4JYYA

Crystal structure of the azide and iron substituted clostrium difficile sod2 complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
202
structure length
202
Chain Sequence
b'NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Crystal structure of the azide and iron substituted Clostrium difficile SOD2 complex
rcsb
source organism Clostridium difficile
molecule tags Oxidoreductase
total genus 73
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4jyyA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4jyyA02
1VEWA 4FFKA 1SZXA 1VARA 3RN4A 1JR9A 1BT8A 2AW9A 1XILA 4F6EA 3EVKA 3K9SA 1N0NA 3AK3A 1AR4A 1LUWA 1BSMA 1EN6A 1I08A 1EN4A 4BR6A 3CEIA 1JA8A 2QKAA 2ADPA 1IXBA 1PM9A 1EM1A 1AR5A 4YIOA 1ZUQA 3C3TA 2QKCA 4JZGA 4JZ2A 4C7UA 1ZTEA 3IC9A 1GN3A 1MMMA 3BFRA 1GN2A 1AP6A 4JYYA 1MA1A 3KKYA 1P7GA 1IX9A 4YIPA 1WB8A 1KKCA 4E4EA 2ADQB 1QNMA 4X9QA 3AK2A 3C3SA 1WB7A 3MDSA 1ZSPA 1GN6A 1AVMA 1D5NA 3TJTA 1GN4A 4GUNA 2CDYA 1LUVA 2CE4A 5A9GA 2GDSA 1PL4A 3AK1A 1XDCA 1I0HA 1BS3A 1ZLZA 1XREA 3LSUA 1MSDA 3OT7A 1N0JA 3DC6A 1AP5A 1IDSA 5AG2A 1Y67A 2P4KA 1MNGA 2RCVA 1XUQA 1B06A 3DC5A 1EN5A 3QVNA
chains in the Genus database with same CATH superfamily
4FFKA 4B3MB 3RN4A 4PD4F 2EILB 1N33B 2RN9A 5EBMC 4B3SB 1PV0A 4X65B 3ABMB 1CXZB 3KG2A 5TISZ 1H2NA 5B1AC 1YI2V 4O4HB 3T1YB 3E22A 3OR6C 4DV5O 1D2DA 4GKKO 1NT2B 4BR6A 2HJFC 3SJAC 1OCCB 3E22B 2YEVA 2Q67A 1EM1A 2EIMB 4J42A 4YIOA 1IBKB 4MTGA 2GTAA 2OIGA 4DYLA 2ZE5A 1H2LA 3HKBA 1US6A 1VQ6V 2EZPA 2YXLA 4MW8A 4DV7O 4K0KB 3P30A 5B1NA 3HPLC 3JAMN 3ABLB 4I4TB 5L3EA 4U7NA 3WG7B 3JALA 2JK5C 4OPAA 2FB5A 3C3SA 4LF8B 1XNRB 1GM8A 3P3PA 4WFHA 1BHBA 1AVMA 2A06H 3JALB 2ILMA 3MAQA 5K1PA 4ASUG 1TVKB 3BAAA 5EYPA 3STLC 2IBZH 1T5EA 3IGAC 4FMTA 3ZHQA 1KD1W 5EYPB 4JPRA 3ZMVA 4NTWA 3OAAG 5IY5B 3LSUA 3CRAA 4PDVA 4YY3O 4JTDB 5LHIA 4O2AA 5LL6Y 1HNWO 4JI6O 3UT5A 5J2TA 1YF2A 4O2AB 4DR3O 1S5HC 3ZCCA 2RDCA 3UT5B 5J2TB 3ZS8C 3FB5C 3BRCA 2Q68A 4DV1B 1VQLV 1SZXA 4CZZA 4I55B 1Z2GA 3G80A 4IL6Z 1ROPA 3H1JH 4JI0B 1H38A 1L0NH 2LFRA 3IFXA 4QPKA 1KYOF 5CA0A 1JA8A 3G67A 5IJ9B 2W6JG 1HNZB 1I5XA 1L0LH 3E83A 2GV9A 2QWPB 2OWOA 5EK0A 2XHBA 3HKCA 1NR7A 4LC1A 5CA3A 4ZKIA 1NH2D 4MVSA 1UPGA 2XTAA 2WLKA 1L1FA 3RYIB 3B8MA 4JYBA 3T2MA 4UV8A 4XDJA 4P9PA 3B2EE 1FAFA 2LO1A 1QNMA 2ZR2A 2QWRB 3CE2A 2PYLA 2EULA 3SPGA 4NXMO 4I0XA 2HLDG 1VQNV 1EFRG 1Q82W 2Y48A 2KSDA 3AEIA 3GWKC 3SJBC 3ZRSA 1COWG 1FXKC 1Y66A 1RP3B 4NKGB 3ETDA 4JI1O 2X0LA 5BZBA 4O4IA 1N0JA 1WN7A 3RYHA 5LMNO 2A9HA 5IYBO 3PJSK 3RYHB 3T1HO 1AJNA 2P4KA 1I94O 4U3JA 2B5UA 2RCVA 3L71H 2CTRA 3VQXA 3JD4A 3RYCA 2D2CB 1N36O 1M57C 1DLBA 4U3JB 2Y69C 3N2KA 1Q6UA 3ASOB 5LXTB 4ICGA 4JASA 1FJGO 2HFEC 1RM1B 3QO5A 4ZHQA 3FB6C 4RUEA 3W7WA 1H8HG 5JVDA 2QTOA 2YIBA 1NVPB 2ZE8A 4G28B 2UU9O 2E76B 1XQ8A 3FYEB 1Q7YW 1Y6XA 3JAWA 2K9PA 2P90A 4CC6A 4GX2A 4IHJB 4WCEV 3KDRA 5LMUB 4X1IA 3K79A 1V55B 5EC2C 3APQA 4X88A 2ZR3A 3LSSA 1JFFA 4MVRA 3JASA 1FS0G 3K5NA 4JZGA 4TUYA 3VOUA 3P32A 3JASB 5GW7A 1ZTEA 3KCYA 4HAMA 4UUJC 4PDRA 5LHGA 1V54B 3SGIA 1SF9A 3KCXA 4LFAB 4LF4B 2VS0A 3L9DA 1QU7A 1GH6A 2E74B 5JCOC 5JJEB 4DV6O 1HNXB 4K8ZA 2WLLA 3CC4V 2VQFB 2QM8A 3CCJV 4H13B 5J9PC 1WJZA 2WLLB 4CC5A 2EIJC 4PA4A 2JIZG 1XNQB 2CDYA 2LJ2A 3F7YC 4TV8B 2P7TC 4RQEA 4I5SA 1I7FA 3JCZA 3FYIB 4KL1A 3VBBA 3SYQA 4JI8B 4X1YB 1DK1A 5B3SB 2IJHA 2PTMA 2YUAA 4FIPC 3K3WA 4DR7O 2EINB 4LWSA 4Q6GA 2UUCB 1DF4A 2HG5C 2UXXA 4B3TO 1H2SB 1OCZC 2R9RB 2LGQA 4FM2A 4A5UB 1NS1A 3QVNA 4MVZA 1YTFB 4I7ZB 2FYUH 4X62O 3OTFA 3L74H 4BIOA 4OX9B 1P84F 4NXNB 2YI9A 3DXRA 4MT8A 1A32A 2XT9A 2E5LO 3FB7C 3CCLV 3OTOB 5L3CA 3EFFK 2EX3A 2YIDA 4PI0A 2W0FC 2YI8A 3CMAV 4Z1VA 3K08A 2UXBB 1LNQA 5JCOA 1N4CA 4J7JA 5EIBC 1HR0B 1SETA 3C3TA 1Z5WA 2QKCA 1GTOA 3JD2A 2BTQB 1VQPV 1Q8IA 4FK5C 2MK3A 2XAJA 1GN3A 2QDOA 4DUZO 1H2MA 1K34A 1YEWA 2ITCC 3QO8A 2F43G 1W0KG 1X59A 3JAKA 4ZOLA 1SA0A 3GWOA 4JI5O 2WLIA 2Y0PA 3JAKB 1IBMB 3UKMA 4ZOLB 1VP7A 4X9QA 1SA0B 1SERA 2QM7A 2WLIB 4HBNA 2CTPA 1F7YA 2R9IA 2GTSA 4HZ3A 2KB1A 2CAZC 2X7RB 3LNMB 4WFFA 4B3MO 1GK9A 3OGIB 1N33O 4B3SO 3AK1A 5LYJB 3E8FA 5LGUA 4X65O 5JQGB 1I0HA 3CJHA 2ZNIA 1ZAUA 4W4KA 3ABTA 3T1YO 3CJHB 1G4YB 1QVFU 5KUMA 3ZRVA 3RYFB 4B08A 4NTYA 1XHZA 3CD6V 3G71V 5KLVH 3ABUA 2P06A 5C8YB 1IBKO 1PNMA 3JD3A 3H9VA 3FX7A 3CYOA 1JCHA 4TWKA 1QLNA 1Q43A 1VF7A 3OFNG 4MVMA 3H1KH 2F4VB 1SQXH 3CC7V 5DECA 4K0KO 2Q7GA 3RVYA 2ZIMA 3CCUV 1TUBB 2AXTZ 2Q7HA 2WLMA 1SQVH 2XAFA 3ABKB 5IYDO 5CBGA 1H2KA 1OCOC 4LF8O 2HKOA 3AG4B 4FFBA 2ZD9A 3O65A 3ZX6A 2Q7EA 2QGNA 4FFBB 4JZ2A 1E1RG 4CH6A 3I55V 3UM7A 4JYYA 3S3WA 5H6QA 2R9AA 4TT3G 5ITZA 1VQMV 5F2VO 1VQOV 2ADQB 1AI4A 2Q69A 1GM7A 2EILC 5ITZB 3QG5A 4RQFA 3ABMC 4TV9A 5E1AC 1FFXA 3HR0A 2NNUA 1G6UA 3K57A 4P30A 3H1LH 4DV1O 2X6AA 3A0HZ 4PI2A 4OXSA 2Q6AA 3ETGA 1OCCC 3HB3B 2HR3A 1S5LZ 4NYKA 2EIMC 4JI0O 3NXSA 5KAFZ 1EZJA 3OD4A 3JARA 1MG1A 1GM9A 4I9QA 4FPPA 3JARB 4AI8A 3W7UA 1AJPA 1HNZO 2YC0A 1BQZA 2QWQB 4I50B 3E89A 3ABLC 3L75H 1VQKV 1KC8W 1P49A 5GTHZ 2CTQA 5EZYA 4HNAA 3WG7C 3EVKA 3K9SA 1F51A 4JI5B 1AJQA 5CBHA 3OW2U 1N0NA 2PY5A 2IJKA 4HNAB 4QJFB 3CP1A 2WAMA 5KX5B 4YXWG 4JAVA 4B3RB 1IXBA 1TUEB 2PYJA 3K5LA 2LQTA 5IY5C 3RT3C 2QTSA 3OMAB 2WPDG 1CPYA 4O4HA 4C7UA 4D7SA 1S0VA 2YXHA 2XASA 1MMMA 4JAAA 2Z0AA 3L72H 1NH2B 2JDIG 1HP8A 3T4DA 1NI8A 4JV5B 3JATA 3TXSA 2MW2B 4WFGA 1WB8A 3ZJZA 2PI4A 2JEXA 3JATB 4J9YB 1WB7A 2F66C 1YJWV 3RWRD 4LBEC 3TJTA 4I4TA 3K04A 3RFRA 1S76D 2JJ1G 4FLZA 4QGPA 1YDXA 2QEXV 4LF7B 4UCOA 4UCUA 5LMUO 2ZINA 4XDKA 1Q6IA 4CH5A 4DK1A 4L8JA 4X64B 4PHZA 4LFBB 2VWJA 4BIZA 1Q3EA 1TVKA 3SJCC 1PPJH 2Q5ZA 4X89A 1AI7A 1NTKH 5KHIA 5LBQA 4J7ZA 4GYCB 4H37A 4O4JA 2XAQA 4LNUA 4EFEA 5KMGA 4H33A 3BABA 4ZI7A 4O4JB 3CCSV 4LNUB 5KMGB 4ZI7B 4LR3A 4B7EA 4DR5B 2M6YA 1VMGA 1YIJV 4LFAO 4WFAV 4IIJB 4LF4O 1PP9H 1OHHG 1PD3A 3AG1B 3OEHG 3ZN1A 4I55A 1HNXO 4GKJB 4PA6A 1AR1B 3K58A 2VQFO 3J7AU 4O4LB 2FKXA 5KA5A 1K33A 1XNQO 2M7WA 2WWWA 1M56C 3U0ZA 4JI8O 5B5EZ 3NR7A 5IJ9A 5KA6A 4WF9V 4TOIA 2R70A 2IU3A 3MHHC 2H3OA 3ASOC 1RM1C 2UUCO 1H8EG 1SQQH 3X2QB 1ZX3A 4J11A 4BW5A 3P3NA 2HHHB 4FZ1A 3RYIA 1IVSA 3DSQA 1KUQA 1RFYA 3ZRWB 2E75B 2YIAA 1BHAA 1AB3A 2AHYA 4R6ZA 1L8DA 2GSMB 3E86A 1RPOA 1V55C 1R3IC 2DWDC 3I56V 4OX9O 4NXNO 3ZMUA 1P7BA 2DMXA 2XUMA 3CXHF 3OTOO 4GZRB 4YJ3B 4J9ZB 3K06A 2UXBO 4IYHA 1MNGA 3JSNA 4DXWA 1JJOA 1XUQA 1HR0O 2P67A 1V54C 4MVQA 1TA8A 4GX1A 4DUYB 1O9GA 4LCUC 2OCHA 3SR2C 4IGGA 5IWAO 1BL8A 3K5MA 3FAVA 4UXNA 5IT9N 3RW0A 3T1CA 1W2BU 3FAVB 2ZKOA 2ZT9B 2N74A 5LXTA 3Q4HB 1IBMO 4AQYB 5EC1C 2A0LA 5LOVB 1MABG 1HDJA 1G8MA 5B3SC 3M7MX 3M99B 3OR7C 2RNBA 1RPRA 1PL0A 2V1DA 4G27B 4J41A 4IHJA 2EINC 1SQGA 2ETNA 3SYPA 2QWOB 3OEEG 2EIKB 4JTCB 2C2AA 2BSKB 5BMVB 1I5YA 3LUTB 1SC5B 3EHBB 1PNLA 4MVUA 4XDLA 1NQTA 1VQ5V 1QLEC 4DV2B 2PUSA 2K1EA 2YDEA 3N2GA 1FOUA 4MTOA 1M90W 2B9ZA 2R72A 3BCCH 3N2GB 3OUSA 3T4ZA 3B09A 2ZCEA 4FLVA 4UVCA 1KECA 1KB9F 5KAIZ 2F4VO 3E35A 1SKVA 3W7TA 1ZLZA 1XREA 1SESA 3CWBH 1NBMG 2ZE7A 3BEHA 1ZL8A 2E3CA 3AG2C 2VWKA 1AI6A 5E79Z 1GMGA 1Y67A 1ZL8B 3ZHSA 2ZM6B 4TV8A 4J7KA 1S77D 4B7KA 3BA9A 4QIWF 2NN4A 3DC5A 4X1YA 5L3DA 2ZQMA 3CHXA 3G6EV 4LF5B 1M9NA 4UCRA 1JR9A 4KXRA 3TXQA 4JYAB 1R73A 4F6EA 5LGNA 4PDLA 2CGOA 5BXZA 2D3OW 4L87A 2GUZA 3STZC 4LFCB 2ZDIC 1M57B 2FL4A 1FYJA 2JS5A 2GUZB 4D7TA 1OV9A 3ZMTA 1AROP 1AI5A 2QKAA 2KQXA 2PI5A 4EKWA 5CN0A 3OMIB 1AR5A 1SZTA 3CS5A 1V9PA 3RGBA 5KHGA 3IJ4A 3E2EA 4GLXA 1Q5OA 2OTJV 2DWEC 2HVJC 4K8XA 4F4LA 3CRCA 5JJJB 1NR1A 1B6QA 4JGSA 4MW3A 3ZMSA 5J2UA 3CCVV 1KKCA 2BTQA 5J2UB 1GRJA 1WNSA 1WPXA 1J5EB 1JNBA 3ETQA 4DR2B 1QR8A 2GHYA 4GT1A 3D36A 5IWAB 4JI4B 5C93A 2DYRB 4PA9A 4WBNA 5CA1A 4X66B 5IYZA 2Y4TA 2CE4A 4GX0A 2IJIA 3ABKC 4WBNB 5CA1B 4FM1A 4PA7A 3JCUZ 5IYZB 1NVPD 4XBFA 1XDCA 2IH3C 3E8HA 2F1MA 2Z5UA 1MSDA 2ATKC 3AG4C 1M5IA 2DYSB 3BPZA 2KG7B 2ZDIA 4DR6B 1VQ7V 1AP5A 1WPBA 3ZRXA 2EIJB 3SJQC 4B3RO 2BE3A 5BY1A 1N34O 4UB6Z 1S5JA 3LNNA 1ZWIC 5LYJA 1R6NA 5JQGA 4DW0A 1NTZH 1JX9A 2UUBB 2YXYA 4GX5A 1OCRB 3ZHTA 2ITDC 3UQ8A 3RYFA 1Q81W 2OYQA 2ZXWB 4DV3O 5FLXN 1U96A 1XMOB 5C8YA 3M8AA 4JV5O 5LA6B 5B1OA 1SRYA 4J80A 3SDLA 4JI3B 2IM9A 3CCQV 1KKDA 5LGTA 1TUBA 4X8AA 3IAYA 2ZIOA 1BGYH 1DF5A 2YS8A 1WP7A 4F6RA 4JAUA 1N8RW 3OM3B 2F93B 1Z5VA 4H44B 4F6RB 4LF7O 2AGAA 2LFSA 1P7GA 4PDMA 3JD1A 3VQVA 2YSUB 2XAGA 4X64O 4LFBO 4E4EA 3B4SA 3QO7A 2QJ1A 1ZSPA 1GN6A 2RJZA 1X4TA 2IW5A 4BAYA 2BOBC 2Y0IA 2RMKB 3B40A 3CRQA 4R8CA 1FKAO 2P6JA 4ABMA 1YCIA 4UCSA 2GBOA 4RWUA 1M93A 4DR5O 4MTXA 2B1GA 5AG2A 4DW1A 4WFBV 4GKJO 4CH3A 1FD9A 3K59A 2ZNJA 2YICA 1B06A 1EN5A 1YJ9V 2CH7A 2PGGA 4E2LA 1MZFA 4AILC 1YJNV 1CEZA 2CH7B 1BT8A 3J80N 2Z3YA 2HP8A 4FVMA 3OE7G 1YITV 2CGNA 1AR4A 4YHHB 2BTOA 1MOFA 4I50A 4DO2A 1EZVH 2VQEB 1N32O 4NVPA 1Q90D 3ZBHA 3ZN0A 2ADPA 4Q20A 4IT5A 2ZE6A 1LR1A 1QBZA 1ZUQA 2HHHO 2P5OA 2Q4PA 2A7WA 2OCCB 2Q9LA 4FLWA 3TCUA 2Q0AA 2A79B 3ZMZA 1YVWA 1THZA 5JJNB 5L3BA 5KX5A 2ARHA 2HVKC 3OGCC 5LP6A 1NKDA 4EEQA 4LH6A 5LP6B 3LSQA 1N34B 5CBFA 5KHJA 2DN9A 4PJ0Z 3DTUB 3BHPA 3BA8A 2W0XA 2AZ2A 3MD0A 2IU0A 2P22C 2P4VA 3CCMV 4DUYO 5EIBD 4DV3B 3AG1C 4CS4A 2UXDB 1Y74B 2UXNA 1IURA 5GONB 4DR1B 5IE9A 2IJJA 1SQPH 1NTMH 2QWNB 1K97A 2KKWA 2JGDA 2QR4A 1IBLB 3THOA 1OZ0A 4EB6A 2XNDG 1KP3A 3UO2A 4AQYO 4LF6B 2JGDB 1FPOA 1R3KC 4K35A 2F23A 3APOA 4NTXA 4EB6B 4JI7B 3CRRA 3GVMA 1VEWA 2YEVB 4BW9A 1KMIZ 3R65A 2AW9A 2O57A 2OTLV 3X2QC 3S3XA 1XL6A 3DGEA 3HKBB 3E8GA 3JYCA 2Y4UA 1M4UA 5B1BB 2NR5A 3CEIA 1VF6A 1H5WA 4DV4B 2F95B 5HFMA 4DV2O 4GCZA 4DV0B 1MZEA 3AG3B 1XMQB 1GKFA 4FM0A 1R6KA 4X1KA 2EJ7A 3ASNB 1PNKA 4RAIA 2UXCB 4X1KB 3JD0A 4IIJA 3CC2V 3UO3A 4ZIBA 4R7CA 5DM6V 4N23A 2BCCH 4DR4B 3OUFA 2DW4A 1MA1A 3LDCA 3H1IH 5D5QA 3CCEV 2WSSG 1VQ8V 3CB2A 2X6CA 2OT5A 4O4LA 3A2FA 4KHPB 2PF4E 4W4LA 5BR8B 1NZ6A 4LF9B 5KHHA 2ZM6O 4OGQB 3ZHUA 5KHKA 5B1AB 2QKSA 2DOSA 2JJ2G 3R66A 2AZ0A 1R3JC 4LF5O 4P9OA 3BY6A 1VF5B 2GDSA 4RUFA 4JI2B 3N27A 1PL4A 4JYAO 1WA8A 3IC7A 3K5OA 1N32B 1WA8B 2WLJA 1K7DA 4LFCO 3DC6A 1SQFA 3B77A 3K0GA 1SQBH 4FZ0A 3ZRWA 4TQFA 3I5DA 1VQ4V 1URFA 1DTOA 2EIKC 1M1KW 2ODMA 3GB7C 1FXHA 4FLXA 3WB1A 5CA0B 2UUAB 1W59A 4R50A 4YJ3A 3SPHA 5KUKA 3HKCB 1IJGA 5DN6G 3AK3A 5FL7G 4QNHB 1Q86W 1F23A 1EN4A 2CTWA 2LP7A 1D5AA 1PM9A 1J5EO 4DR2O 4JI4O 3TGUH 2FTKA 1XOUA 4X66O 2N04A 5B66Z 1ENVA 3Q4HA 5FPOA 4I0XB 3J81N 5GTIZ 2QM4A 1KBHA 5LOVA 4DV5B 1IX9A 4GKKB 4YIPA 4DR6O 4KP4A 4DK0A 1M56B 4O4IB 4X20A 2CK3G 5CB4A 4J10A 3L73H 1MSWD 4JYCA 5DEDA 3CRMA 3K03A 4X20B 4GUNA 2BSKA 1Y4MA 5BMVA 5CB4B 2WA4A 2UUBO 1Q6HA 3RYCB 3CPWU 1G1XB 2EZOA 4KFMA 3CSXA 3F5WC 4UV9A 2B1IA 2IH1C 4DV7B 3N2KB 2RQ6A 1BS3A 3H01A 3U11A 4IYIA 1XMOO 3G4SV 3WU2Z 1F4MA 4UCVA 3RVZA 4ZHQB 5IYCO 5JVDB 1TGOA 3FB8C 3EXAA 1GAXA 4JI3O 2H94A 3SYCA 3JAWB 4X1IB 2X6BA 1R6TA 3RBZA 4MSWC 5LHHA 3WFVA 2VRZA 3VQYA 1JFFB 2WLNA 4BWAA 4P2ZA 1JPXA 3BVOA 4JF3A 1K73W 2XOKG 4TUYB 4YY3B 5IDJA 1LUWA 1KQSU 1BSMA 1FXKA 3W7XA 1CP9A 2DYRC 1HNWB 1U97A 4JI6B 3D36C 4N21A 1FXKB 4DR3B 1E1QG 3SYOA 1K5QA 4FLUA 2DYSC 1EBOA 5EBWC 3FKSG 3ZHVA 1UFIA 1JOYA 1GN2A 1AP6A 2Y69B 1K5SA 2W6IG 4D6TH 5CMUA 3D3IA 5JH7A 2JVDA 2A3QA 1OCRC 1K8AW 1QR9A 2HEPA 5JH7B 2ZXWC 1D5NA 2EJRA 1QVGU 3ML0A 4LWSB 1H2GA 3G6BA 2V7QG 4FLYA 4LH7A 2JRIA 1NU1H 5A9GA 3O9OA 3SPJA 2FMLA 1BE3H 2DQ3A 1KP2A 4UVBA 1QLEB 5D5PA 3ICXA 4YHHO 3OT7A 3CXCU 3SYAA 2VQEO 1IDSA 3HKDA 3DXRB 1BMFG 1P4RA 5H9CA 3MHSC 3HKDB 1B3QA 4TSFG 4NXMB 1JQ0A 1JVMA 4QE9A 3QTCA 3WB2A 1QCEA 1VQ9V 2KG7A 1QHTA 1VARA 1WAZA 3UCSC 4NB5A 3AG2B 3A0BZ 1YHQV 3D8CA 2YIBD 5HFLA 1XILA 1K3EA 4JI1B 4CS2A 5L3GA 4MTFA 4TQDA 4U7OA 5LMNB 5EBLC 1EN6A 1I08A 4QPJA 3T1HB 2V4DA 1I94B 1ORQC 1N36B 1AILA 4JTAB 5IJ0A 4Z2WA 5A2QN 2QA4V 4EFBA 2QE7G 1BZKA 3A8TA 3LDDA 5IJ0B 4CS3A 4FLTA 1FJGB 4U3FH 4BIUA 1K4CC 3IC9A 1HWYA 5LA6A 3W7SA 3SPIA 1JMKC 2UXDO 2QSAA 1OCZB 4UB8Z 2UU9B 3U10A 4G2KA 4DR1O 1XHXA 2LGWA 2Q0OC 3ZIAG 1J95A 3KZIZ 1IZ3A 4UFZA 1IBLO 2JEUA 2H8PC 3H1HH 3SPCA 3AK2A 1VIBA 2EBOA 3MDSA 4LF6O 4CBCA 2JS3A 2AHZA 4JI7O 2BOCC 1XEQA 1GN4A 3WB0A 4CH4A 3CX5F 2Q8VA 1LUVA 1OJHA 4YJ2A 4DRXA 4ZBMA 2NLJC 1DGSA 4PA3A 4Z1MG 1GO3F 4YJ2B 2LW7A 4DRXB 5H2FZ 5JWPA 2PZSA 4PV1B 2N05A 2OCCC 5H5NA 1FXVA 1R3LC 4HYOA 4UVAA 4DV6B 1BQ0A 4DV4O 3TETA 1F4NA 2L35A 4DV0O 1YTFD 1XMQO 1O9HA 3K9AA 5LP6C 3ZHRA 1XNRO 4MS2A 4O2BA 2UXCO 1WP8A 1WLEA 1B04A 4DR4O 4O2BB 1PKXA 1W0JG 1RSOA 1KU9A 1E79G 4DR7B 4UCTA 4NR1A 4KHPO 1NJIW 2DJVA 1RSOB 5BR8O 4LF9O 1XI1A 3L70H 4B3TB 2HJDA 4KUMA 2DE0X 3E8BA 4X62B 3PN1A 1TAEA 1S72V 2WLHA 3D3QA 2JGUA 2XAHA 4OPHA 2Q73A 2WA3A 4JI2O 3K0DA 3BFRA 1XBLA 4H0LB 2CUGA 3A0RA 4TV9B 5L3FA 1Y76A 1K9MW 2DQ0A 2E5LB 1FFXB 3CMEV 3KKYA 4WFEA 1XL4A 3OMNB 4AHCA 1Y76B 3C90A 1IXMA 1UJWB 3F7VC 3AG7A 4K3AA 3HKEA 1YXBA 4PELA 5FNVA 3HKEB 3F5TA 4RO2A 5FPRA 5FNVB 4I9WA 3B8NA 1BCCH 1JJ2U 4MVOA 5B1BC 2UUAO 4DUZB 1R1BA 3QNEA 1OCOB 4QE7A 3LDEA 3JSLA 2G38A 1YSCA 1VF6C 3AG3C 2L6LA 4LP8A 3CCRV 3QF7A 1YZBA 1K4DC 3ASNC 3TK1A 5EZYB 1QQCA 1HW7A 3ZEDA 4FJCC 3FD9A 1S3JA 5K1XA 2OIEA 1SS3A 1Y74A 5GONA 3FFQA 3VQWA 3ETEA 1K92A 1FFTB 5H6RA 2LW1A
chains in the Genus database with same CATH topology
1VEWA 4FFKA 1SZXA 1VARA 3RN4A 1JR9A 1BT8A 2AW9A 1XILA 4F6EA 3EVKA 3K9SA 1N0NA 3AK3A 1AR4A 1LUWA 3KDRA 1BSMA 1EN6A 1I08A 1EN4A 4BR6A 3CEIA 1JA8A 2QKAA 2ADPA 1IXBA 1PM9A 1EM1A 1AR5A 4YIOA 1ZUQA 3C3TA 2QKCA 4JZGA 4JZ2A 4C7UA 1ZTEA 3IC9A 1GN3A 1MMMA 3BFRA 1GN2A 1AP6A 4JYYA 1MA1A 3KKYA 1P7GA 1IX9A 4YIPA 1WB8A 1KKCA 4E4EA 2ADQB 1QNMA 4X9QA 3AK2A 3C3SA 1WB7A 3MDSA 1ZSPA 1GN6A 1AVMA 1D5NA 3TJTA 1GN4A 4GUNA 2CDYA 1LUVA 2CE4A 5A9GA 2GDSA 1PL4A 3AK1A 1XDCA 1I0HA 1BS3A 1ZLZA 1XREA 3LSUA 1MSDA 3OT7A 1N0JA 3DC6A 1AP5A 1IDSA 5AG2A 1Y67A 2P4KA 1MNGA 2RCVA 1XUQA 1B06A 3DC5A 1EN5A 3QVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEW A;  4FFK A;  1SZX A;  1VAR A;  3RN4 A;  1JR9 A;  1BT8 A;  2AW9 A;  1XIL A;  4F6E A;  3EVK A;  3K9S A;  1N0N A;  3AK3 A;  1AR4 A;  1LUW A;  1BSM A;  1EN6 A;  1I08 A;  1EN4 A;  4BR6 A;  3CEI A;  1JA8 A;  2QKA A;  2ADP A;  1IXB A;  1PM9 A;  1EM1 A;  1AR5 A;  4YIO A;  1ZUQ A;  3C3T A;  2QKC A;  4JZG A;  4JZ2 A;  4C7U A;  1ZTE A;  3IC9 A;  1GN3 A;  1MMM A;  3BFR A;  1GN2 A;  1AP6 A;  4JYY A;  1MA1 A;  3KKY A;  1P7G A;  1IX9 A;  4YIP A;  1WB8 A;  1KKC A;  4E4E A;  2ADQ B;  1QNM A;  4X9Q A;  3AK2 A;  3C3S A;  1WB7 A;  3MDS A;  1ZSP A;  1GN6 A;  1AVM A;  1D5N A;  3TJT A;  1GN4 A;  4GUN A;  2CDY A;  1LUV A;  2CE4 A;  5A9G A;  2GDS A;  1PL4 A;  3AK1 A;  1XDC A;  1I0H A;  1BS3 A;  1ZLZ A;  1XRE A;  3LSU A;  1MSD A;  3OT7 A;  1N0J A;  3DC6 A;  1AP5 A;  1IDS A;  5AG2 A;  1Y67 A;  2P4K A;  1MNG A;  2RCV A;  1XUQ A;  1B06 A;  3DC5 A;  1EN5 A;  3QVN A; 
#chains in the Genus database with same CATH topology
 4FFK A;  4B3M B;  3RN4 A;  4PD4 F;  2EIL B;  1N33 B;  2RN9 A;  5EBM C;  4B3S B;  1PV0 A;  4X65 B;  3ABM B;  1CXZ B;  3KG2 A;  5TIS Z;  1H2N A;  5B1A C;  1YI2 V;  4O4H B;  3T1Y B;  3E22 A;  3OR6 C;  4DV5 O;  1D2D A;  4GKK O;  1NT2 B;  4BR6 A;  2HJF C;  3SJA C;  1OCC B;  3E22 B;  2YEV A;  2Q67 A;  1EM1 A;  2EIM B;  4J42 A;  4YIO A;  1IBK B;  4MTG A;  2GTA A;  2OIG A;  4DYL A;  2ZE5 A;  1H2L A;  3HKB A;  1US6 A;  1VQ6 V;  2EZP A;  2YXL A;  4MW8 A;  4DV7 O;  4K0K B;  3P30 A;  5B1N A;  3HPL C;  3JAM N;  3ABL B;  4I4T B;  5L3E A;  4U7N A;  3WG7 B;  3JAL A;  2JK5 C;  4OPA A;  2FB5 A;  3C3S A;  4LF8 B;  1XNR B;  1GM8 A;  3P3P A;  4WFH A;  1BHB A;  1AVM A;  2A06 H;  3JAL B;  2ILM A;  3MAQ A;  5K1P A;  4ASU G;  1TVK B;  3BAA A;  5EYP A;  3STL C;  2IBZ H;  1T5E A;  3IGA C;  4FMT A;  3ZHQ A;  1KD1 W;  5EYP B;  4JPR A;  3ZMV A;  4NTW A;  3OAA G;  5IY5 B;  3LSU A;  3CRA A;  4PDV A;  4YY3 O;  4JTD B;  5LHI A;  4O2A A;  5LL6 Y;  1HNW O;  4JI6 O;  3UT5 A;  5J2T A;  1YF2 A;  4O2A B;  4DR3 O;  1S5H C;  3ZCC A;  2RDC A;  3UT5 B;  5J2T B;  3ZS8 C;  3FB5 C;  3BRC A;  2Q68 A;  4DV1 B;  1VQL V;  1SZX A;  4CZZ A;  4I55 B;  1Z2G A;  3G80 A;  4IL6 Z;  1ROP A;  3H1J H;  4JI0 B;  1H38 A;  1L0N H;  2LFR A;  3IFX A;  4QPK A;  1KYO F;  5CA0 A;  1JA8 A;  3G67 A;  5IJ9 B;  2W6J G;  1HNZ B;  1I5X A;  1L0L H;  3E83 A;  2GV9 A;  2QWP B;  2OWO A;  5EK0 A;  2XHB A;  3HKC A;  1NR7 A;  4LC1 A;  5CA3 A;  4ZKI A;  1NH2 D;  4MVS A;  1UPG A;  2XTA A;  2WLK A;  1L1F A;  3RYI B;  3B8M A;  4JYB A;  3T2M A;  4UV8 A;  4XDJ A;  4P9P A;  3B2E E;  1FAF A;  2LO1 A;  1QNM A;  2ZR2 A;  2QWR B;  3CE2 A;  2PYL A;  2EUL A;  3SPG A;  4NXM O;  4I0X A;  2HLD G;  1VQN V;  1EFR G;  1Q82 W;  2Y48 A;  2KSD A;  3AEI A;  3GWK C;  3SJB C;  3ZRS A;  1COW G;  1FXK C;  1Y66 A;  1RP3 B;  4NKG B;  3ETD A;  4JI1 O;  2X0L A;  5BZB A;  4O4I A;  1N0J A;  1WN7 A;  3RYH A;  5LMN O;  2A9H A;  5IYB O;  3PJS K;  3RYH B;  3T1H O;  1AJN A;  2P4K A;  1I94 O;  4U3J A;  2B5U A;  2RCV A;  3L71 H;  2CTR A;  3VQX A;  3JD4 A;  3RYC A;  2D2C B;  1N36 O;  1M57 C;  1DLB A;  4U3J B;  2Y69 C;  3N2K A;  1Q6U A;  3ASO B;  5LXT B;  4ICG A;  4JAS A;  1FJG O;  2HFE C;  1RM1 B;  3QO5 A;  4ZHQ A;  3FB6 C;  4RUE A;  3W7W A;  1H8H G;  5JVD A;  2QTO A;  2YIB A;  1NVP B;  2ZE8 A;  4G28 B;  2UU9 O;  2E76 B;  1XQ8 A;  3FYE B;  1Q7Y W;  1Y6X A;  3JAW A;  2K9P A;  2P90 A;  4CC6 A;  4GX2 A;  4IHJ B;  4WCE V;  3KDR A;  5LMU B;  4X1I A;  3K79 A;  1V55 B;  5EC2 C;  3APQ A;  4X88 A;  2ZR3 A;  3LSS A;  1JFF A;  4MVR A;  3JAS A;  1FS0 G;  3K5N A;  4JZG A;  4TUY A;  3VOU A;  3P32 A;  3JAS B;  5GW7 A;  1ZTE A;  3KCY A;  4HAM A;  4UUJ C;  4PDR A;  5LHG A;  1V54 B;  3SGI A;  1SF9 A;  3KCX A;  4LFA B;  4LF4 B;  2VS0 A;  3L9D A;  1QU7 A;  1GH6 A;  2E74 B;  5JCO C;  5JJE B;  4DV6 O;  1HNX B;  4K8Z A;  2WLL A;  3CC4 V;  2VQF B;  2QM8 A;  3CCJ V;  4H13 B;  5J9P C;  1WJZ A;  2WLL B;  4CC5 A;  2EIJ C;  4PA4 A;  2JIZ G;  1XNQ B;  2CDY A;  2LJ2 A;  3F7Y C;  4TV8 B;  2P7T C;  4RQE A;  4I5S A;  1I7F A;  3JCZ A;  3FYI B;  4KL1 A;  3VBB A;  3SYQ A;  4JI8 B;  4X1Y B;  1DK1 A;  5B3S B;  2IJH A;  2PTM A;  2YUA A;  4FIP C;  3K3W A;  4DR7 O;  2EIN B;  4LWS A;  4Q6G A;  2UUC B;  1DF4 A;  2HG5 C;  2UXX A;  4B3T O;  1H2S B;  1OCZ C;  2R9R B;  2LGQ A;  4FM2 A;  4A5U B;  1NS1 A;  3QVN A;  4MVZ A;  1YTF B;  4I7Z B;  2FYU H;  4X62 O;  3OTF A;  3L74 H;  4BIO A;  4OX9 B;  1P84 F;  4NXN B;  2YI9 A;  3DXR A;  4MT8 A;  1A32 A;  2XT9 A;  2E5L O;  3FB7 C;  3CCL V;  3OTO B;  5L3C A;  3EFF K;  2EX3 A;  2YID A;  4PI0 A;  2W0F C;  2YI8 A;  3CMA V;  4Z1V A;  3K08 A;  2UXB B;  1LNQ A;  5JCO A;  1N4C A;  4J7J A;  5EIB C;  1HR0 B;  1SET A;  3C3T A;  1Z5W A;  2QKC A;  1GTO A;  3JD2 A;  2BTQ B;  1VQP V;  1Q8I A;  4FK5 C;  2MK3 A;  2XAJ A;  1GN3 A;  2QDO A;  4DUZ O;  1H2M A;  1K34 A;  1YEW A;  2ITC C;  3QO8 A;  2F43 G;  1W0K G;  1X59 A;  3JAK A;  4ZOL A;  1SA0 A;  3GWO A;  4JI5 O;  2WLI A;  2Y0P A;  3JAK B;  1IBM B;  3UKM A;  4ZOL B;  1VP7 A;  4X9Q A;  1SA0 B;  1SER A;  2QM7 A;  2WLI B;  4HBN A;  2CTP A;  1F7Y A;  2R9I A;  2GTS A;  4HZ3 A;  2KB1 A;  2CAZ C;  2X7R B;  3LNM B;  4WFF A;  4B3M O;  1GK9 A;  3OGI B;  1N33 O;  4B3S O;  3AK1 A;  5LYJ B;  3E8F A;  5LGU A;  4X65 O;  5JQG B;  1I0H A;  3CJH A;  2ZNI A;  1ZAU A;  4W4K A;  3ABT A;  3T1Y O;  3CJH B;  1G4Y B;  1QVF U;  5KUM A;  3ZRV A;  3RYF B;  4B08 A;  4NTY A;  1XHZ A;  3CD6 V;  3G71 V;  5KLV H;  3ABU A;  2P06 A;  5C8Y B;  1IBK O;  1PNM A;  3JD3 A;  3H9V A;  3FX7 A;  3CYO A;  1JCH A;  4TWK A;  1QLN A;  1Q43 A;  1VF7 A;  3OFN G;  4MVM A;  3H1K H;  2F4V B;  1SQX H;  3CC7 V;  5DEC A;  4K0K O;  2Q7G A;  3RVY A;  2ZIM A;  3CCU V;  1TUB B;  2AXT Z;  2Q7H A;  2WLM A;  1SQV H;  2XAF A;  3ABK B;  5IYD O;  5CBG A;  1H2K A;  1OCO C;  4LF8 O;  2HKO A;  3AG4 B;  4FFB A;  2ZD9 A;  3O65 A;  3ZX6 A;  2Q7E A;  2QGN A;  4FFB B;  4JZ2 A;  1E1R G;  4CH6 A;  3I55 V;  3UM7 A;  4JYY A;  3S3W A;  5H6Q A;  2R9A A;  4TT3 G;  5ITZ A;  1VQM V;  5F2V O;  1VQO V;  2ADQ B;  1AI4 A;  2Q69 A;  1GM7 A;  2EIL C;  5ITZ B;  3QG5 A;  4RQF A;  3ABM C;  4TV9 A;  5E1A C;  1FFX A;  3HR0 A;  2NNU A;  1G6U A;  3K57 A;  4P30 A;  3H1L H;  4DV1 O;  2X6A A;  3A0H Z;  4PI2 A;  4OXS A;  2Q6A A;  3ETG A;  1OCC C;  3HB3 B;  2HR3 A;  1S5L Z;  4NYK A;  2EIM C;  4JI0 O;  3NXS A;  5KAF Z;  1EZJ A;  3OD4 A;  3JAR A;  1MG1 A;  1GM9 A;  4I9Q A;  4FPP A;  3JAR B;  4AI8 A;  3W7U A;  1AJP A;  1HNZ O;  2YC0 A;  1BQZ A;  2QWQ B;  4I50 B;  3E89 A;  3ABL C;  3L75 H;  1VQK V;  1KC8 W;  1P49 A;  5GTH Z;  2CTQ A;  5EZY A;  4HNA A;  3WG7 C;  3EVK A;  3K9S A;  1F51 A;  4JI5 B;  1AJQ A;  5CBH A;  3OW2 U;  1N0N A;  2PY5 A;  2IJK A;  4HNA B;  4QJF B;  3CP1 A;  2WAM A;  5KX5 B;  4YXW G;  4JAV A;  4B3R B;  1IXB A;  1TUE B;  2PYJ A;  3K5L A;  2LQT A;  5IY5 C;  3RT3 C;  2QTS A;  3OMA B;  2WPD G;  1CPY A;  4O4H A;  4C7U A;  4D7S A;  1S0V A;  2YXH A;  2XAS A;  1MMM A;  4JAA A;  2Z0A A;  3L72 H;  1NH2 B;  2JDI G;  1HP8 A;  3T4D A;  1NI8 A;  4JV5 B;  3JAT A;  3TXS A;  2MW2 B;  4WFG A;  1WB8 A;  3ZJZ A;  2PI4 A;  2JEX A;  3JAT B;  4J9Y B;  1WB7 A;  2F66 C;  1YJW V;  3RWR D;  4LBE C;  3TJT A;  4I4T A;  3K04 A;  3RFR A;  1S76 D;  2JJ1 G;  4FLZ A;  4QGP A;  1YDX A;  2QEX V;  4LF7 B;  4UCO A;  4UCU A;  5LMU O;  2ZIN A;  4XDK A;  1Q6I A;  4CH5 A;  4DK1 A;  4L8J A;  4X64 B;  4PHZ A;  4LFB B;  2VWJ A;  4BIZ A;  1Q3E A;  1TVK A;  3SJC C;  1PPJ H;  2Q5Z A;  4X89 A;  1AI7 A;  1NTK H;  5KHI A;  5LBQ A;  4J7Z A;  4GYC B;  4H37 A;  4O4J A;  2XAQ A;  4LNU A;  4EFE A;  5KMG A;  4H33 A;  3BAB A;  4ZI7 A;  4O4J B;  3CCS V;  4LNU B;  5KMG B;  4ZI7 B;  4LR3 A;  4B7E A;  4DR5 B;  2M6Y A;  1VMG A;  1YIJ V;  4LFA O;  4WFA V;  4IIJ B;  4LF4 O;  1PP9 H;  1OHH G;  1PD3 A;  3AG1 B;  3OEH G;  3ZN1 A;  4I55 A;  1HNX O;  4GKJ B;  4PA6 A;  1AR1 B;  3K58 A;  2VQF O;  3J7A U;  4O4L B;  2FKX A;  5KA5 A;  1K33 A;  1XNQ O;  2M7W A;  2WWW A;  1M56 C;  3U0Z A;  4JI8 O;  5B5E Z;  3NR7 A;  5IJ9 A;  5KA6 A;  4WF9 V;  4TOI A;  2R70 A;  2IU3 A;  3MHH C;  2H3O A;  3ASO C;  1RM1 C;  2UUC O;  1H8E G;  1SQQ H;  3X2Q B;  1ZX3 A;  4J11 A;  4BW5 A;  3P3N A;  2HHH B;  4FZ1 A;  3RYI A;  1IVS A;  3DSQ A;  1KUQ A;  1RFY A;  3ZRW B;  2E75 B;  2YIA A;  1BHA A;  1AB3 A;  2AHY A;  4R6Z A;  1L8D A;  2GSM B;  3E86 A;  1RPO A;  1V55 C;  1R3I C;  2DWD C;  3I56 V;  4OX9 O;  4NXN O;  3ZMU A;  1P7B A;  2DMX A;  2XUM A;  3CXH F;  3OTO O;  4GZR B;  4YJ3 B;  4J9Z B;  3K06 A;  2UXB O;  4IYH A;  1MNG A;  3JSN A;  4DXW A;  1JJO A;  1XUQ A;  1HR0 O;  2P67 A;  1V54 C;  4MVQ A;  1TA8 A;  4GX1 A;  4DUY B;  1O9G A;  4LCU C;  2OCH A;  3SR2 C;  4IGG A;  5IWA O;  1BL8 A;  3K5M A;  3FAV A;  4UXN A;  5IT9 N;  3RW0 A;  3T1C A;  1W2B U;  3FAV B;  2ZKO A;  2ZT9 B;  2N74 A;  5LXT A;  3Q4H B;  1IBM O;  4AQY B;  5EC1 C;  2A0L A;  5LOV B;  1MAB G;  1HDJ A;  1G8M A;  5B3S C;  3M7M X;  3M99 B;  3OR7 C;  2RNB A;  1RPR A;  1PL0 A;  2V1D A;  4G27 B;  4J41 A;  4IHJ A;  2EIN C;  1SQG A;  2ETN A;  3SYP A;  2QWO B;  3OEE G;  2EIK B;  4JTC B;  2C2A A;  2BSK B;  5BMV B;  1I5Y A;  3LUT B;  1SC5 B;  3EHB B;  1PNL A;  4MVU A;  4XDL A;  1NQT A;  1VQ5 V;  1QLE C;  4DV2 B;  2PUS A;  2K1E A;  2YDE A;  3N2G A;  1FOU A;  4MTO A;  1M90 W;  2B9Z A;  2R72 A;  3BCC H;  3N2G B;  3OUS A;  3T4Z A;  3B09 A;  2ZCE A;  4FLV A;  4UVC A;  1KEC A;  1KB9 F;  5KAI Z;  2F4V O;  3E35 A;  1SKV A;  3W7T A;  1ZLZ A;  1XRE A;  1SES A;  3CWB H;  1NBM G;  2ZE7 A;  3BEH A;  1ZL8 A;  2E3C A;  3AG2 C;  2VWK A;  1AI6 A;  5E79 Z;  1GMG A;  1Y67 A;  1ZL8 B;  3ZHS A;  2ZM6 B;  4TV8 A;  4J7K A;  1S77 D;  4B7K A;  3BA9 A;  4QIW F;  2NN4 A;  3DC5 A;  4X1Y A;  5L3D A;  2ZQM A;  3CHX A;  3G6E V;  4LF5 B;  1M9N A;  4UCR A;  1JR9 A;  4KXR A;  3TXQ A;  4JYA B;  1R73 A;  4F6E A;  5LGN A;  4PDL A;  2CGO A;  5BXZ A;  2D3O W;  4L87 A;  2GUZ A;  3STZ C;  4LFC B;  2ZDI C;  1M57 B;  2FL4 A;  1FYJ A;  2JS5 A;  2GUZ B;  4D7T A;  1OV9 A;  3ZMT A;  1ARO P;  1AI5 A;  2QKA A;  2KQX A;  2PI5 A;  4EKW A;  5CN0 A;  3OMI B;  1AR5 A;  1SZT A;  3CS5 A;  1V9P A;  3RGB A;  5KHG A;  3IJ4 A;  3E2E A;  4GLX A;  1Q5O A;  2OTJ V;  2DWE C;  2HVJ C;  4K8X A;  4F4L A;  3CRC A;  5JJJ B;  1NR1 A;  1B6Q A;  4JGS A;  4MW3 A;  3ZMS A;  5J2U A;  3CCV V;  1KKC A;  2BTQ A;  5J2U B;  1GRJ A;  1WNS A;  1WPX A;  1J5E B;  1JNB A;  3ETQ A;  4DR2 B;  1QR8 A;  2GHY A;  4GT1 A;  3D36 A;  5IWA B;  4JI4 B;  5C93 A;  2DYR B;  4PA9 A;  4WBN A;  5CA1 A;  4X66 B;  5IYZ A;  2Y4T A;  2CE4 A;  4GX0 A;  2IJI A;  3ABK C;  4WBN B;  5CA1 B;  4FM1 A;  4PA7 A;  3JCU Z;  5IYZ B;  1NVP D;  4XBF A;  1XDC A;  2IH3 C;  3E8H A;  2F1M A;  2Z5U A;  1MSD A;  2ATK C;  3AG4 C;  1M5I A;  2DYS B;  3BPZ A;  2KG7 B;  2ZDI A;  4DR6 B;  1VQ7 V;  1AP5 A;  1WPB A;  3ZRX A;  2EIJ B;  3SJQ C;  4B3R O;  2BE3 A;  5BY1 A;  1N34 O;  4UB6 Z;  1S5J A;  3LNN A;  1ZWI C;  5LYJ A;  1R6N A;  5JQG A;  4DW0 A;  1NTZ H;  1JX9 A;  2UUB B;  2YXY A;  4GX5 A;  1OCR B;  3ZHT A;  2ITD C;  3UQ8 A;  3RYF A;  1Q81 W;  2OYQ A;  2ZXW B;  4DV3 O;  5FLX N;  1U96 A;  1XMO B;  5C8Y A;  3M8A A;  4JV5 O;  5LA6 B;  5B1O A;  1SRY A;  4J80 A;  3SDL A;  4JI3 B;  2IM9 A;  3CCQ V;  1KKD A;  5LGT A;  1TUB A;  4X8A A;  3IAY A;  2ZIO A;  1BGY H;  1DF5 A;  2YS8 A;  1WP7 A;  4F6R A;  4JAU A;  1N8R W;  3OM3 B;  2F93 B;  1Z5V A;  4H44 B;  4F6R B;  4LF7 O;  2AGA A;  2LFS A;  1P7G A;  4PDM A;  3JD1 A;  3VQV A;  2YSU B;  2XAG A;  4X64 O;  4LFB O;  4E4E A;  3B4S A;  3QO7 A;  2QJ1 A;  1ZSP A;  1GN6 A;  2RJZ A;  1X4T A;  2IW5 A;  4BAY A;  2BOB C;  2Y0I A;  2RMK B;  3B40 A;  3CRQ A;  4R8C A;  1FKA O;  2P6J A;  4ABM A;  1YCI A;  4UCS A;  2GBO A;  4RWU A;  1M93 A;  4DR5 O;  4MTX A;  2B1G A;  5AG2 A;  4DW1 A;  4WFB V;  4GKJ O;  4CH3 A;  1FD9 A;  3K59 A;  2ZNJ A;  2YIC A;  1B06 A;  1EN5 A;  1YJ9 V;  2CH7 A;  2PGG A;  4E2L A;  1MZF A;  4AIL C;  1YJN V;  1CEZ A;  2CH7 B;  1BT8 A;  3J80 N;  2Z3Y A;  2HP8 A;  4FVM A;  3OE7 G;  1YIT V;  2CGN A;  1AR4 A;  4YHH B;  2BTO A;  1MOF A;  4I50 A;  4DO2 A;  1EZV H;  2VQE B;  1N32 O;  4NVP A;  1Q90 D;  3ZBH A;  3ZN0 A;  2ADP A;  4Q20 A;  4IT5 A;  2ZE6 A;  1LR1 A;  1QBZ A;  1ZUQ A;  2HHH O;  2P5O A;  2Q4P A;  2A7W A;  2OCC B;  2Q9L A;  4FLW A;  3TCU A;  2Q0A A;  2A79 B;  3ZMZ A;  1YVW A;  1THZ A;  5JJN B;  5L3B A;  5KX5 A;  2ARH A;  2HVK C;  3OGC C;  5LP6 A;  1NKD A;  4EEQ A;  4LH6 A;  5LP6 B;  3LSQ A;  1N34 B;  5CBF A;  5KHJ A;  2DN9 A;  4PJ0 Z;  3DTU B;  3BHP A;  3BA8 A;  2W0X A;  2AZ2 A;  3MD0 A;  2IU0 A;  2P22 C;  2P4V A;  3CCM V;  4DUY O;  5EIB D;  4DV3 B;  3AG1 C;  4CS4 A;  2UXD B;  1Y74 B;  2UXN A;  1IUR A;  5GON B;  4DR1 B;  5IE9 A;  2IJJ A;  1SQP H;  1NTM H;  2QWN B;  1K97 A;  2KKW A;  2JGD A;  2QR4 A;  1IBL B;  3THO A;  1OZ0 A;  4EB6 A;  2XND G;  1KP3 A;  3UO2 A;  4AQY O;  4LF6 B;  2JGD B;  1FPO A;  1R3K C;  4K35 A;  2F23 A;  3APO A;  4NTX A;  4EB6 B;  4JI7 B;  3CRR A;  3GVM A;  1VEW A;  2YEV B;  4BW9 A;  1KMI Z;  3R65 A;  2AW9 A;  2O57 A;  2OTL V;  3X2Q C;  3S3X A;  1XL6 A;  3DGE A;  3HKB B;  3E8G A;  3JYC A;  2Y4U A;  1M4U A;  5B1B B;  2NR5 A;  3CEI A;  1VF6 A;  1H5W A;  4DV4 B;  2F95 B;  5HFM A;  4DV2 O;  4GCZ A;  4DV0 B;  1MZE A;  3AG3 B;  1XMQ B;  1GKF A;  4FM0 A;  1R6K A;  4X1K A;  2EJ7 A;  3ASN B;  1PNK A;  4RAI A;  2UXC B;  4X1K B;  3JD0 A;  4IIJ A;  3CC2 V;  3UO3 A;  4ZIB A;  4R7C A;  5DM6 V;  4N23 A;  2BCC H;  4DR4 B;  3OUF A;  2DW4 A;  1MA1 A;  3LDC A;  3H1I H;  5D5Q A;  3CCE V;  2WSS G;  1VQ8 V;  3CB2 A;  2X6C A;  2OT5 A;  4O4L A;  3A2F A;  4KHP B;  2PF4 E;  4W4L A;  5BR8 B;  1NZ6 A;  4LF9 B;  5KHH A;  2ZM6 O;  4OGQ B;  3ZHU A;  5KHK A;  5B1A B;  2QKS A;  2DOS A;  2JJ2 G;  3R66 A;  2AZ0 A;  1R3J C;  4LF5 O;  4P9O A;  3BY6 A;  1VF5 B;  2GDS A;  4RUF A;  4JI2 B;  3N27 A;  1PL4 A;  4JYA O;  1WA8 A;  3IC7 A;  3K5O A;  1N32 B;  1WA8 B;  2WLJ A;  1K7D A;  4LFC O;  3DC6 A;  1SQF A;  3B77 A;  3K0G A;  1SQB H;  4FZ0 A;  3ZRW A;  4TQF A;  3I5D A;  1VQ4 V;  1URF A;  1DTO A;  2EIK C;  1M1K W;  2ODM A;  3GB7 C;  1FXH A;  4FLX A;  3WB1 A;  5CA0 B;  2UUA B;  1W59 A;  4R50 A;  4YJ3 A;  3SPH A;  5KUK A;  3HKC B;  1IJG A;  5DN6 G;  3AK3 A;  5FL7 G;  4QNH B;  1Q86 W;  1F23 A;  1EN4 A;  2CTW A;  2LP7 A;  1D5A A;  1PM9 A;  1J5E O;  4DR2 O;  4JI4 O;  3TGU H;  2FTK A;  1XOU A;  4X66 O;  2N04 A;  5B66 Z;  1ENV A;  3Q4H A;  5FPO A;  4I0X B;  3J81 N;  5GTI Z;  2QM4 A;  1KBH A;  5LOV A;  4DV5 B;  1IX9 A;  4GKK B;  4YIP A;  4DR6 O;  4KP4 A;  4DK0 A;  1M56 B;  4O4I B;  4X20 A;  2CK3 G;  5CB4 A;  4J10 A;  3L73 H;  1MSW D;  4JYC A;  5DED A;  3CRM A;  3K03 A;  4X20 B;  4GUN A;  2BSK A;  1Y4M A;  5BMV A;  5CB4 B;  2WA4 A;  2UUB O;  1Q6H A;  3RYC B;  3CPW U;  1G1X B;  2EZO A;  4KFM A;  3CSX A;  3F5W C;  4UV9 A;  2B1I A;  2IH1 C;  4DV7 B;  3N2K B;  2RQ6 A;  1BS3 A;  3H01 A;  3U11 A;  4IYI A;  1XMO O;  3G4S V;  3WU2 Z;  1F4M A;  4UCV A;  3RVZ A;  4ZHQ B;  5IYC O;  5JVD B;  1TGO A;  3FB8 C;  3EXA A;  1GAX A;  4JI3 O;  2H94 A;  3SYC A;  3JAW B;  4X1I B;  2X6B A;  1R6T A;  3RBZ A;  4MSW C;  5LHH A;  3WFV A;  2VRZ A;  3VQY A;  1JFF B;  2WLN A;  4BWA A;  4P2Z A;  1JPX A;  3BVO A;  4JF3 A;  1K73 W;  2XOK G;  4TUY B;  4YY3 B;  5IDJ A;  1LUW A;  1KQS U;  1BSM A;  1FXK A;  3W7X A;  1CP9 A;  2DYR C;  1HNW B;  1U97 A;  4JI6 B;  3D36 C;  4N21 A;  1FXK B;  4DR3 B;  1E1Q G;  3SYO A;  1K5Q A;  4FLU A;  2DYS C;  1EBO A;  5EBW C;  3FKS G;  3ZHV A;  1UFI A;  1JOY A;  1GN2 A;  1AP6 A;  2Y69 B;  1K5S A;  2W6I G;  4D6T H;  5CMU A;  3D3I A;  5JH7 A;  2JVD A;  2A3Q A;  1OCR C;  1K8A W;  1QR9 A;  2HEP A;  5JH7 B;  2ZXW C;  1D5N A;  2EJR A;  1QVG U;  3ML0 A;  4LWS B;  1H2G A;  3G6B A;  2V7Q G;  4FLY A;  4LH7 A;  2JRI A;  1NU1 H;  5A9G A;  3O9O A;  3SPJ A;  2FML A;  1BE3 H;  2DQ3 A;  1KP2 A;  4UVB A;  1QLE B;  5D5P A;  3ICX A;  4YHH O;  3OT7 A;  3CXC U;  3SYA A;  2VQE O;  1IDS A;  3HKD A;  3DXR B;  1BMF G;  1P4R A;  5H9C A;  3MHS C;  3HKD B;  1B3Q A;  4TSF G;  4NXM B;  1JQ0 A;  1JVM A;  4QE9 A;  3QTC A;  3WB2 A;  1QCE A;  1VQ9 V;  2KG7 A;  1QHT A;  1VAR A;  1WAZ A;  3UCS C;  4NB5 A;  3AG2 B;  3A0B Z;  1YHQ V;  3D8C A;  2YIB D;  5HFL A;  1XIL A;  1K3E A;  4JI1 B;  4CS2 A;  5L3G A;  4MTF A;  4TQD A;  4U7O A;  5LMN B;  5EBL C;  1EN6 A;  1I08 A;  4QPJ A;  3T1H B;  2V4D A;  1I94 B;  1ORQ C;  1N36 B;  1AIL A;  4JTA B;  5IJ0 A;  4Z2W A;  5A2Q N;  2QA4 V;  4EFB A;  2QE7 G;  1BZK A;  3A8T A;  3LDD A;  5IJ0 B;  4CS3 A;  4FLT A;  1FJG B;  4U3F H;  4BIU A;  1K4C C;  3IC9 A;  1HWY A;  5LA6 A;  3W7S A;  3SPI A;  1JMK C;  2UXD O;  2QSA A;  1OCZ B;  4UB8 Z;  2UU9 B;  3U10 A;  4G2K A;  4DR1 O;  1XHX A;  2LGW A;  2Q0O C;  3ZIA G;  1J95 A;  3KZI Z;  1IZ3 A;  4UFZ A;  1IBL O;  2JEU A;  2H8P C;  3H1H H;  3SPC A;  3AK2 A;  1VIB A;  2EBO A;  3MDS A;  4LF6 O;  4CBC A;  2JS3 A;  2AHZ A;  4JI7 O;  2BOC C;  1XEQ A;  1GN4 A;  3WB0 A;  4CH4 A;  3CX5 F;  2Q8V A;  1LUV A;  1OJH A;  4YJ2 A;  4DRX A;  4ZBM A;  2NLJ C;  1DGS A;  4PA3 A;  4Z1M G;  1GO3 F;  4YJ2 B;  2LW7 A;  4DRX B;  5H2F Z;  5JWP A;  2PZS A;  4PV1 B;  2N05 A;  2OCC C;  5H5N A;  1FXV A;  1R3L C;  4HYO A;  4UVA A;  4DV6 B;  1BQ0 A;  4DV4 O;  3TET A;  1F4N A;  2L35 A;  4DV0 O;  1YTF D;  1XMQ O;  1O9H A;  3K9A A;  5LP6 C;  3ZHR A;  1XNR O;  4MS2 A;  4O2B A;  2UXC O;  1WP8 A;  1WLE A;  1B04 A;  4DR4 O;  4O2B B;  1PKX A;  1W0J G;  1RSO A;  1KU9 A;  1E79 G;  4DR7 B;  4UCT A;  4NR1 A;  4KHP O;  1NJI W;  2DJV A;  1RSO B;  5BR8 O;  4LF9 O;  1XI1 A;  3L70 H;  4B3T B;  2HJD A;  4KUM A;  2DE0 X;  3E8B A;  4X62 B;  3PN1 A;  1TAE A;  1S72 V;  2WLH A;  3D3Q A;  2JGU A;  2XAH A;  4OPH A;  2Q73 A;  2WA3 A;  4JI2 O;  3K0D A;  3BFR A;  1XBL A;  4H0L B;  2CUG A;  3A0R A;  4TV9 B;  5L3F A;  1Y76 A;  1K9M W;  2DQ0 A;  2E5L B;  1FFX B;  3CME V;  3KKY A;  4WFE A;  1XL4 A;  3OMN B;  4AHC A;  1Y76 B;  3C90 A;  1IXM A;  1UJW B;  3F7V C;  3AG7 A;  4K3A A;  3HKE A;  1YXB A;  4PEL A;  5FNV A;  3HKE B;  3F5T A;  4RO2 A;  5FPR A;  5FNV B;  4I9W A;  3B8N A;  1BCC H;  1JJ2 U;  4MVO A;  5B1B C;  2UUA O;  4DUZ B;  1R1B A;  3QNE A;  1OCO B;  4QE7 A;  3LDE A;  3JSL A;  2G38 A;  1YSC A;  1VF6 C;  3AG3 C;  2L6L A;  4LP8 A;  3CCR V;  3QF7 A;  1YZB A;  1K4D C;  3ASN C;  3TK1 A;  5EZY B;  1QQC A;  1HW7 A;  3ZED A;  4FJC C;  3FD9 A;  1S3J A;  5K1X A;  2OIE A;  1SS3 A;  1Y74 A;  5GON A;  3FFQ A;  3VQW A;  3ETE A;  1K92 A;  1FFT B;  5H6R A;  2LW1 A; 
#chains in the Genus database with same CATH homology
 1VEW A;  4FFK A;  1SZX A;  1VAR A;  3RN4 A;  1JR9 A;  1BT8 A;  2AW9 A;  1XIL A;  4F6E A;  3EVK A;  3K9S A;  1N0N A;  3AK3 A;  1AR4 A;  1LUW A;  3KDR A;  1BSM A;  1EN6 A;  1I08 A;  1EN4 A;  4BR6 A;  3CEI A;  1JA8 A;  2QKA A;  2ADP A;  1IXB A;  1PM9 A;  1EM1 A;  1AR5 A;  4YIO A;  1ZUQ A;  3C3T A;  2QKC A;  4JZG A;  4JZ2 A;  4C7U A;  1ZTE A;  3IC9 A;  1GN3 A;  1MMM A;  3BFR A;  1GN2 A;  1AP6 A;  4JYY A;  1MA1 A;  3KKY A;  1P7G A;  1IX9 A;  4YIP A;  1WB8 A;  1KKC A;  4E4E A;  2ADQ B;  1QNM A;  4X9Q A;  3AK2 A;  3C3S A;  1WB7 A;  3MDS A;  1ZSP A;  1GN6 A;  1AVM A;  1D5N A;  3TJT A;  1GN4 A;  4GUN A;  2CDY A;  1LUV A;  2CE4 A;  5A9G A;  2GDS A;  1PL4 A;  3AK1 A;  1XDC A;  1I0H A;  1BS3 A;  1ZLZ A;  1XRE A;  3LSU A;  1MSD A;  3OT7 A;  1N0J A;  3DC6 A;  1AP5 A;  1IDS A;  5AG2 A;  1Y67 A;  2P4K A;  1MNG A;  2RCV A;  1XUQ A;  1B06 A;  3DC5 A;  1EN5 A;  3QVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...