT3 G;  4ZHQ B;  1VQ4 V;  2A9H A;  2YIC A;  4LH6 A;  1OHH G;  4AQY O;  1N32 O;  4DV7 O;  2WWW A;  2KKW A;  4MTF A;  5TIS Z;  4CC6 A;  1GAX A;  2AHZ A;  5J2U A;  3OUS A;  3RYC A;  1NTM H;  1V9P A;  1N33 B;  1X59 A;  1URF A;  3SYP A;  1FFT B;  4PHZ A;  4YY3 O;  1Q7Y W;  1SA0 A;  3H01 A;  3K59 A;  3ZMV A;  1N34 B;  4NYK A;  2ETN A;  4TV9 A;  4O4H B;  4WBN A;  1F4M A;  2L6L A;  1FFX A;  1SQB H;  2IU3 A;  1BHA A;  4JV5 B;  1KU9 A;  3FB6 C;  4GUN A;  5LP6 B;  1G4Y B;  2EZP A;  2QR4 A;  1ZLZ A;  4FIP C;  2Y69 C;  5LYJ B;  4B3M B;  2DMX A;  2C2A A;  5B3S C;  3STZ C;  1ZUQ A;  2HLD G;  1SQV H;  4YJ3 B;  5CA1 B;  1M1K W;  1XUQ A;  1VF7 A;  2H3O A;  4CBC A;  4F6R A;  3CCS V;  2QWO B;  2X7R B;  3AG4 B;  5JWP A;  3TK1 A;  1OZ0 A;  1US6 A;  2IJJ A;  4GT1 A;  1Z2G A;  1XMO B;  3LUT B;  4TSF G;  5GTI Z;  3D3Q A;  5L3C A;  1M56 C;  5BMV B;  4CS2 A;  5EZY A;  2IH1 C;  5K1P A;  3BY6 A;  2UUA B;  4BWA A;  2CTP A;  5LA6 A;  4NKG B;  3UCS C;  3M7M X;  1YDX A;  1R6T A;  2Y4T A;  3G6E V;  4CC5 A;  2QKS A;  3ABU A;  1NTK H;  2XTA A;  5DM6 V;  5J2U B;  2Q4P A;  4FJC C;  3MAQ A;  1ZSP A;  4HAM A;  2F4V O;  5B1A C;  5JVD B;  2KQX A;  5LHI A;  4NTX A;  1NTZ H;  3WB1 A;  2EIM C;  3OEE G;  3VOU A;  3ABM C;  3R65 A;  2UXC O;  4X1Y A;  4DV3 B;  3K08 A;  5B1N A;  4DW0 A;  1EM1 A;  2LO1 A;  1R3I C;  4JI2 O;  2EUL A;  4MSW C;  1VQ5 V;  3JAT B;  3N2K A;  3RVZ A;  3H1H H;  5LMU O;  1SS3 A;  5KHG A;  1HNX O;  4LFA B;  3D36 A;  3T4Z A;  3SPC A;  1K7D A;  4FM0 A;  2PGG A;  1BQ0 A;  5IWA B;  1M57 B;  5HFL A;  2XAH A;  2YIB D;  4XDL A;  5C8Y A;  4DUY B;  1FJG B;  1PV0 A;  5JCO C;  1K34 A;  3HKB B;  3P3P A;  1PNL A;  4UXN A;  3T4D A;  5H6R A;  3JAW B;  4UCR A;  1K92 A;  1NVP D;  3WB2 A;  1QLE C;  3RYI A;  3JYC A;  3SJB C;  1XL6 A;  5E79 Z;  1RP3 B;  4OX9 B;  1AIL A;  1K8A W;  3SYO A;  5KA6 A;  4DV2 O;  3H1J H;  3PJS K;  2DJV A;  3JAS B;  2XND G;  3KKY A;  1JNB A;  1SC5 B;  3BAB A;  1K5S A;  4JYY A;  1VQ9 V;  1D2D A;  2OTJ V;  2XT9 A;  4AIL C;  3M99 B;  1NQT A;  2M7W A;  2JRI A;  1XDC A;  2L35 A;  4Z1M G;  3A0B Z;  2LGW A;  4H37 A;  4UV8 A;  4R7C A;  3JCU Z;  2WLJ A;  2P6J A;  4Z1V A;  3FB5 C;  2R70 A;  2DWE C;  3RYF B;  1F4N A;  3LDE A;  4J9Z B;  5IJ9 A;  1PL0 A;  1NZ6 A;  1JQ0 A;  2N05 A;  2IW5 A;  1K4D C;  3SPG A;  3SYA A;  5IT9 N;  1HNW O;  5KHJ A;  4BIO A;  4JV5 O;  2BE3 A;  4FMT A;  3D8C A;  4JI0 O;  3VQW A;  1M4U A;  3JSN A;  1JFF B;  2QM7 A;  4B3M O;  3OGC C;  3J80 N;  3E22 B;  1Q81 W;  4QNH B;  5J2T A;  3ZED A;  1NR1 A;  2Q0A A;  4ZI7 A;  2JGU A;  4U3J A;  2ZT9 B;  3L74 H;  2KG7 B;  2GTS A;  5JH7 B;  5IJ0 B;  1IBL B;  1W2B U;  2FTK A;  2W0F C;  1Q86 W;  2VWJ A;  1NR7 A;  3JAL A;  3UQ8 A;  2UXN A;  3ZX6 A;  1JA8 A;  4QPK A;  1QVG U;  2G38 A;  5B1B B;  2E5L O;  3CXC U;  2DE0 X;  5ITZ B;  3HKD A;  2HHH O;  1HNZ B;  2F23 A;  2CTW A;  1H5W A;  3SPH A;  2IM9 A;  3RVY A;  4DR4 O;  3W7S A;  2UUA O;  1F51 A;  4RO2 A;  3CME V;  3E89 A;  5KAI Z;  2ZQM A;  3T1H O;  4QE7 A;  5CB4 A;  5CA0 A;  4JTA B;  5IY5 C;  1OCC B;  2DYS B;  1M93 A;  3ABL C;  2JEX A;  5LMN B;  2EIN B;  2ODM A;  4BR6 A;  3FYE B;  3S3X A;  4JPR A;  4UUJ C;  3FB8 C;  3HPL C;  4L87 A;  4WFG A;  1L1F A;  4LWS A;  1DLB A;  3QO7 A;  4GCZ A;  2CAZ C;  2P67 A;  4BAY A;  4RQF A;  3TXS A;  1P7G A;  4P30 A;  4FLT A;  3K79 A;  3L71 H;  4O4L B;  4KUM A;  2WA4 A;  4G28 B;  1NU1 H;  4I9W A;  5LOV B;  2QEX V;  2YSU B;  5EBW C;  1YTF B;  1TGO A;  5J9P C;  3ZHV A;  3R66 A;  2JEU A;  2A7W A;  2IJH A;  1MG1 A;  2RN9 A;  2QWN B;  1K73 W;  4LFA O;  2UXB O;  2OIG A;  5IWA O;  4X62 B;  1YIT V;  1HDJ A;  4PJ0 Z;  1DTO A;  4KP4 A;  4DUY O;  1FJG O;  4JI3 B;  4FK5 C;  1RM1 C;  1J95 A;  1ZWI C;  2OCC B;  1EFR G;  2RMK B;  4ABM A;  1MSD A;  1KKC A;  1BMF G;  3CYO A;  1VF6 A;  1N0J A;  4LNU B;  3J81 N;  1Q43 A;  1JR9 A;  3K58 A;  3QNE A;  1FXK A;  3DTU B;  3VQX A;  4O4J A;  3VBB A;  4AQY B;  4FM2 A;  4X89 A;  2Z0A A;  2ZE7 A;  1WB8 A;  2BSK A;  1IBK O;  4X20 A;  4N21 A;  2LJ2 A;  1Q6H A;  4JZ2 A;  4DV1 O;  3KCX A;  1KKD A;  1KQS U;  5A9G A;  2B1I A;  2ATK C;  1MZF A;  2BTO A;  4J11 A;  1S76 D;  1IZ3 A;  1XBL A;  4WFB V;  2BOC C;  3AK3 A;  1GTO A;  4X1K B;  4RQE A;  1YF2 A;  1FOU A;  4R8C A;  3X2Q B;  1AR5 A;  1I0H A;  3B8N A;  4J7K A;  3T2M A;  4P9P A;  2UXD B;  3ZIA G;  3FAV A;  4H13 B;  1JCH A;  4L8J A;  5EC2 C;  4X66 O;  3OGI B;  2FYU H;  3ZHS A;  1VP7 A;  3NXS A;  2PY5 A;  2EJR A;  2JJ2 G;  2YID A;  1Z5V A;  2ZM6 B;  1G6U A;  4ZOL A;  4YJ2 A;  1HW7 A;  1TVK B;  1SQP H;  5KA5 A;  4WCE V;  4R6Z A;  3K5O A;  2CE4 A;  3ASN C;  2YXY A;  3E2E A;  1QR9 A;  5L3F A;  1VMG A;  1E1R G;  2ZXW B;  1CPY A;  4DK1 A;  4O2B A;  1HNZ O;  2AGA A;  3BPZ A;  4NXM O;  3JAR B;  3ZMS A;  5LGN A;  2HEP A;  3RBZ A;  1NT2 B;  5JQG B;  2ZNI A;  2JGD A;  4FLY A;  1DF4 A;  3CC2 V;  4K35 A;  2VRZ A;  4UV9 A;  4YHH B;  5DEC A;  4FZ1 A;  1S77 D;  3CD6 V;  4B3T O;  4ZHQ A;  4OGQ B;  4LR3 A;  4TUY B;  3GB7 C;  1WN7 A;  2F4V B;  1BSM A;  3AG3 C;  3H1I H;  1Q3E A;  1XRE A;  4PA3 A;  3DC5 A;  1WB7 A;  1Q5O A;  1VF5 B;  1MNG A;  1GN6 A;  4PD4 F;  2Y0I A;  2HP8 A;  4ZBM A;  4JYA B;  2GUZ B;  2AW9 A;  2UXC B;  2CTR A;  5FPR A;  1GN2 A;  5B1O A;  1SQQ H;  5LP6 A;  4FM1 A;  4LF8 B;  5LYJ A;  3T1Y B;  4JI2 B;  2XAQ A;  3C3S A;  5LMU B;  1B3Q A;  2YXL A;  2JS3 A;  4PA4 A;  1WJZ A;  1XMQ B;  4MTX A;  4YJ2 B;  4JTC B;  4YJ3 A;  5CA1 A;  1VIB A;  4FFK A;  3THO A;  1AJP A;  1OCO C;  1WPB A;  2JDI G;  2ILM A;  1YJN V;  2HG5 C;  5KMG B;  4X62 O;  3UM7 A;  4X1I B;  1H2N A;  4JI3 O;  3JD0 A;  5E1A C;  3VQV A;  1IBM B;  3DGE A;  5BMV A;  2KSD A;  4O2A B;  4HBN A;  3CCL V;  3ASO C;  1ENV A;  2DQ0 A;  1QNM A;  4G27 B;  2RCV A;  1AI6 A;  3ABT A;  4TOI A;  4LF4 B;  5BXZ A;  2RQ6 A;  4J7Z A;  3HR0 A;  2QM4 A;  2YIB A;  4H0L B;  1WAZ A;  4YIO A;  1K3E A;  2WLN A;  1EN6 A;  1H2M A;  3DSQ A;  3UO3 A;  2Q6A A;  4D6T H;  2QTO A;  1Q82 W;  2OWO A;  4IYH A;  5KLV H;  2QWQ B;  2QA4 V;  3JD1 A;  5JVD A;  3JAK A;  1AI4 A;  1HNW B;  3IJ4 A;  3OM3 B;  1DF5 A;  1Y74 B;  4JI0 B;  1QHT A;  2Z3Y A;  1S0V A;  1MOF A;  3APQ A;  2W6I G;  3AG4 C;  1O9G A;  1ORQ C;  3M8A A;  3OAA G;  2UXD O;  2EZO A;  4CH3 A;  4PEL A;  3JAT A;  4P9O A;  4DRX B;  1BS3 A;  3ZHT A;  4I0X B;  3DXR B;  3F7Y C;  3CXH F;  1SQF A;  2R9I A;  1OCR C;  2ZM6 O;  2E5L B;  1KD1 W;  2A79 B;  4JZG A;  2V4D A;  3CC4 V;  1Y76 B;  1PPJ H;  2Y69 B;  2WLI B;  2HHH B;  2QKA A;  4PI2 A;  3HKB A;  2K1E A;  4I5S A;  1M9N A;  5B3S B;  4I50 B;  3LNM B;  1IDS A;  3JAW A;  1XEQ A;  4JYC A;  4DR4 B;  2YUA A;  1N36 B;  2DOS A;  3T1H B;  1GN4 A;  2Q0O C;  3SDL A;  4WFH A;  2FML A;  3SGI A;  4ZKI A;  2X0L A;  3FX7 A;  4H33 A;  1VQ8 V;  4YHH O;  3E83 A;  3JAS A;  4J42 A;  1DGS A;  3CEI A;  2P22 C;  3W7X A;  1IXM A;  1NVP B;  1Y4M A;  1Y67 A;  3CPW U;  3LSQ A;  5KHH A;  2JS5 A;  3JAK B;  1M56 B;  3JD4 A;  2ZCE A;  2Q7E A;  1L8D A;  3H1L H;  1R3J C;  2ZNJ A;  1K97 A;  4X9Q A;  1QR8 A;  4JAS A;  5KHI A;  1YEW A;  2CGN A;  3RYF A;  4JYA O;  3LSS A;  2FKX A;  4X8A A;  2YC0 A;  2CH7 B;  3CRQ A;  3EHB B;  4J41 A;  4LF8 O;  3T1Y O;  1JFF A;  3TET A;  1BL8 A;  4FZ0 A;  3E22 A;  3AG2 C;  2FB5 A;  1HR0 B;  5B1A B;  1YI2 V;  1H2K A;  3HKC B;  1H2L A;  3CRM A;  1IUR A;  3B4S A;  2KG7 A;  1XMQ O;  2UXB B;  5JH7 A;  5IJ0 A;  3N2G B;  2A06 H;  2EIM B;  4NB5 A;  3ZHR A;  3SPJ A;  3CX5 F;  1MAB G;  1SER A;  3K3W A;  4LFC B;  3ZRW B;  4QGP A;  1BGY H;  2X6A A;  3K5N A;  4FLU A;  1SF9 A;  4DO2 A;  2K9P A;  4PDR A;  2WLL B;  2HJF C;  1G8M A;  5ITZ A;  2UXX A;  3E8F A;  2HVK C;  4I9Q A;  4QIW F;  1IBM O;  5LBQ A;  1K5Q A;  4NVP A;  5IYC O;  3CCR V;  3HKE B;  5EBM C;  3ZRS A;  4LF7 O;  1RSO B;  1NS1 A;  4MVR A;  2PTM A;  4LF4 O;  1IBK B;  5LHG A;  4DV1 B;  2QE7 G;  4Z2W A;  3QVN A;  1VQO V;  5B5E Z;  4FFB B;  4MS2 A;  3ZMZ A;  3W7U A;  1QU7 A;  5EIB C;  3G6B A;  2E74 B;  4UB6 Z;  1QLE B;  3B8M A;  1XHZ A;  2P4K A;  4KFM A;  3F7V C;  1R73 A;  4LP8 A;  5JJN B;  4K8X A;  4GKJ B;  4CH6 A;  4XBF A;  3D36 C;  2B9Z A;  4IYI A;  2NLJ C;  1Y6X A;  1ZX3 A;  2W0X A;  5H2F Z;  4O4L A;  1XNR B;  4E4E A;  3CE2 A;  3GWO A;  1H38 A;  3KG2 A;  5LOV A;  2CGO A;  4B7K A;  4X64 O;  4X66 B;  5CA3 A;  3OR7 C;  5L3E A;  3P32 A;  2RJZ A;  5CN0 A;  1V55 C;  3AG1 C;  3BFR A;  2PYJ A;  1XHX A;  1R3L C;  4F6E A;  2ZIN A;  4ZIB A;  4NXN B;  4JYB A;  4J7J A;  2DYR C;  3STL C;  3ETQ A;  2DQ3 A;  1ZL8 B;  1FYJ A;  3FB7 C;  4NXM B;  1AI7 A;  3AG7 A;  4MW8 A;  1WLE A;  2PUS A;  1JMK C;  3BEH A;  1N36 O;  5L3G A;  1SES A;  2F95 B;  1OCC C;  4LH7 A;  4LNU A;  1QCE A;  2EIN C;  2NN4 A;  1JVM A;  4B3T B;  2Q7G A;  5KX5 B;  1OCZ C;  4BIZ A;  3CCJ V;  4YXW G;  3KDR A;  3FYI B;  1I94 B;  5L3B A;  1KMI Z;  1VEW A;  1X4T A;  4LFB O;  1I08 A;  3A0R A;  4KXR A;  2OIE A;  2DW4 A;  3OFN G;  5JJJ B;  1CEZ A;  1BE3 H;  3L72 H;  5LHH A;  5EIB D;  3RN4 A;  2F93 B;  3OMI B;  4I7Z B;  2IJK A;  2OT5 A;  4TWK A;  2WSS G;  2HR3 A;  3MHH C;  1SZT A;  5IY5 B;  3J7A U;  2A3Q A;  1KP2 A;  4X1K A;  3ABL B;  3H1K H;  1R1B A;  1FXH A;  5BR8 B;  3DC6 A;  4FLZ A;  2E75 B;  2EIL C;  2F1M A;  4U3F H;  4EB6 B;  5EK0 A;  4MT8 A;  2QDO A;  4GKK B;  1WPX A;  1W0J G;  1I5Y A;  1HR0 O;  4ASU G;  3HB3 B;  1WP7 A;  2R9R B;  4BIU A;  2F66 C;  2YXH A;  2EIK B;  4E2L A;  1PNK A;  2OCC C;  3AEI A;  4W4L A;  1TVK A;  4RUE A;  5C93 A;  3ICX A;  1GN3 A;  2OTL V;  1WA8 B;  1TAE A;  4LFC O;  2CTQ A;  3ZRX A;  1EZV H;  4JF3 A;  5EYP B;  1H8H G;  1MMM A;  4DUZ O;  4UCU A;  3QF7 A;  2WLK A;  1J5E B;  1EZJ A;  3IC7 A;  4DR7 O;  5CBG A;  3JAR A;  2P90 A;  4OXS A;  1I7F A;  2H8P C;  3ZN1 A;  2PZS A;  5JQG A;  4MVZ A;  2RNB A;  4IHJ B;  1F7Y A;  2VS0 A;  3Q4H B;  2BTQ B;  1SET A;  3G71 V;  1LUV A;  3WG7 C;  1N0N A;  4TUY A;  3ZCC A;  1RM1 B;  1PNM A;  2AXT Z;  3OR6 C;  2AZ2 A;  3OT7 A;  3ZJZ A;  1AJN A;  2PI4 A;  3G4S V;  3U10 A;  3QG5 A;  1AR1 B;  2Z5U A;  4HNA B;  1SQG A;  4ICG A;  2GUZ A;  4LBE C;  1QQC A;  1OV9 A;  3JSL A;  5FNV B;  4GKJ O;  2B1G A;  1SQX H;  2VQF B;  1VQ7 V;  3K03 A;  1XNR O;  1GM9 A;  4DR6 B;  5LGU A;  1UJW B;  3RT3 C;  1COW G;  3BVO A;  5GON B;  2W6J G;  3ABK C;  4NR1 A;  1THZ A;  1VF6 C;  3CP1 A;  3CSX A;  4NXN O;  1L0L H;  1VQK V;  1FXK C;  3IGA C;  3I55 V;  2CK3 G;  1V54 C;  2EIJ B;  5KMG A;  3K57 A;  1RPO A;  4JAU A;  3B40 A;  4X1I A;  4LC1 A;  4JTD B;  1JOY A;  4JI8 B;  2EBO A;  2YI8 A;  1NJI W;  4OPA A;  3OUF A;  3CRC A;  4RAI A;  1R6N A;  4O2A A;  3PN1 A;  2H94 A;  3UT5 B;  2QGN A;  2XHB A;  5IYD O;  4MVM A;  4U7N A;  2LQT A;  1XNQ B;  4EFE A;  1R3K C;  2HKO A;  4JI4 B;  1I94 O;  3SYQ A;  1BHB A;  4X88 A;  1VQN V;  5K1X A;  4AHC A;  3RYH A;  4I55 B;  4A5U B;  2EX3 A;  5GTH Z;  5LXT B;  2Y48 A;  3L73 H;  3S3W A;  3N27 A;  2DWD C;  2D2C B;  1AVM A;  2AHY A;  1Y74 A;  2ARH A;  4JAV A;  5KUM A;  4GZR B;  4QE9 A;  3ZMT A;  1N8R W;  4DR5 B;  3K0D A;  2OCH A;  3AG3 B;  3ETG A;  5BR8 O;  4IGG A;  3K06 A;  4UCV A;  3RWR D;  4DR3 B;  2VWK A;  2P4V A;  1GK9 A;  1KYO F;  5B66 Z;  1FPO A;  2UUB B;  4GKK O;  4UB8 Z;  4CH4 A;  5BZB A;  4DRX A;  4I0X A;  3DXR A;  4K0K B;  2ADQ B;  3CC7 V;  1Z5W A;  1ARO P;  2D3O W;  4DV4 B;  5L3D A;  4UFZ A;  4CS4 A;  1Q6U A;  2YDE A;  1Y76 A;  4XDK A;  2WLI A;  5KAF Z;  3OMN B;  1Q8I A;  4I50 A;  3BRC A;  2Q7H A;  1AB3 A;  4JI6 B;  1ROP A;  4LF7 B;  3EVK A;  3LSU A;  4IT5 A;  4PA7 A;  1RFY A;  1J5E O;  2Q69 A;  2PYL A;  2QWR B;  3ZHQ A;  2WLM A;  1IJG A;  4JGS A;  4KHP B;  1OCO B;  5JJE B;  5H5N A;  1JJ2 U;  2X6B A;  3ZS8 C;  4IIJ B;  2JK5 C;  5A2Q N;  4TV8 B; 
#chains in the Genus database with same CATH homology
 2AW9 A;  5A9G A;  1GN2 A;  3TJT A;  3C3T A;  4BR6 A;  1EN4 A;  3K9S A;  4YIP A;  1LUW A;  1BS3 A;  3KKY A;  3AK3 A;  1AR4 A;  3C3S A;  4JYY A;  3MDS A;  1IX9 A;  1LUV A;  1N0N A;  1XDC A;  4JZG A;  1AR5 A;  3AK1 A;  1I0H A;  2ADP A;  1IXB A;  4C7U A;  1P7G A;  2QKA A;  4FFK A;  1ZTE A;  3KDR A;  3OT7 A;  1EN5 A;  1VEW A;  1IDS A;  1ZSP A;  1AVM A;  3IC9 A;  1PL4 A;  1I08 A;  2GDS A;  1GN4 A;  1VAR A;  3QVN A;  3RN4 A;  1AP6 A;  1AP5 A;  2CE4 A;  1QNM A;  3CEI A;  2P4K A;  2RCV A;  1EM1 A;  2ADQ B;  1SZX A;  1Y67 A;  4GUN A;  1PM9 A;  3DC6 A;  1ZLZ A;  4YIO A;  1BT8 A;  1EN6 A;  1MSD A;  1JA8 A;  4X9Q A;  1KKC A;  1N0J A;  4E4E A;  1JR9 A;  1ZUQ A;  3EVK A;  3LSU A;  1MA1 A;  1XUQ A;  1BSM A;  2CDY A;  1XRE A;  1GN3 A;  1B06 A;  3DC5 A;  2QKC A;  3AK2 A;  1XIL A;  5AG2 A;  1WB8 A;  1WB7 A;  1D5N A;  3BFR A;  4F6E A;  1MMM A;  4JZ2 A;  1MNG A;  1GN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...