4JYYA

Crystal structure of the azide and iron substituted clostrium difficile sod2 complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
202
structure length
202
Chain Sequence
NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Crystal structure of the azide and iron substituted Clostrium difficile SOD2 complex
rcsb
source organism Clostridium difficile
molecule tags Oxidoreductase
total genus 73
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4jyyA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4jyyA02
3KKYA 1LUVA 5AG2A 3IC9A 3K9SA 2QKAA 2GDSA 5A9GA 3MDSA 3QVNA 1XREA 4GUNA 1AR4A 1Y67A 1GN6A 1GN4A 1VEWA 3BFRA 1GN3A 1ZUQA 3EVKA 3RN4A 3TJTA 1I08A 1ZSPA 4BR6A 1MA1A 1MNGA 1XUQA 3C3SA 3LSUA 4E4EA 2ADPA 2CDYA 1MSDA 1ZTEA 3OT7A 2RCVA 1N0NA 1AVMA 4X9QA 1P7GA 1BT8A 1WB7A 4JZ2A 1AP5A 1XILA 2CE4A 1BSMA 1WB8A 4JYYA 4JZGA 1N0JA 2P4KA 2AW9A 1MMMA 3AK1A 1JA8A 4C7UA 1B06A 1XDCA 1KKCA 1IX9A 1EN5A 1EN6A 3CEIA 1QNMA 1AP6A 1ZLZA 1EM1A 1GN2A 1PM9A 3DC5A 3DC6A 3AK3A 1LUWA 1VARA 1JR9A 1AR5A 1BS3A 1EN4A 1SZXA 2ADQB 2QKCA 1I0HA 1PL4A 4F6EA 4FFKA 4YIPA 1IXBA 3C3TA 4YIOA 1IDSA 3AK2A 1D5NA
chains in the Genus database with same CATH superfamily
1QHTA 3ZMVA 1KBHA 2EZPA 1FJGB 5BR8O 4JTCB 5JVDA 2QKSA 1DTOA 3ZRSA 4FM1A 2X6BA 1N36B 5KX5B 4CH3A 3ZMTA 1I08A 4PJ0Z 4AI8A 1JCHA 2XAHA 2PTMA 4X64B 4MTFA 1L0LH 2KQXA 4E4EA 3QO7A 1XL4A 3RVYA 4RUEA 1ROPA 2EIKB 3CC2V 1M9NA 2FB5A 3L72H 1M56C 1HDJA 2XUMA 3CE2A 3HKCB 3TETA 2CTPA 4I50A 1K92A 4J80A 1H8HG 4NXNO 4WBNB 3B8MA 5IYZA 2VS0A 4JZ2A 2RJZA 1X4TA 4LNUA 1JJ2U 1XILA 3A2FA 3L73H 2PF4E 2GBOA 2QGNA 3A0HZ 2R9AA 1K7DA 2EZOA 3N2KB 4LF6O 1KKCA 4TQDA 1IX9A 4FLYA 2DW4A 3DXRB 1ENVA 3JAKA 4FIPC 5LHGA 1URFA 3CRMA 3S3WA 1Y76B 1N33O 5LXTB 1OCZC 1ZL8B 5B3SC 1DF5A 1XQ8A 1H2LA 1SQGA 4UCUA 3QNEA 1AI7A 2Y48A 3N2GB 2E3CA 2VQEB 3SPHA 3SPCA 4U3FH 5GTIZ 2CAZC 3G80A 1M57C 5FNVB 1Z5VA 2HJFC 3OMIB 4KL1A 1CXZB 2YXLA 4DV3O 4LF5B 4Q6GA 2IJKA 1GRJA 1K4DC 1SESA 1UPGA 5KHHA 3STLC 1GN6A 3ABKC 2YI9A 4CH5A 2M6YA 3W7SA 4QNHB 3JSNA 1V55B 3T1YB 3CCSV 3G4SV 1EZJA 2FYUH 3X2QC 2QJ1A 4BIUA 2W6JG 4ZI7A 4LFCO 3K04A 1SRYA 1VMGA 4CBCA 5GONB 4EEQA 2DQ3A 1F4NA 1LNQA 1RFYA 4B3SB 1I5YA 5J2UA 2HHHB 2EJ7A 5IJ9A 4QE7A 2JEUA 3D3IA 1VQKV 3ASOB 4X20A 4I55A 3K79A 2C2AA 4JYYA 4LNUB 2QWQB 4QGPA 1PPJH 1Y74A 3CHXA 1G4YB 5L3FA 4TT3G 1BQ0A 3H1LH 2VRZA 3W7TA 2V1DA 4YHHO 2UXDB 3L74H 2XASA 1QNMA 3OTFA 3UT5B 3JAKB 2ATKC 2CTQA 4BAYA 5LOVB 2Y4UA 1PKXA 3FB5C 3WG7B 1VARA 2ZNIA 3JALA 3BPZA 2Q8VA 2YC0A 4CH6A 3D36C 1Q8IA 1RSOB 3HPLC 3CMEV 3OGIB 1H2NA 3OTOB 1VIBA 4PA4A 4GX0A 4ZBMA 2GDSA 5LMNB 4GKJO 1LR1A 2DWEC 3L75H 4U3JB 5CB4A 1FAFA 3GWOA 4WFAV 4GX1A 1V54B 1FKAO 3W7UA 2AZ2A 1U97A 2CGNA 3B2EE 5B1AB 4DV5O 4IT5A 4QE9A 3CJHA 4DR2B 2QA4V 4O4HA 1R6NA 1AI4A 4JI4B 2R70A 3VQYA 4ZI7B 3OW2U 4FPPA 2WA4A 4B3RB 5GW7A 3OT7A 4O4JB 1Q82W 2UXBB 2RCVA 1P7BA 1T5EA 1VQ6V 4B3MO 1FPOA 4HZ3A 4DV7O 4LF4B 4DUYO 1XHZA 3ABMB 2QWRB 3LSSA 5L3EA 1Q86W 3O9OA 4J9YB 1SZTA 3VOUA 3ZMUA 3T2MA 5ITZB 3WB1A 3JSLA 4I55B 4KUMA 1VQ5V 5LYJA 4J42A 3CD6V 3TK1A 1QVFU 1IBKB 4MTXA 4JI5B 4J7KA 4R7CA 3D3QA 4PI0A 4AQYB 1GN2A 1VQ9V 2HP8A 1XOUA 3GVMA 4NXMB 3SGIA 2UXNA 3K5MA 3JATA 4PELA 1WP8A 2UUBB 3OR6C 1I0HA 3E8FA 4O2BA 4TUYA 1IBLO 3CMAV 4CZZA 1KC8W 2RMKB 5IT9N 3JALB 4WFHA 3E83A 4UVCA 4JYBA 2Y4TA 3LDCA 5TISZ 2PY5A 3ZRXA 2JS5A 2BCCH 4YXWG 3SPJA 2R9RB 4GUNA 2YSUB 4JYCA 3FB7C 1GTOA 3EVKA 1SKVA 3TJTA 1NVPB 1NR7A 4PDVA 4DW1A 1TVKA 2WLLA 4JI1B 1B6QA 3APQA 4UFZA 5E1AC 2RDCA 3BCCH 4YJ2A 1GO3F 3CJHB 2UUCO 2HG5C 3GWKC 4K0KO 4O4HB 5H5NA 2R72A 2ZE8A 3DGEA 3FAVB 4MVZA 1UJWB 1XNRO 3P32A 1WJZA 3GB7C 4H44B 2ZE6A 1L8DA 5BMVA 2X7RB 5CMUA 4WCEV 4I9QA 1MMMA 1I94O 3ML0A 4P9PA 5KUKA 2V7QG 2V4DA 5CA0A 4DV4B 2LO1A 5B1OA 3FKSG 3JARA 4JASA 3WFVA 4ZHQA 5KUMA 2OCCB 3E86A 1EN6A 4LWSB 5KMGA 1P49A 2ZM6O 4YJ3A 5E79Z 1EM1A 1VQ7V 3K03A 1JMKC 2YICA 2GTAA 3JCZA 1VP7A 1JR9A 5LMUO 1YDXA 5CA1B 2FL4A 3HKDB 4GT1A 4LCUC 3SDLA 1NS1A 4JI2B 2XAFA 1Q6HA 3T1CA 3UQ8A 4YIPA 1SQFA 1IXBA 4XDKA 1Q3EA 3PJSK 4FZ0A 4O2BB 4TUYB 2QSAA 3CCUV 3CXCU 3WB0A 2H94A 2QWOB 5DM6V 4UCRA 1XMOB 2D2CB 4R50A 4U7OA 1AJQA 3H1KH 1N32O 1SQVH 4IIJB 1BHAA 3ETGA 5LHIA 2MK3A 3RYHB 5JQGA 4DV2B 2PI4A 1HNWB 3OEEG 1V55C 2P6JA 3ZRWA 1EFRG 3OFNG 4P2ZA 4DYLA 1E79G 1MA1A 4PDRA 1SS3A 2YDEA 3CP1A 1Z2GA 4CH4A 2XT9A 1DK1A 2BOBC 4H13B 2WLMA 1OCRB 3FYEB 2NLJC 1A32A 4X64O 2WPDG 3CC7V 4MTGA 2DN9A 3CRRA 2KKWA 3TXSA 1BT8A 3ASOC 3SPGA 2F93B 3K08A 2UU9B 3CRQA 5EK0A 1P4RA 3ZRVA 2P4KA 2AW9A 2HEPA 5BMVB 2UXCB 4R8CA 2P4VA 2WLIA 1WAZA 4C7UA 1B06A 4JI3B 2Q0AA 5L3DA 3JD0A 3Q4HA 1QVGU 1B3QA 2HR3A 1MZEA 1PL0A 3JARB 3FX7A 1K73W 4X88A 1AP6A 2KB1A 5KMGB 4K8ZA 4HYOA 4FLTA 1M1KW 3WG7C 3HKBA 4EFEA 1YJWV 2QDOA 3QTCA 1BHBA 2DE0X 4OGQB 4ZOLB 3RYFA 2HLDG 3OR7C 1RPRA 2GV9A 3ASNB 3CCVV 2N74A 5IDJA 2F66C 3G6BA 1VQ8V 1W0KG 2BTQA 1BE3H 3IC9A 4UVBA 1QR8A 5JH7A 2XAJA 2YXYA 2VQEO 1PP9H 3VQXA 2Q9LA 1GN4A 1MG1A 1V54C 3UO2A 4DUZB 1N8RW 2ZDIC 1ZUQA 1JQ0A 1KKDA 4RQFA 5DEDA 3MHSC 5IYDO 3L70H 1NH2B 4DK0A 5JQGB 4LF5O 5B1AC 3SYPA 3IAYA 4MVOA 2AHZA 2F1MA 4FFBA 5LGTA 1HW7A 3AEIA 4QIWF 3BHPA 3CYOA 2JJ1G 4JI0B 3K0DA 3DTUB 3T1YO 5IJ0B 4LFAB 1HP8A 3BAAA 1R73A 1ZWIC 5KAFZ 4IHJB 5KAIZ 4TQFA 3JD3A 3ABMC 4GCZA 4LH7A 1MABG 4P30A 1M4UA 3K57A 1YJ9V 2OTJV 3OE7G 2YIDA 2EINB 1Q90D 1XHXA 4WFBV 4B3SO 2HHHO 2NR5A 2QM7A 1H2MA 4OXSA 1VQLV 3AG3B 4OPHA 5LA6A 4NTXA 4X66B 2WLIB 3E8GA 5CBHA 4RWUA 4O4IB 4MW3A 4D7SA 1WPBA 2JS3A 3HR0A 4G27B 4MVRA 4UCTA 5EC2C 1NVPD 3P3PA 4JI7O 3ZJZA 2UXDO 1YVWA 5K1XA 5LP6A 2Y0PA 4LF8B 4DXWA 2YI8A 4JAVA 5HFLA 5H6QA 4WF9V 4GX2A 5EZYA 3RYFB 1YTFB 1IURA 3QO8A 3ZHRA 1MOFA 1AR1B 3K9SA 1FXHA 3AG1B 2BE3A 1J5EB 1NTKH 1UFIA 1F23A 5JH7B 2IH3C 3ETDA 4DR1B 1CP9A 4PV1B 3OTOO 2FTKA 3CCMV 3APOA 1Q6IA 2ZINA 4IL6Z 1GK9A 5LMNO 4DV6B 2P5OA 1GH6A 1W59A 1ZSPA 4BW9A 2DMXA 3BA8A 3M8AA 2PZSA 2GHYA 2CTRA 2LW1A 4UVAA 1IVSA 4NTWA 3ICXA 1Q5OA 5JVDB 3AG7A 4BIOA 3E8HA 4DR2O 4JI4O 1FXKA 1WB7A 4JAAA 2ITCC 2LGWA 3C90A 2QEXV 4L8JA 2EJRA 4B3RO 3JD2A 1AROP 2UXBO 1WB8A 3T1HB 4KHPB 4DRXA 5CA3A 3UM7A 1JA8A 1YXBA 2ZXWB 2OCCC 2B9ZA 2OWOA 3ZEDA 5IE9A 3P30A 3NR7A 1NTMH 5EIBD 3CEIA 2W0FC 3K0GA 2CK3G 1ZX3A 2Y0IA 1RP3B 2JGDA 4I50B 3G71V 1IBKO 3AK3A 4JI5O 5IYZB 4E2LA 3OMNB 1JJOA 4LH6A 1AR5A 3UKMA 3ZCCA 1JFFA 2ADQB 1QR9A 4AQYO 3H01A 1PL4A 1YJNV 3JAMN 2Q7GA 4F6EA 4NXMO 4TOIA 4YIOA 1IDSA 5H6RA 1D5NA 1WN7A 4EB6A 1R1BA 1SQBH 2ZT9B 3K5NA 4X1IA 3VBBA 3RT3C 4DR4B 1MZFA 3QVNA 2BTOA 1HR0B 4NYKA 2LW7A 5EIBC 4LC1A 5C8YA 1AR4A 3ABTA 4UUJC 1AJPA 3OD4A 4CC5A 4UCSA 4L87A 1HNXB 3FFQA 2E74B 1OZ0A 4AHCA 1IBMB 4LFBO 2HFEC 2WLJA 1H2SB 1Q43A 3OEHG 2XAGA 5EYPA 3RFRA 1OCRC 4MTOA 1L1FA 3E2EA 3E22A 5JCOA 1COWG 4JI1O 4JF3A 4MS2A 3JAWA 3M7MX 3CC4V 2MW2B 2CE4A 2RNBA 4BWAA 3ZHUA 1TUBA 4OX9B 1TUEB 3CXHF 2B1GA 4FZ1A 2DYSB 1SA0A 2EX3A 4WFEA 3B40A 4DRXB 4JI6B 1XBLA 2VQFO 4TV9A 3K3WA 4D6TH 5B1BB 2GUZA 3CCLV 2L35A 1FYJA 1NU1H 1HWYA 1K9MW 5J2UB 3CS5A 4HAMA 5IJ9B 3JASA 1TGOA 2K1EA 2PYLA 4DV4O 3B09A 1NH2D 2JK5C 4B3TB 1K5QA 4X20B 3R66A 4GKKB 2JGDB 3JYCA 4K35A 4X65O 3W7XA 4KP4A 2ZNJA 4X1YA 3ASNC 3E35A 1DGSA 4NB5A 1NZ6A 4JYAB 1Y74B 2CGOA 3AK2A 2QM8A 3H1HH 4MW8A 3JD4A 2JVDA 1K34A 1JX9A 1AILA 4NKGB 5JJJB 4B08A 2QE7G 4JI2O 5B1NA 2DYRB 1OHHG 1Y4MA 5A9GA 1S76D 4UCOA 5DN6G 2LFRA 2WAMA 4DR5B 3LNMB 1YEWA 1VF7A 1Y67A 2A79B 2X6AA 1VEWA 3BFRA 4NTYA 1S0VA 3HKEA 2IBZH 2XTAA 5CBFA 3P3NA 4FLXA 4FM2A 4GYCB 1N34O 4PI2A 3K06A 1KECA 4DR3O 3LUTB 1XUQA 2IU3A 3O65A 3ABLB 2YEVA 4DV2O 4Z1MG 3ZN1A 3G67A 4I4TA 2H8PC 2E5LB 1HNWO 1H38A 2H3OA 2KG7A 4LR3A 2PI5A 3ETQA 2ARHA 2N04A 4X1KA 2BSKA 1M90W 5H2FZ 4JTDB 4DR7O 1YITV 2P06A 2P22C 5CB4B 3E22B 2EINC 1XMQO 4JAUA 1SERA 4JV5B 3CRCA 3ZHVA 2JDIG 1YTFD 4RAIA 1OCZB 2W6IG 2EIKC 3AG3C 2ITDC 1SQPH 2ZCEA 4O2AA 5A2QN 3D36A 3A0RA 1BCCH 1TUBB 1W0JG 2P7TC 4R6ZA 1JOYA 5DECA 3OUFA 1VF6C 2UXCO 4MVMA 2Q7EA 5J2TA 4TV9B 1M57B 2P90A 4PDMA 3SJAC 3DC5A 4JI3O 2GUZB 2Z0AA 3WU2Z 3K5OA 3B8NA 4PHZA 3EFFK 5KHGA 1IJGA 2XAQA 1J95A 4KFMA 2IJHA 4H33A 1R3KC 4RQEA 3TCUA 5LYJB 3RYIA 3OM3B 4ZIBA 3RYCA 4TV8A 1Q6UA 1NQTA 2FMLA 3BRCA 1SF9A 3SJBC 2F43G 3CCQV 1Y6XA 2X6CA 3AG1C 3VQWA 2QKAA 4WFGA 3AG4B 2ETNA 1G6UA 3MDSA 3L9DA 3OAAG 4Z2WA 3A8TA 2OTLV 4G28B 2DOSA 2Q0OC 3JATB 3UO3A 2EULA 1JVMA 3KCXA 1OCOB 3M99B 5EBMC 2OYQA 4LBEC 4MSWC 1AJNA 1KB9F 2F4VO 2ZE5A 4DUZO 4A5UB 1JPXA 5JJNB 5LL6Y 1NTZH 5EC1C 2KG7B 4YY3B 2PGGA 1S5LZ 1FJGO 5L3BA 3ETEA 3F5TA 4LFAO 1R6KA 3STZC 1F7YA 4XDJA 4JZGA 1FXVA 1N36O 4DW0A 1YSCA 1TVKB 4PD4F 2UXXA 2WLLB 1M93A 3SJCC 1VQMV 2ZXWC 4W4LA 1K5SA 2ZD9A 1EN5A 1CPYA 1L0NH 1M5IA 3J7AU 1GKFA 4Z1VA 5F2VO 4YJ2B 4O2AB 4J10A 4ASUG 3MD0A 5C93A 5JJEB 5D5QA 3LDDA 2XHBA 1RPOA 5J2TB 4X66O 1BS3A 5KX5A 5J9PC 3THOA 2QKCA 4OPAA 2P67A 1YCIA 1WP7A 4FFKA 3C3TA 5LBQA 5CA0B 3A0BZ 3ZS8C 5LGNA 2GTSA 3K5LA 3KKYA 1I7FA 5AG2A 4ZHQB 2YXHA 3RYIB 4LF8O 3RYCB 1YIJV 1XNQB 5FPOA 1VQPV 4TV8B 4YJ3B 2QWNB 4MVUA 3AG2B 2YIAA 3CWBH 1KMIZ 2IW5A 2CTWA 3OMAB 3RN4A 3ZMZA 4AILC 1J5EO 1BL8A 5IWAB 1VQNV 2Q6AA 2ADPA 2CDYA 4DR1O 3DXRA 1RM1B 5CBGA 2AXTZ 2RQ6A 3KDRA 1Y76A 5CN0A 5LMUB 4X8AA 1OCCB 4JI8B 2W0XA 4UV8A 4DR6B 1BSMA 3S3XA 3ZRWB 2DQ0A 3N2GA 4J11A 2HJDA 2DYSC 1KP3A 4J9ZB 5FNVA 2E75B 1N32B 4CC6A 5B1BC 2Y69B 5LHHA 3T1HO 2IJIA 4KHPO 2A7WA 4H0LB 4ICGA 3QG5A 4XDLA 3SJQC 4FLUA 1H5WA 2UUAB 5L3CA 1EN4A 4DV0B 3RBZA 4LF7B 3H1JH 4PDLA 5GONA 4I9WA 3HB3B 2KSDA 1KD1W 2JEXA 1QBZA 1CEZA 1LUVA 3Q4HB 3RVZA 4DV1B 2DYRC 3IGAC 1H2GA 1QLEB 4N21A 4JTAB 1HNZB 1K8AW 2JGUA 2RN9A 3LNNA 5FPRA 2AHYA 1QLNA 4FM0A 3HKBB 1WA8A 2ZE7A 1FFTB 2EIJB 2A9HA 2QM4A 4DR4O 1HR0O 3CRAA 4LF9B 3T4DA 1Q81W 2B5UA 3ABLC 3JD1A 2EBOA 2OIEA 1PV0A 4FMTA 1MSDA 1HNXO 2BTQB 4MVQA 1R3IC 2EIMB 3I55V 2JRIA 2ZQMA 3W7WA 5BY1A 1IBMO 3UT5A 1N0NA 4X9QA 5LOVA 1R6TA 3KZIZ 5FLXN 5JCOC 2A0LA 4UXNA 2R9IA 2YIBA 1F4MA 2OIGA 4X62B 2VWJA 4BW5A 1R3LC 2QTOA 4B7KA 2QR4A 3PN1A 4FFBB 4FJCC 3SYOA 3FB6C 5H9CA 1RSOA 3RGBA 3F7YC 1Y66A 3EXAA 2IU0A 1FOUA 4WFFA 1FS0G 3FD9A 3D8CA 3B77A 3U10A 5FL7G 5GTHZ 4ABMA 4OX9O 2IJJA 1PD3A 2WLKA 1ZLZA 4QJFB 1OV9A 4U3JA 1S3JA 2HVJC 1R3JC 2ZR2A 4B7EA 4JGSA 4JI6O 1PNKA 4H37A 3WB2A 1ZAUA 4LF4O 2ZDIA 3ABUA 4U7NA 5BR8B 5BZBA 5LA6B 4B3TO 3UCSC 2B1IA 1YI2V 4GKKO 4MVSA 3LSQA 4O4LA 1U96A 4O4JA 4CS3A 3AG4C 4JPRA 1TA8A 2WWWA 4PA6A 2ZR3A 4JYAO 1XREA 4F4LA 3ZHSA 1ORQC 4D7TA 1GN3A 1H8EG 4UB6Z 2IH1C 5ITZA 2NN4A 3IJ4A 1IXMA 1OCOC 3BEHA 5LP6B 3L71H 4GX5A 1S77D 1WA8B 2UUBO 5EBLC 1XL6A 5EZYB 4DR5O 4FVMA 4IYIA 3C3SA 3F7VC 4NXNB 1XEQA 2K9PA 4F6RA 4UV9A 1QQCA 2F23A 1GAXA 3SPIA 2DJVA 1Q7YW 3K59A 4JI7B 2CH7A 1NR1A 2ODMA 2A06H 2N05A 3G6EV 2E5LO 4LF6B 1NBMG 5IY5B 3KCYA 1X59A 4GZRB 2Z5UA 5D5PA 4IYHA 3BABA 1I5XA 3SYQA 1N33B 1XDCA 2X0LA 4JV5O 1Z5WA 4J7ZA 4RO2A 1QCEA 4K3AA 1P84F 1PM9A 2BOCC 3DC6A 1FXKB 3JCUZ 2OT5A 1B04A 1GM8A 1F51A 2EILB 1K97A 3LDEA 4DV3B 3F5WC 1H2KA 1SC5B 2IM9A 3U11A 5KHIA 5IYBO 1TAEA 2OCHA 2Q67A 3FAVA 4O4LB 2WA3A 1AI5A 3AG2C 4LFCB 2O57A 4DO2A 3CCRV 3I5DA 2LQTA 1JFFB 1BGYH 4BR6A 3E8BA 2L6LA 5LGUA 3LSUA 4P9OA 1RM1C 1EBOA 4I0XA 4N23A 4EB6B 2WSSG 4LWSA 4X1IB 4J7JA 1SQQH 4J41A 2AZ0A 4NR1A 4F6RB 3R65A 2Q4PA 2ILMA 3CPWU 1M56B 1KUQA 1IZ3A 1G8MA 1OCCC 1PNMA 5B66Z 1GMGA 1P7GA 5C8YB 2JJ2G 2CH7B 2Q7HA 2QTSA 1XMOO 4UCVA 3QO5A 2E76B 3BVOA 5CA1A 3VQVA 5B5EZ 3HKDA 4YHHB 3CB2A 3K9AA 4I5SA 2WLHA 1VQ4V 4YY3O 2NNUA 1WPXA 3AK1A 1VQOV 2Y69C 4PA3A 5EYPB 4FLZA 1EZVH 3RW0A 2XOKG 4QPKA 4IIJA 1E1QG 3RYHA 3ZHTA 3JAWB 2AGAA 1LUWA 5B3SB 1K33A 3MHHC 4LFBB 1SZXA 3RWRD 1KP2A 4UB8Z 2VWKA 1S72V 4GKJB 2UU9O 2Q68A 2LJ2A 5KA6A 1O9HA 2F95B 1SA0B 2ZKOA 3FB8C 1SQXH 3H1IH 1N4CA 5EBWC 1QLEC 2JIZG 4PA7A 1V9PA 4TWKA 1DLBA 1G1XB 3FYIB 2LFSA 1US6A 1AI6A 3JASB 4NVPA 4DV5B 3ABKB 5IYCO 2Q5ZA 2EIJC 3SYAA 1VF5B 3TGUH 3B4SA 1YHQV 1XNQO 2PYJA 3ZN0A 1KU9A 4W4KA 4X1YB 1KYOF 4B3MB 3X2QB 2VQFB 1BQZA 4DV7B 4DUYB 1NKDA 2Z3YA 3DSQA 1NT2B 3K58A 2EIMC 4MT8A 2HVKC 1ZTEA 4I0XB 4FLWA 3CX5F 1AVMA 3OGCC 4CS2A 4K8XA 5IWAO 4X65B 2WLNA 2FKXA 2DWDC 3SYCA 1AP5A 3HKEB 4ZOLA 1THZA 2D3OW 1N0JA 3E89A 3ZX6A 4QPJA 4IGGA 2YEVB 3J81N 4FLVA 4JI8O 4TSFG 4I4TB 4DR6O 4Q20A 1WNSA 3H9VA 1FFXA 4BIZA 4ZKIA 2Q69A 4X1KB 4HBNA 2BSKB 4JI0O 4I7ZB 1IBLB 3IFXA 1N34B 3CCEV 5KHJA 1MSWD 1GM9A 4HNAA 1BZKA 2YS8A 4G2KA 1K4CC 3MAQA 2G38A 3BA9A 4DR3B 2GSMB 5K1PA 3ZHQA 2QWPB 5HFMA 1SETA 4DK1A 5KHKA 1QU7A 2CUGA 3ZMSA 1W2BU 1WLEA 5L3GA 1K3EA 2UUAO 1AB3A 5IJ0A 4DV0O 4DR7B 2A3QA 4LP8A 4KXRA 4LF7O 4IHJA 1XMQB 3CCJV 1GM7A 2ZIMA 3TXQA 2M7WA 1PNLA 3N27A 2XNDG 3OUSA 2YIBD 1KQSU 4DV1O 5LP6C 2UUCB 4PA9A 4K0KB 3J80N 1HNZO 4EFBA 3ZIAG 1MNGA 3U0ZA 1XNRB 1S5HC 3HKCA 1NI8A 4CS4A 3NXSA 3KG2A 4LF9O 4WBNA 1VF6A 4O4IA 2Q73A 2PUSA 4X89A 1JNBA 4FK5C 1YF2A 1I94B 3CSXA 2LP7A 2ZIOA 3T4ZA 5JWPA 5IY5C 5BXZA 1FD9A 1OJHA 4GLXA 3N2KA 2ZM6B 1O9GA 3I56V 2YUAA 1BMFG 3QF7A 5KA5A 1E1RG 4DV6O 1XI1A 1YZBA 1S5JA 4X62O 1NJIW 3IC7A 5LXTA 2LGQA 1ZL8A 5KLVH 3BY6A 1FFXB 4RUFA 1FXKC 1DF4A 3EHBB 4EKWA 2EILC 2F4VB 1D2DA 2HKOA 4HNAB 3ZBHA 4XBFA 3SR2C 1D5AA
chains in the Genus database with same CATH topology
3KKYA 1LUVA 5AG2A 3IC9A 3K9SA 2QKAA 2GDSA 5A9GA 3MDSA 3QVNA 1XREA 4GUNA 1AR4A 1Y67A 1GN6A 1GN4A 1VEWA 3BFRA 1GN3A 1ZUQA 3EVKA 3RN4A 3TJTA 1I08A 1ZSPA 4BR6A 1MA1A 1MNGA 1XUQA 3C3SA 3LSUA 4E4EA 2ADPA 2CDYA 1MSDA 3KDRA 1ZTEA 3OT7A 2RCVA 1N0NA 1AVMA 4X9QA 1P7GA 1BT8A 1WB7A 4JZ2A 1AP5A 1XILA 2CE4A 1BSMA 1WB8A 4JYYA 4JZGA 1N0JA 2P4KA 2AW9A 1MMMA 3AK1A 1JA8A 4C7UA 1B06A 1XDCA 1KKCA 1IX9A 1EN5A 1EN6A 3CEIA 1QNMA 1AP6A 1ZLZA 1EM1A 1GN2A 1PM9A 3DC5A 3DC6A 3AK3A 1LUWA 1VARA 1JR9A 1AR5A 1BS3A 1EN4A 1SZXA 2ADQB 2QKCA 1I0HA 1PL4A 4F6EA 4FFKA 4YIPA 1IXBA 3C3TA 4YIOA 1IDSA 3AK2A 1D5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKY A;  1LUV A;  5AG2 A;  3IC9 A;  3K9S A;  2QKA A;  2GDS A;  5A9G A;  3MDS A;  3QVN A;  1XRE A;  4GUN A;  1AR4 A;  1Y67 A;  1GN6 A;  1GN4 A;  1VEW A;  3BFR A;  1GN3 A;  1ZUQ A;  3EVK A;  3RN4 A;  3TJT A;  1I08 A;  1ZSP A;  4BR6 A;  1MA1 A;  1MNG A;  1XUQ A;  3C3S A;  3LSU A;  4E4E A;  2ADP A;  2CDY A;  1MSD A;  1ZTE A;  3OT7 A;  2RCV A;  1N0N A;  1AVM A;  4X9Q A;  1P7G A;  1BT8 A;  1WB7 A;  4JZ2 A;  1AP5 A;  1XIL A;  2CE4 A;  1BSM A;  1WB8 A;  4JYY A;  4JZG A;  1N0J A;  2P4K A;  2AW9 A;  1MMM A;  3AK1 A;  1JA8 A;  4C7U A;  1B06 A;  1XDC A;  1KKC A;  1IX9 A;  1EN5 A;  1EN6 A;  3CEI A;  1QNM A;  1AP6 A;  1ZLZ A;  1EM1 A;  1GN2 A;  1PM9 A;  3DC5 A;  3DC6 A;  3AK3 A;  1LUW A;  1VAR A;  1JR9 A;  1AR5 A;  1BS3 A;  1EN4 A;  1SZX A;  2ADQ B;  2QKC A;  1I0H A;  1PL4 A;  4F6E A;  4FFK A;  4YIP A;  1IXB A;  3C3T A;  4YIO A;  1IDS A;  3AK2 A;  1D5N A; 
#chains in the Genus database with same CATH topology
 1QHT A;  3ZMV A;  1KBH A;  2EZP A;  1FJG B;  5BR8 O;  4JTC B;  5JVD A;  2QKS A;  1DTO A;  3ZRS A;  4FM1 A;  2X6B A;  1N36 B;  5KX5 B;  4CH3 A;  3ZMT A;  1I08 A;  4PJ0 Z;  4AI8 A;  1JCH A;  2XAH A;  2PTM A;  4X64 B;  4MTF A;  1L0L H;  2KQX A;  4E4E A;  3QO7 A;  1XL4 A;  3RVY A;  4RUE A;  1ROP A;  2EIK B;  3CC2 V;  1M9N A;  2FB5 A;  3L72 H;  1M56 C;  1HDJ A;  2XUM A;  3CE2 A;  3HKC B;  3TET A;  2CTP A;  4I50 A;  1K92 A;  4J80 A;  1H8H G;  4NXN O;  4WBN B;  3B8M A;  5IYZ A;  2VS0 A;  4JZ2 A;  2RJZ A;  1X4T A;  4LNU A;  1JJ2 U;  1XIL A;  3A2F A;  3L73 H;  2PF4 E;  2GBO A;  2QGN A;  3A0H Z;  2R9A A;  1K7D A;  2EZO A;  3N2K B;  4LF6 O;  1KKC A;  4TQD A;  1IX9 A;  4FLY A;  2DW4 A;  3DXR B;  1ENV A;  3JAK A;  4FIP C;  5LHG A;  1URF A;  3CRM A;  3S3W A;  1Y76 B;  1N33 O;  5LXT B;  1OCZ C;  1ZL8 B;  5B3S C;  1DF5 A;  1XQ8 A;  1H2L A;  1SQG A;  4UCU A;  3QNE A;  1AI7 A;  2Y48 A;  3N2G B;  2E3C A;  2VQE B;  3SPH A;  3SPC A;  4U3F H;  5GTI Z;  2CAZ C;  3G80 A;  1M57 C;  5FNV B;  1Z5V A;  2HJF C;  3OMI B;  4KL1 A;  1CXZ B;  2YXL A;  4DV3 O;  4LF5 B;  4Q6G A;  2IJK A;  1GRJ A;  1K4D C;  1SES A;  1UPG A;  5KHH A;  3STL C;  1GN6 A;  3ABK C;  2YI9 A;  4CH5 A;  2M6Y A;  3W7S A;  4QNH B;  3JSN A;  1V55 B;  3T1Y B;  3CCS V;  3G4S V;  1EZJ A;  2FYU H;  3X2Q C;  2QJ1 A;  4BIU A;  2W6J G;  4ZI7 A;  4LFC O;  3K04 A;  1SRY A;  1VMG A;  4CBC A;  5GON B;  4EEQ A;  2DQ3 A;  1F4N A;  1LNQ A;  1RFY A;  4B3S B;  1I5Y A;  5J2U A;  2HHH B;  2EJ7 A;  5IJ9 A;  4QE7 A;  2JEU A;  3D3I A;  1VQK V;  3ASO B;  4X20 A;  4I55 A;  3K79 A;  2C2A A;  4JYY A;  4LNU B;  2QWQ B;  4QGP A;  1PPJ H;  1Y74 A;  3CHX A;  1G4Y B;  5L3F A;  4TT3 G;  1BQ0 A;  3H1L H;  2VRZ A;  3W7T A;  2V1D A;  4YHH O;  2UXD B;  3L74 H;  2XAS A;  1QNM A;  3OTF A;  3UT5 B;  3JAK B;  2ATK C;  2CTQ A;  4BAY A;  5LOV B;  2Y4U A;  1PKX A;  3FB5 C;  3WG7 B;  1VAR A;  2ZNI A;  3JAL A;  3BPZ A;  2Q8V A;  2YC0 A;  4CH6 A;  3D36 C;  1Q8I A;  1RSO B;  3HPL C;  3CME V;  3OGI B;  1H2N A;  3OTO B;  1VIB A;  4PA4 A;  4GX0 A;  4ZBM A;  2GDS A;  5LMN B;  4GKJ O;  1LR1 A;  2DWE C;  3L75 H;  4U3J B;  5CB4 A;  1FAF A;  3GWO A;  4WFA V;  4GX1 A;  1V54 B;  1FKA O;  3W7U A;  2AZ2 A;  1U97 A;  2CGN A;  3B2E E;  5B1A B;  4DV5 O;  4IT5 A;  4QE9 A;  3CJH A;  4DR2 B;  2QA4 V;  4O4H A;  1R6N A;  1AI4 A;  4JI4 B;  2R70 A;  3VQY A;  4ZI7 B;  3OW2 U;  4FPP A;  2WA4 A;  4B3R B;  5GW7 A;  3OT7 A;  4O4J B;  1Q82 W;  2UXB B;  2RCV A;  1P7B A;  1T5E A;  1VQ6 V;  4B3M O;  1FPO A;  4HZ3 A;  4DV7 O;  4LF4 B;  4DUY O;  1XHZ A;  3ABM B;  2QWR B;  3LSS A;  5L3E A;  1Q86 W;  3O9O A;  4J9Y B;  1SZT A;  3VOU A;  3ZMU A;  3T2M A;  5ITZ B;  3WB1 A;  3JSL A;  4I55 B;  4KUM A;  1VQ5 V;  5LYJ A;  4J42 A;  3CD6 V;  3TK1 A;  1QVF U;  1IBK B;  4MTX A;  4JI5 B;  4J7K A;  4R7C A;  3D3Q A;  4PI0 A;  4AQY B;  1GN2 A;  1VQ9 V;  2HP8 A;  1XOU A;  3GVM A;  4NXM B;  3SGI A;  2UXN A;  3K5M A;  3JAT A;  4PEL A;  1WP8 A;  2UUB B;  3OR6 C;  1I0H A;  3E8F A;  4O2B A;  4TUY A;  1IBL O;  3CMA V;  4CZZ A;  1KC8 W;  2RMK B;  5IT9 N;  3JAL B;  4WFH A;  3E83 A;  4UVC A;  4JYB A;  2Y4T A;  3LDC A;  5TIS Z;  2PY5 A;  3ZRX A;  2JS5 A;  2BCC H;  4YXW G;  3SPJ A;  2R9R B;  4GUN A;  2YSU B;  4JYC A;  3FB7 C;  1GTO A;  3EVK A;  1SKV A;  3TJT A;  1NVP B;  1NR7 A;  4PDV A;  4DW1 A;  1TVK A;  2WLL A;  4JI1 B;  1B6Q A;  3APQ A;  4UFZ A;  5E1A C;  2RDC A;  3BCC H;  4YJ2 A;  1GO3 F;  3CJH B;  2UUC O;  2HG5 C;  3GWK C;  4K0K O;  4O4H B;  5H5N A;  2R72 A;  2ZE8 A;  3DGE A;  3FAV B;  4MVZ A;  1UJW B;  1XNR O;  3P32 A;  1WJZ A;  3GB7 C;  4H44 B;  2ZE6 A;  1L8D A;  5BMV A;  2X7R B;  5CMU A;  4WCE V;  4I9Q A;  1MMM A;  1I94 O;  3ML0 A;  4P9P A;  5KUK A;  2V7Q G;  2V4D A;  5CA0 A;  4DV4 B;  2LO1 A;  5B1O A;  3FKS G;  3JAR A;  4JAS A;  3WFV A;  4ZHQ A;  5KUM A;  2OCC B;  3E86 A;  1EN6 A;  4LWS B;  5KMG A;  1P49 A;  2ZM6 O;  4YJ3 A;  5E79 Z;  1EM1 A;  1VQ7 V;  3K03 A;  1JMK C;  2YIC A;  2GTA A;  3JCZ A;  1VP7 A;  1JR9 A;  5LMU O;  1YDX A;  5CA1 B;  2FL4 A;  3HKD B;  4GT1 A;  4LCU C;  3SDL A;  1NS1 A;  4JI2 B;  2XAF A;  1Q6H A;  3T1C A;  3UQ8 A;  4YIP A;  1SQF A;  1IXB A;  4XDK A;  1Q3E A;  3PJS K;  4FZ0 A;  4O2B B;  4TUY B;  2QSA A;  3CCU V;  3CXC U;  3WB0 A;  2H94 A;  2QWO B;  5DM6 V;  4UCR A;  1XMO B;  2D2C B;  4R50 A;  4U7O A;  1AJQ A;  3H1K H;  1N32 O;  1SQV H;  4IIJ B;  1BHA A;  3ETG A;  5LHI A;  2MK3 A;  3RYH B;  5JQG A;  4DV2 B;  2PI4 A;  1HNW B;  3OEE G;  1V55 C;  2P6J A;  3ZRW A;  1EFR G;  3OFN G;  4P2Z A;  4DYL A;  1E79 G;  1MA1 A;  4PDR A;  1SS3 A;  2YDE A;  3CP1 A;  1Z2G A;  4CH4 A;  2XT9 A;  1DK1 A;  2BOB C;  4H13 B;  2WLM A;  1OCR B;  3FYE B;  2NLJ C;  1A32 A;  4X64 O;  2WPD G;  3CC7 V;  4MTG A;  2DN9 A;  3CRR A;  2KKW A;  3TXS A;  1BT8 A;  3ASO C;  3SPG A;  2F93 B;  3K08 A;  2UU9 B;  3CRQ A;  5EK0 A;  1P4R A;  3ZRV A;  2P4K A;  2AW9 A;  2HEP A;  5BMV B;  2UXC B;  4R8C A;  2P4V A;  2WLI A;  1WAZ A;  4C7U A;  1B06 A;  4JI3 B;  2Q0A A;  5L3D A;  3JD0 A;  3Q4H A;  1QVG U;  1B3Q A;  2HR3 A;  1MZE A;  1PL0 A;  3JAR B;  3FX7 A;  1K73 W;  4X88 A;  1AP6 A;  2KB1 A;  5KMG B;  4K8Z A;  4HYO A;  4FLT A;  1M1K W;  3WG7 C;  3HKB A;  4EFE A;  1YJW V;  2QDO A;  3QTC A;  1BHB A;  2DE0 X;  4OGQ B;  4ZOL B;  3RYF A;  2HLD G;  3OR7 C;  1RPR A;  2GV9 A;  3ASN B;  3CCV V;  2N74 A;  5IDJ A;  2F66 C;  3G6B A;  1VQ8 V;  1W0K G;  2BTQ A;  1BE3 H;  3IC9 A;  4UVB A;  1QR8 A;  5JH7 A;  2XAJ A;  2YXY A;  2VQE O;  1PP9 H;  3VQX A;  2Q9L A;  1GN4 A;  1MG1 A;  1V54 C;  3UO2 A;  4DUZ B;  1N8R W;  2ZDI C;  1ZUQ A;  1JQ0 A;  1KKD A;  4RQF A;  5DED A;  3MHS C;  5IYD O;  3L70 H;  1NH2 B;  4DK0 A;  5JQG B;  4LF5 O;  5B1A C;  3SYP A;  3IAY A;  4MVO A;  2AHZ A;  2F1M A;  4FFB A;  5LGT A;  1HW7 A;  3AEI A;  4QIW F;  3BHP A;  3CYO A;  2JJ1 G;  4JI0 B;  3K0D A;  3DTU B;  3T1Y O;  5IJ0 B;  4LFA B;  1HP8 A;  3BAA A;  1R73 A;  1ZWI C;  5KAF Z;  4IHJ B;  5KAI Z;  4TQF A;  3JD3 A;  3ABM C;  4GCZ A;  4LH7 A;  1MAB G;  4P30 A;  1M4U A;  3K57 A;  1YJ9 V;  2OTJ V;  3OE7 G;  2YID A;  2EIN B;  1Q90 D;  1XHX A;  4WFB V;  4B3S O;  2HHH O;  2NR5 A;  2QM7 A;  1H2M A;  4OXS A;  1VQL V;  3AG3 B;  4OPH A;  5LA6 A;  4NTX A;  4X66 B;  2WLI B;  3E8G A;  5CBH A;  4RWU A;  4O4I B;  4MW3 A;  4D7S A;  1WPB A;  2JS3 A;  3HR0 A;  4G27 B;  4MVR A;  4UCT A;  5EC2 C;  1NVP D;  3P3P A;  4JI7 O;  3ZJZ A;  2UXD O;  1YVW A;  5K1X A;  5LP6 A;  2Y0P A;  4LF8 B;  4DXW A;  2YI8 A;  4JAV A;  5HFL A;  5H6Q A;  4WF9 V;  4GX2 A;  5EZY A;  3RYF B;  1YTF B;  1IUR A;  3QO8 A;  3ZHR A;  1MOF A;  1AR1 B;  3K9S A;  1FXH A;  3AG1 B;  2BE3 A;  1J5E B;  1NTK H;  1UFI A;  1F23 A;  5JH7 B;  2IH3 C;  3ETD A;  4DR1 B;  1CP9 A;  4PV1 B;  3OTO O;  2FTK A;  3CCM V;  3APO A;  1Q6I A;  2ZIN A;  4IL6 Z;  1GK9 A;  5LMN O;  4DV6 B;  2P5O A;  1GH6 A;  1W59 A;  1ZSP A;  4BW9 A;  2DMX A;  3BA8 A;  3M8A A;  2PZS A;  2GHY A;  2CTR A;  2LW1 A;  4UVA A;  1IVS A;  4NTW A;  3ICX A;  1Q5O A;  5JVD B;  3AG7 A;  4BIO A;  3E8H A;  4DR2 O;  4JI4 O;  1FXK A;  1WB7 A;  4JAA A;  2ITC C;  2LGW A;  3C90 A;  2QEX V;  4L8J A;  2EJR A;  4B3R O;  3JD2 A;  1ARO P;  2UXB O;  1WB8 A;  3T1H B;  4KHP B;  4DRX A;  5CA3 A;  3UM7 A;  1JA8 A;  1YXB A;  2ZXW B;  2OCC C;  2B9Z A;  2OWO A;  3ZED A;  5IE9 A;  3P30 A;  3NR7 A;  1NTM H;  5EIB D;  3CEI A;  2W0F C;  3K0G A;  2CK3 G;  1ZX3 A;  2Y0I A;  1RP3 B;  2JGD A;  4I50 B;  3G71 V;  1IBK O;  3AK3 A;  4JI5 O;  5IYZ B;  4E2L A;  3OMN B;  1JJO A;  4LH6 A;  1AR5 A;  3UKM A;  3ZCC A;  1JFF A;  2ADQ B;  1QR9 A;  4AQY O;  3H01 A;  1PL4 A;  1YJN V;  3JAM N;  2Q7G A;  4F6E A;  4NXM O;  4TOI A;  4YIO A;  1IDS A;  5H6R A;  1D5N A;  1WN7 A;  4EB6 A;  1R1B A;  1SQB H;  2ZT9 B;  3K5N A;  4X1I A;  3VBB A;  3RT3 C;  4DR4 B;  1MZF A;  3QVN A;  2BTO A;  1HR0 B;  4NYK A;  2LW7 A;  5EIB C;  4LC1 A;  5C8Y A;  1AR4 A;  3ABT A;  4UUJ C;  1AJP A;  3OD4 A;  4CC5 A;  4UCS A;  4L87 A;  1HNX B;  3FFQ A;  2E74 B;  1OZ0 A;  4AHC A;  1IBM B;  4LFB O;  2HFE C;  2WLJ A;  1H2S B;  1Q43 A;  3OEH G;  2XAG A;  5EYP A;  3RFR A;  1OCR C;  4MTO A;  1L1F A;  3E2E A;  3E22 A;  5JCO A;  1COW G;  4JI1 O;  4JF3 A;  4MS2 A;  3JAW A;  3M7M X;  3CC4 V;  2MW2 B;  2CE4 A;  2RNB A;  4BWA A;  3ZHU A;  1TUB A;  4OX9 B;  1TUE B;  3CXH F;  2B1G A;  4FZ1 A;  2DYS B;  1SA0 A;  2EX3 A;  4WFE A;  3B40 A;  4DRX B;  4JI6 B;  1XBL A;  2VQF O;  4TV9 A;  3K3W A;  4D6T H;  5B1B B;  2GUZ A;  3CCL V;  2L35 A;  1FYJ A;  1NU1 H;  1HWY A;  1K9M W;  5J2U B;  3CS5 A;  4HAM A;  5IJ9 B;  3JAS A;  1TGO A;  2K1E A;  2PYL A;  4DV4 O;  3B09 A;  1NH2 D;  2JK5 C;  4B3T B;  1K5Q A;  4X20 B;  3R66 A;  4GKK B;  2JGD B;  3JYC A;  4K35 A;  4X65 O;  3W7X A;  4KP4 A;  2ZNJ A;  4X1Y A;  3ASN C;  3E35 A;  1DGS A;  4NB5 A;  1NZ6 A;  4JYA B;  1Y74 B;  2CGO A;  3AK2 A;  2QM8 A;  3H1H H;  4MW8 A;  3JD4 A;  2JVD A;  1K34 A;  1JX9 A;  1AIL A;  4NKG B;  5JJJ B;  4B08 A;  2QE7 G;  4JI2 O;  5B1N A;  2DYR B;  1OHH G;  1Y4M A;  5A9G A;  1S76 D;  4UCO A;  5DN6 G;  2LFR A;  2WAM A;  4DR5 B;  3LNM B;  1YEW A;  1VF7 A;  1Y67 A;  2A79 B;  2X6A A;  1VEW A;  3BFR A;  4NTY A;  1S0V A;  3HKE A;  2IBZ H;  2XTA A;  5CBF A;  3P3N A;  4FLX A;  4FM2 A;  4GYC B;  1N34 O;  4PI2 A;  3K06 A;  1KEC A;  4DR3 O;  3LUT B;  1XUQ A;  2IU3 A;  3O65 A;  3ABL B;  2YEV A;  4DV2 O;  4Z1M G;  3ZN1 A;  3G67 A;  4I4T A;  2H8P C;  2E5L B;  1HNW O;  1H38 A;  2H3O A;  2KG7 A;  4LR3 A;  2PI5 A;  3ETQ A;  2ARH A;  2N04 A;  4X1K A;  2BSK A;  1M90 W;  5H2F Z;  4JTD B;  4DR7 O;  1YIT V;  2P06 A;  2P22 C;  5CB4 B;  3E22 B;  2EIN C;  1XMQ O;  4JAU A;  1SER A;  4JV5 B;  3CRC A;  3ZHV A;  2JDI G;  1YTF D;  4RAI A;  1OCZ B;  2W6I G;  2EIK C;  3AG3 C;  2ITD C;  1SQP H;  2ZCE A;  4O2A A;  5A2Q N;  3D36 A;  3A0R A;  1BCC H;  1TUB B;  1W0J G;  2P7T C;  4R6Z A;  1JOY A;  5DEC A;  3OUF A;  1VF6 C;  2UXC O;  4MVM A;  2Q7E A;  5J2T A;  4TV9 B;  1M57 B;  2P90 A;  4PDM A;  3SJA C;  3DC5 A;  4JI3 O;  2GUZ B;  2Z0A A;  3WU2 Z;  3K5O A;  3B8N A;  4PHZ A;  3EFF K;  5KHG A;  1IJG A;  2XAQ A;  1J95 A;  4KFM A;  2IJH A;  4H33 A;  1R3K C;  4RQE A;  3TCU A;  5LYJ B;  3RYI A;  3OM3 B;  4ZIB A;  3RYC A;  4TV8 A;  1Q6U A;  1NQT A;  2FML A;  3BRC A;  1SF9 A;  3SJB C;  2F43 G;  3CCQ V;  1Y6X A;  2X6C A;  3AG1 C;  3VQW A;  2QKA A;  4WFG A;  3AG4 B;  2ETN A;  1G6U A;  3MDS A;  3L9D A;  3OAA G;  4Z2W A;  3A8T A;  2OTL V;  4G28 B;  2DOS A;  2Q0O C;  3JAT B;  3UO3 A;  2EUL A;  1JVM A;  3KCX A;  1OCO B;  3M99 B;  5EBM C;  2OYQ A;  4LBE C;  4MSW C;  1AJN A;  1KB9 F;  2F4V O;  2ZE5 A;  4DUZ O;  4A5U B;  1JPX A;  5JJN B;  5LL6 Y;  1NTZ H;  5EC1 C;  2KG7 B;  4YY3 B;  2PGG A;  1S5L Z;  1FJG O;  5L3B A;  3ETE A;  3F5T A;  4LFA O;  1R6K A;  3STZ C;  1F7Y A;  4XDJ A;  4JZG A;  1FXV A;  1N36 O;  4DW0 A;  1YSC A;  1TVK B;  4PD4 F;  2UXX A;  2WLL B;  1M93 A;  3SJC C;  1VQM V;  2ZXW C;  4W4L A;  1K5S A;  2ZD9 A;  1EN5 A;  1CPY A;  1L0N H;  1M5I A;  3J7A U;  1GKF A;  4Z1V A;  5F2V O;  4YJ2 B;  4O2A B;  4J10 A;  4ASU G;  3MD0 A;  5C93 A;  5JJE B;  5D5Q A;  3LDD A;  2XHB A;  1RPO A;  5J2T B;  4X66 O;  1BS3 A;  5KX5 A;  5J9P C;  3THO A;  2QKC A;  4OPA A;  2P67 A;  1YCI A;  1WP7 A;  4FFK A;  3C3T A;  5LBQ A;  5CA0 B;  3A0B Z;  3ZS8 C;  5LGN A;  2GTS A;  3K5L A;  3KKY A;  1I7F A;  5AG2 A;  4ZHQ B;  2YXH A;  3RYI B;  4LF8 O;  3RYC B;  1YIJ V;  1XNQ B;  5FPO A;  1VQP V;  4TV8 B;  4YJ3 B;  2QWN B;  4MVU A;  3AG2 B;  2YIA A;  3CWB H;  1KMI Z;  2IW5 A;  2CTW A;  3OMA B;  3RN4 A;  3ZMZ A;  4AIL C;  1J5E O;  1BL8 A;  5IWA B;  1VQN V;  2Q6A A;  2ADP A;  2CDY A;  4DR1 O;  3DXR A;  1RM1 B;  5CBG A;  2AXT Z;  2RQ6 A;  3KDR A;  1Y76 A;  5CN0 A;  5LMU B;  4X8A A;  1OCC B;  4JI8 B;  2W0X A;  4UV8 A;  4DR6 B;  1BSM A;  3S3X A;  3ZRW B;  2DQ0 A;  3N2G A;  4J11 A;  2HJD A;  2DYS C;  1KP3 A;  4J9Z B;  5FNV A;  2E75 B;  1N32 B;  4CC6 A;  5B1B C;  2Y69 B;  5LHH A;  3T1H O;  2IJI A;  4KHP O;  2A7W A;  4H0L B;  4ICG A;  3QG5 A;  4XDL A;  3SJQ C;  4FLU A;  1H5W A;  2UUA B;  5L3C A;  1EN4 A;  4DV0 B;  3RBZ A;  4LF7 B;  3H1J H;  4PDL A;  5GON A;  4I9W A;  3HB3 B;  2KSD A;  1KD1 W;  2JEX A;  1QBZ A;  1CEZ A;  1LUV A;  3Q4H B;  3RVZ A;  4DV1 B;  2DYR C;  3IGA C;  1H2G A;  1QLE B;  4N21 A;  4JTA B;  1HNZ B;  1K8A W;  2JGU A;  2RN9 A;  3LNN A;  5FPR A;  2AHY A;  1QLN A;  4FM0 A;  3HKB B;  1WA8 A;  2ZE7 A;  1FFT B;  2EIJ B;  2A9H A;  2QM4 A;  4DR4 O;  1HR0 O;  3CRA A;  4LF9 B;  3T4D A;  1Q81 W;  2B5U A;  3ABL C;  3JD1 A;  2EBO A;  2OIE A;  1PV0 A;  4FMT A;  1MSD A;  1HNX O;  2BTQ B;  4MVQ A;  1R3I C;  2EIM B;  3I55 V;  2JRI A;  2ZQM A;  3W7W A;  5BY1 A;  1IBM O;  3UT5 A;  1N0N A;  4X9Q A;  5LOV A;  1R6T A;  3KZI Z;  5FLX N;  5JCO C;  2A0L A;  4UXN A;  2R9I A;  2YIB A;  1F4M A;  2OIG A;  4X62 B;  2VWJ A;  4BW5 A;  1R3L C;  2QTO A;  4B7K A;  2QR4 A;  3PN1 A;  4FFB B;  4FJC C;  3SYO A;  3FB6 C;  5H9C A;  1RSO A;  3RGB A;  3F7Y C;  1Y66 A;  3EXA A;  2IU0 A;  1FOU A;  4WFF A;  1FS0 G;  3FD9 A;  3D8C A;  3B77 A;  3U10 A;  5FL7 G;  5GTH Z;  4ABM A;  4OX9 O;  2IJJ A;  1PD3 A;  2WLK A;  1ZLZ A;  4QJF B;  1OV9 A;  4U3J A;  1S3J A;  2HVJ C;  1R3J C;  2ZR2 A;  4B7E A;  4JGS A;  4JI6 O;  1PNK A;  4H37 A;  3WB2 A;  1ZAU A;  4LF4 O;  2ZDI A;  3ABU A;  4U7N A;  5BR8 B;  5BZB A;  5LA6 B;  4B3T O;  3UCS C;  2B1I A;  1YI2 V;  4GKK O;  4MVS A;  3LSQ A;  4O4L A;  1U96 A;  4O4J A;  4CS3 A;  3AG4 C;  4JPR A;  1TA8 A;  2WWW A;  4PA6 A;  2ZR3 A;  4JYA O;  1XRE A;  4F4L A;  3ZHS A;  1ORQ C;  4D7T A;  1GN3 A;  1H8E G;  4UB6 Z;  2IH1 C;  5ITZ A;  2NN4 A;  3IJ4 A;  1IXM A;  1OCO C;  3BEH A;  5LP6 B;  3L71 H;  4GX5 A;  1S77 D;  1WA8 B;  2UUB O;  5EBL C;  1XL6 A;  5EZY B;  4DR5 O;  4FVM A;  4IYI A;  3C3S A;  3F7V C;  4NXN B;  1XEQ A;  2K9P A;  4F6R A;  4UV9 A;  1QQC A;  2F23 A;  1GAX A;  3SPI A;  2DJV A;  1Q7Y W;  3K59 A;  4JI7 B;  2CH7 A;  1NR1 A;  2ODM A;  2A06 H;  2N05 A;  3G6E V;  2E5L O;  4LF6 B;  1NBM G;  5IY5 B;  3KCY A;  1X59 A;  4GZR B;  2Z5U A;  5D5P A;  4IYH A;  3BAB A;  1I5X A;  3SYQ A;  1N33 B;  1XDC A;  2X0L A;  4JV5 O;  1Z5W A;  4J7Z A;  4RO2 A;  1QCE A;  4K3A A;  1P84 F;  1PM9 A;  2BOC C;  3DC6 A;  1FXK B;  3JCU Z;  2OT5 A;  1B04 A;  1GM8 A;  1F51 A;  2EIL B;  1K97 A;  3LDE A;  4DV3 B;  3F5W C;  1H2K A;  1SC5 B;  2IM9 A;  3U11 A;  5KHI A;  5IYB O;  1TAE A;  2OCH A;  2Q67 A;  3FAV A;  4O4L B;  2WA3 A;  1AI5 A;  3AG2 C;  4LFC B;  2O57 A;  4DO2 A;  3CCR V;  3I5D A;  2LQT A;  1JFF B;  1BGY H;  4BR6 A;  3E8B A;  2L6L A;  5LGU A;  3LSU A;  4P9O A;  1RM1 C;  1EBO A;  4I0X A;  4N23 A;  4EB6 B;  2WSS G;  4LWS A;  4X1I B;  4J7J A;  1SQQ H;  4J41 A;  2AZ0 A;  4NR1 A;  4F6R B;  3R65 A;  2Q4P A;  2ILM A;  3CPW U;  1M56 B;  1KUQ A;  1IZ3 A;  1G8M A;  1OCC C;  1PNM A;  5B66 Z;  1GMG A;  1P7G A;  5C8Y B;  2JJ2 G;  2CH7 B;  2Q7H A;  2QTS A;  1XMO O;  4UCV A;  3QO5 A;  2E76 B;  3BVO A;  5CA1 A;  3VQV A;  5B5E Z;  3HKD A;  4YHH B;  3CB2 A;  3K9A A;  4I5S A;  2WLH A;  1VQ4 V;  4YY3 O;  2NNU A;  1WPX A;  3AK1 A;  1VQO V;  2Y69 C;  4PA3 A;  5EYP B;  4FLZ A;  1EZV H;  3RW0 A;  2XOK G;  4QPK A;  4IIJ A;  1E1Q G;  3RYH A;  3ZHT A;  3JAW B;  2AGA A;  1LUW A;  5B3S B;  1K33 A;  3MHH C;  4LFB B;  1SZX A;  3RWR D;  1KP2 A;  4UB8 Z;  2VWK A;  1S72 V;  4GKJ B;  2UU9 O;  2Q68 A;  2LJ2 A;  5KA6 A;  1O9H A;  2F95 B;  1SA0 B;  2ZKO A;  3FB8 C;  1SQX H;  3H1I H;  1N4C A;  5EBW C;  1QLE C;  2JIZ G;  4PA7 A;  1V9P A;  4TWK A;  1DLB A;  1G1X B;  3FYI B;  2LFS A;  1US6 A;  1AI6 A;  3JAS B;  4NVP A;  4DV5 B;  3ABK B;  5IYC O;  2Q5Z A;  2EIJ C;  3SYA A;  1VF5 B;  3TGU H;  3B4S A;  1YHQ V;  1XNQ O;  2PYJ A;  3ZN0 A;  1KU9 A;  4W4K A;  4X1Y B;  1KYO F;  4B3M B;  3X2Q B;  2VQF B;  1BQZ A;  4DV7 B;  4DUY B;  1NKD A;  2Z3Y A;  3DSQ A;  1NT2 B;  3K58 A;  2EIM C;  4MT8 A;  2HVK C;  1ZTE A;  4I0X B;  4FLW A;  3CX5 F;  1AVM A;  3OGC C;  4CS2 A;  4K8X A;  5IWA O;  4X65 B;  2WLN A;  2FKX A;  2DWD C;  3SYC A;  1AP5 A;  3HKE B;  4ZOL A;  1THZ A;  2D3O W;  1N0J A;  3E89 A;  3ZX6 A;  4QPJ A;  4IGG A;  2YEV B;  3J81 N;  4FLV A;  4JI8 O;  4TSF G;  4I4T B;  4DR6 O;  4Q20 A;  1WNS A;  3H9V A;  1FFX A;  4BIZ A;  4ZKI A;  2Q69 A;  4X1K B;  4HBN A;  2BSK B;  4JI0 O;  4I7Z B;  1IBL B;  3IFX A;  1N34 B;  3CCE V;  5KHJ A;  1MSW D;  1GM9 A;  4HNA A;  1BZK A;  2YS8 A;  4G2K A;  1K4C C;  3MAQ A;  2G38 A;  3BA9 A;  4DR3 B;  2GSM B;  5K1P A;  3ZHQ A;  2QWP B;  5HFM A;  1SET A;  4DK1 A;  5KHK A;  1QU7 A;  2CUG A;  3ZMS A;  1W2B U;  1WLE A;  5L3G A;  1K3E A;  2UUA O;  1AB3 A;  5IJ0 A;  4DV0 O;  4DR7 B;  2A3Q A;  4LP8 A;  4KXR A;  4LF7 O;  4IHJ A;  1XMQ B;  3CCJ V;  1GM7 A;  2ZIM A;  3TXQ A;  2M7W A;  1PNL A;  3N27 A;  2XND G;  3OUS A;  2YIB D;  1KQS U;  4DV1 O;  5LP6 C;  2UUC B;  4PA9 A;  4K0K B;  3J80 N;  1HNZ O;  4EFB A;  3ZIA G;  1MNG A;  3U0Z A;  1XNR B;  1S5H C;  3HKC A;  1NI8 A;  4CS4 A;  3NXS A;  3KG2 A;  4LF9 O;  4WBN A;  1VF6 A;  4O4I A;  2Q73 A;  2PUS A;  4X89 A;  1JNB A;  4FK5 C;  1YF2 A;  1I94 B;  3CSX A;  2LP7 A;  2ZIO A;  3T4Z A;  5JWP A;  5IY5 C;  5BXZ A;  1FD9 A;  1OJH A;  4GLX A;  3N2K A;  2ZM6 B;  1O9G A;  3I56 V;  2YUA A;  1BMF G;  3QF7 A;  5KA5 A;  1E1R G;  4DV6 O;  1XI1 A;  1YZB A;  1S5J A;  4X62 O;  1NJI W;  3IC7 A;  5LXT A;  2LGQ A;  1ZL8 A;  5KLV H;  3BY6 A;  1FFX B;  4RUF A;  1FXK C;  1DF4 A;  3EHB B;  4EKW A;  2EIL C;  2F4V B;  1D2D A;  2HKO A;  4HNA B;  3ZBH A;  4XBF A;  3SR2 C;  1D5A A; 
#chains in the Genus database with same CATH homology
 3KKY A;  1LUV A;  5AG2 A;  3IC9 A;  3K9S A;  2QKA A;  2GDS A;  5A9G A;  3MDS A;  3QVN A;  1XRE A;  4GUN A;  1AR4 A;  1Y67 A;  1GN6 A;  1GN4 A;  1VEW A;  3BFR A;  1GN3 A;  1ZUQ A;  3EVK A;  3RN4 A;  3TJT A;  1I08 A;  1ZSP A;  4BR6 A;  1MA1 A;  1MNG A;  1XUQ A;  3C3S A;  3LSU A;  4E4E A;  2ADP A;  2CDY A;  1MSD A;  3KDR A;  1ZTE A;  3OT7 A;  2RCV A;  1N0N A;  1AVM A;  4X9Q A;  1P7G A;  1BT8 A;  1WB7 A;  4JZ2 A;  1AP5 A;  1XIL A;  2CE4 A;  1BSM A;  1WB8 A;  4JYY A;  4JZG A;  1N0J A;  2P4K A;  2AW9 A;  1MMM A;  3AK1 A;  1JA8 A;  4C7U A;  1B06 A;  1XDC A;  1KKC A;  1IX9 A;  1EN5 A;  1EN6 A;  3CEI A;  1QNM A;  1AP6 A;  1ZLZ A;  1EM1 A;  1GN2 A;  1PM9 A;  3DC5 A;  3DC6 A;  3AK3 A;  1LUW A;  1VAR A;  1JR9 A;  1AR5 A;  1BS3 A;  1EN4 A;  1SZX A;  2ADQ B;  2QKC A;  1I0H A;  1PL4 A;  4F6E A;  4FFK A;  4YIP A;  1IXB A;  3C3T A;  4YIO A;  1IDS A;  3AK2 A;  1D5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...