4JYYA

Crystal structure of the azide and iron substituted clostrium difficile sod2 complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
202
structure length
202
Chain Sequence
NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Crystal structure of the azide and iron substituted Clostrium difficile SOD2 complex
rcsb
source organism Clostridium difficile
molecule tags Oxidoreductase
total genus 73
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4jyyA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4jyyA02
1ZLZA 4X9QA 1LUVA 1EM1A 1N0JA 4C7UA 1EN4A 3EVKA 1PM9A 1JA8A 5AG2A 4YIPA 1ZUQA 1I08A 1XILA 3BFRA 3QVNA 4GUNA 1BT8A 1MNGA 1MSDA 4F6EA 4FFKA 1N0NA 4JZ2A 1GN3A 1SZXA 3IC9A 4JYYA 3C3SA 3DC6A 1Y67A 1D5NA 2P4KA 1IX9A 1PL4A 2GDSA 2RCVA 1ZSPA 3CEIA 3LSUA 1VARA 1ZTEA 1WB8A 1AP5A 4E4EA 2QKCA 1WB7A 1IXBA 2AW9A 2CE4A 1BS3A 5A9GA 1GN6A 1GN2A 3AK1A 1AR5A 3AK3A 3C3TA 1BSMA 1MA1A 1XREA 1VEWA 3K9SA 4YIOA 1B06A 2CDYA 3KKYA 3MDSA 3DC5A 1P7GA 2ADPA 3AK2A 1JR9A 1AVMA 3TJTA 1LUWA 1XUQA 3RN4A 1IDSA 1MMMA 1AR4A 1KKCA 2ADQB 4BR6A 1XDCA 1AP6A 3OT7A 1EN5A 1GN4A 1I0HA 4JZGA 1EN6A 2QKAA 1QNMA
chains in the Genus database with same CATH superfamily
3IJ4A 3CSXA 3K06A 2YIBD 3U0ZA 3E22A 4NVPA 2A9HA 3QG5A 3CX5F 2ZE5A 1Q3EA 4LP8A 2R9AA 5LA6A 3T1HO 2ARHA 3SGIA 1FYJA 2FMLA 3JALA 3ETQA 1K7DA 5B1OA 4MVSA 5J9PC 4JZ2A 3U11A 4BIUA 2P22C 2QJ1A 3KZIZ 4FVMA 1YSCA 3ABMC 4DV3O 5H9CA 1M5IA 4JI3O 1VQLV 3OFNG 2AHYA 1OCOC 3ABUA 2H3OA 1R6NA 5IJ0A 1DK1A 2IH3C 2GDSA 2JRIA 5JCOA 5KHHA 3GWOA 3T1YB 3TK1A 2R72A 2L35A 3ZMSA 2P06A 5GONB 4E4EA 3RBZA 2WPDG 3JARA 4JI0O 4CH6A 4NKGB 1WB7A 1BS3A 3JD3A 4R8CA 3FB5C 1VQ5V 4ZBMA 4WBNA 4DV1B 4EKWA 3SYAA 3WU2Z 4AI8A 1Q7YW 4F6RA 2OCCB 4FJCC 2F4VB 3JATA 1K34A 3K58A 2V7QG 1FXKA 4YY3O 1LUWA 2WLMA 4GX1A 2F95B 4JGSA 1H2MA 3RYCB 4QGPA 2QWOB 3F7YC 2WA4A 5FLXN 4ZHQA 3E86A 4MTXA 1WJZA 3JD1A 4K0KB 3W7WA 1XL6A 4B3RO 3SJQC 3CRQA 3H01A 1YI2V 1CEZA 4O2BB 4DR3O 2EIJB 5IYCO 3SYCA 2P5OA 5KUKA 2FL4A 3BEHA 4JTCB 3SYQA 5IDJA 1KU9A 2YDEA 1KD1W 1FD9A 1J95A 1M57C 2K1EA 1P4RA 3F7VC 1I08A 1AJNA 2PGGA 3OM3B 4DR1O 3AG2B 3RYFA 1NVPB 4PA9A 3ZHSA 1GAXA 2ITCC 3ZMUA 2DMXA 1M4UA 4WFFA 1VMGA 1SKVA 1WAZA 1AROP 1WPBA 4DV4B 1XMOB 5KX5B 5LGTA 3B77A 2IH1C 4JTAB 1SRYA 2PF4E 4YJ3B 3MHSC 1PL4A 1IJGA 3ASOB 3DSQA 2P90A 4X1KB 2Y69C 3AG7A 2ZR2A 4IHJB 4TV9A 1RFYA 1P49A 3SPCA 4JI2O 2WA3A 3CRRA 4GYCB 4DV2O 1V55B 1VQ8V 3E2EA 4H33A 2PTMA 3SJCC 5BMVA 4LR3A 3CXHF 4QJFB 1U97A 1I94O 2EJRA 4DV6O 2CDYA 5LGNA 3BA8A 5GW7A 2B1GA 1NZ6A 1TAEA 1KC8W 1GM9A 5K1XA 4BIZA 3UT5B 4UCTA 4KUMA 2DYSB 3JAKB 1Y4MA 3MAQA 1K4DC 2HJFC 1VQKV 2RDCA 1M1KW 4CZZA 2UU9B 4WFAV 4MTFA 5IYZB 3JALB 3L73H 1JFFA 3BY6A 2DYRB 4MSWC 1LUVA 1PNLA 1EM1A 2ZCEA 3OR6C 2QGNA 4CS2A 1BCCH 1EBOA 3CP1A 2QWQB 4AQYB 2OCCC 3CJHA 4UCSA 4LNUA 3M8AA 1KECA 3BFRA 5IJ0B 2RNBA 2D2CB 1VQNV 5JH7B 1US6A 3HKBA 3WB2A 1N0NA 2K9PA 3UM7A 3JARB 1IZ3A 1S77D 4JYAO 2IM9A 2FKXA 1VQ6V 2LJ2A 3G4SV 4FLZA 1JPXA 3VQVA 3HR0A 1FJGB 4GX5A 4LF4B 1RP3B 1YF2A 4LBEC 2IJJA 3JATB 1FXVA 2EIJC 1NH2D 2CUGA 1ORQC 3JYCA 2EILB 3UO3A 3ZRWB 2Q68A 2P4VA 4B3MO 5H2FZ 2DQ0A 3AK3A 3STLC 4J7KA 4PD4F 2LGQA 3JAWB 4FFBA 4BAYA 4DR6O 5EC1C 4X65B 3RFRA 2QM7A 3D36A 3FB8C 4JI1B 3ZMVA 3M99B 1K9MW 3KKYA 4IL6Z 1NR1A 1PP9H 3RVYA 1PD3A 2W0FC 3HKDB 2R9IA 3CRAA 4JASA 2H8PC 2UXNA 2LQTA 2EZOA 1SF9A 3RYHB 1N34O 4I50A 3T4DA 4LWSA 1YZBA 1RSOA 3ZRXA 3OT7A 2HHHB 4ZKIA 3FD9A 3K08A 3ASOC 4CH5A 2Q7HA 4JZGA 4XDJA 1F4NA 5B1AC 1S5JA 5L3CA 1XQ8A 1NBMG 1N0JA 1K8AW 3AEIA 4PDVA 4FZ1A 4UXNA 3I55V 3JD4A 1N4CA 3CXCU 1SA0B 2GHYA 1Y76A 2N74A 3W7TA 2C2AA 4MW3A 2PUSA 4GUNA 3FAVB 4UFZA 4F6EA 1YTFB 3E83A 2HJDA 4ZOLA 3H1LH 1SZXA 2DYSC 4X8AA 1R6TA 2ZIOA 4B3SB 1JNBA 2ETNA 5LMNO 5EZYA 3E8HA 1E79G 3CB2A 3KDRA 3C90A 3BA9A 5BMVB 3DXRA 2VQEB 2Q0AA 5L3DA 2RJZA 1I5YA 1YVWA 2XNDG 4JI6B 1ZAUA 5E79Z 2YI9A 2DYRC 4OGQB 4UB6Z 4TQDA 4NTXA 5GTIZ 2JEXA 1L0LH 2Q73A 4B08A 2P7TC 4LFBB 1SC5B 5JCOC 4UCOA 1HP8A 1TVKA 3T1CA 1FS0G 2QM8A 1DTOA 1NT2B 5B66Z 1K92A 1HWYA 4DV0O 4K8ZA 4KHPO 1ZWIC 4G28B 1QR8A 3LSQA 2F43G 4FLYA 2W6IG 1G6UA 3R66A 4TV8B 5EIBD 4KFMA 4JAAA 3J81N 2EZPA 2EJ7A 1Q5OA 4N21A 1B3QA 4UVAA 3FX7A 2FYUH 1XBLA 4JI7O 2LFSA 3T1HB 2EBOA 2WLLA 2YXYA 2EILC 1GMGA 1AJPA 3M7MX 4LF7O 2UXXA 2WAMA 4EB6A 1SETA 2D3OW 3B40A 2A3QA 1N33O 2X7RB 2IU3A 2JGDB 2NLJC 1R3IC 4GKJB 3H1JH 3H1HH 2F66C 4MVQA 5KHGA 1GTOA 3SR2C 1PV0A 3OUSA 3N2KA 2UXCO 4FM0A 2UUAO 4GZRB 2R9RB 4QE9A 2YEVB 4LFCB 3E8GA 3IC9A 3G67A 3WB1A 2Z0AA 4PDLA 5LYJA 3L75H 1G8MA 2EIMC 5JWPA 2VRZA 2HP8A 1M56B 1S72V 4O4HB 3WG7B 4LF5O 3JSLA 1BHBA 5FNVB 1IXBA 2AW9A 3A2FA 3P3NA 4Q6GA 3OD4A 4NXMB 2DE0X 3ZHTA 4IIJB 2M6YA 4LFAB 4JTDB 4I50B 4UV9A 1RSOB 3K5MA 3DTUB 1B06A 4LF8B 3K04A 2XOKG 3LDEA 5IT9N 4U3JA 1N36O 3O9OA 4B3RB 2GSMB 4FM2A 4DYLA 4GX0A 3RN4A 3OUFA 1W59A 1KP2A 2A79B 3ABKB 2CGOA 2VQFB 3K79A 5C93A 4DR5O 4R6ZA 4FM1A 1XI1A 1Y76B 2CK3G 3BPZA 4TUYA 3CCSV 1P84F 2ILMA 1Y6XA 5IE9A 5LBQA 2XAGA 4ZOLB 3STZC 3T4ZA 4JI4O 1EN4A 2KG7B 4RWUA 5EZYB 4FLUA 3CHXA 3ETEA 2LW1A 1KQSU 2B9ZA 3QO8A 1TUBB 5EYPB 5CA1A 2XAQA 1NS1A 4DV5O 3JSNA 5TISZ 5CA0A 4I0XA 4BW5A 1H5WA 4GX2A 3HKCA 1Y74A 1THZA 3BAAA 4TOIA 1Y67A 2CTRA 3CE2A 4JI2B 2Q6AA 4FZ0A 2XAFA 4DV2B 1R1BA 4DK1A 1KBHA 2BOBC 2CTQA 4FMTA 4JI5O 1KP3A 3CEIA 5B1BB 1OCRB 1I94B 2GV9A 3RVZA 2WLNA 2YC0A 4DV6B 4YXWG 2L6LA 4MVZA 4LF9O 3WB0A 1GN6A 1VP7A 4NTYA 4I7ZB 2ZINA 2OWOA 1P7BA 5ITZA 3ICXA 2XUMA 2ZDIC 1HNXO 3UO2A 1O9HA 4O4LA 3SDLA 5JJJB 2JS5A 1I5XA 1QLNA 3AG1B 4X88A 2YIBA 4WF9V 3ZN0A 3GWKC 1Q81W 4WFBV 4EB6B 2JEUA 1AP6A 1PKXA 3EXAA 2CH7A 1M56C 1GN4A 3LNNA 3WG7C 2QKAA 3SYPA 3SJBC 1H8HG 3N27A 3N2KB 3JD0A 3JD2A 3UKMA 3L9DA 1OZ0A 2OT5A 3L74H 4X66O 2WLIB 1HR0O 1PM9A 4GLXA 5AG2A 4MVUA 1PNMA 4P9OA 5JJNB 1ZUQA 4ZI7A 5H5NA 2CTWA 4PDRA 5E1AC 1NU1H 3FB7C 1SESA 1ZL8B 5L3EA 2DQ3A 2BSKA 4J9ZB 1R73A 3CCVV 5L3GA 4TWKA 1VQPV 3ZHUA 4X64O 2Q8VA 3ABKC 3CCEV 4ICGA 3L70H 1FPOA 5IWAO 4I55A 1MZEA 3CYOA 4B3MB 1FFXA 2R70A 4UCRA 4MTGA 4DR6B 1W2BU 2QWNB 2Y4TA 4MS2A 2LW7A 3CCRV 4DW0A 2QKCA 1CP9A 2HR3A 1WN7A 4F4LA 1UPGA 1WA8A 3N2GA 4Z1VA 3BABA 1EFRG 1LNQA 5B5EZ 3K9SA 1N34B 2GBOA 2PY5A 1GKFA 2VWKA 1VF7A 4P9PA 5LL6Y 1P7GA 3AK2A 4J80A 3CCQV 4YJ2A 3BHPA 4HBNA 3VQWA 1XUQA 2AZ0A 4NR1A 3A0RA 2UXDB 1PL0A 5KAFZ 1AI7A 3BCCH 4PA7A 1KKCA 1AI4A 1IBLO 4B7EA 2ZNJA 4B3TB 4TT3G 2V1DA 3K5OA 4PJ0Z 1HDJA 5B1BC 2QSAA 4WFGA 1OCRC 2QTOA 3W7SA 5J2TB 1EN6A 4UCVA 4A5UB 1IBMB 4Z1MG 1ZLZA 2NNUA 4E2LA 2XHBA 2UUBB 1Y74B 4C7UA 2E75B 4XBFA 3CPWU 3E22B 3CCJV 1BHAA 5KA6A 3SPJA 4G27B 5LA6B 3U10A 1MABG 4DUZB 1JJOA 3AG1C 1GN3A 3QF7A 4X62O 3SPHA 1CPYA 3UCSC 3OMNB 1BQZA 2HLDG 4UV8A 4JF3A 3T1YO 1H8EG 1D5NA 4P2ZA 1IX9A 5ITZB 1VQ7V 1ZTEA 1WP8A 2FTKA 1VQ9V 4O4LB 2QA4V 2QEXV 1T5EA 1YEWA 4DR7O 2JK5C 4HNAA 2QDOA 3E8BA 5KUMA 4DV0B 1OCZB 3ZRVA 3G6EV 4PA4A 4WBNB 4KHPB 3ZX6A 4F6RB 4O2AA 3Q4HA 5EBLC 1BQ0A 5IJ9A 2MW2B 3LUTB 3EFFK 4H13B 3ABLB 1FXKB 3CRMA 4JI7B 4X1IA 5BY1A 5FPOA 1PPJH 1SQPH 1HNWB 3H1KH 4K0KO 1DF5A 4UCUA 4Z2WA 1XNRO 4IGGA 2AZ2A 3ZMTA 4LF7B 2KQXA 4ZHQB 4DR4O 4OXSA 2ZIMA 2ZM6B 1OCCB 1H2GA 4Q20A 4ZI7B 3K0GA 2OIEA 2V4DA 2ZT9B 1QLEB 4U3FH 1BL8A 1VQ4V 3J7AU 3AG2C 4ZIBA 5KLVH 4DK0A 1BE3H 2BSKB 3B8MA 2UUAB 2ZE8A 1QVFU 4RUFA 5CB4A 1COWG 3OGCC 4KL1A 1JA8A 5LOVA 4U7NA 1QCEA 4I55B 4MTOA 2E3CA 3K03A 3CMAV 1VF6C 5KMGA 2UXBB 1VF5B 1BT8A 1QU7A 5JQGA 4DV4O 3RYFB 1IVSA 2BTQA 3SPGA 2WLHA 3O65A 1S5HC 4JYYA 4DO2A 1V55C 2QWPB 4PHZA 1WA8B 3JCUZ 2QTSA 4GKKO 3G80A 1H2SB 2X6AA 1EZJA 5LGUA 5B1NA 2XAJA 1WB8A 2GTSA 5L3FA 3B09A 1B04A 3LDDA 4OX9B 5J2UA 1HNZB 1FXHA 4TV9B 3OAAG 2FB5A 2AHZA 1R3KC 2DOSA 3HKEA 4UVCA 4DV7O 1I7FA 1BSMA 2LP7A 1XNQB 2LGWA 3JCZA 1KUQA 2YI8A 1YJ9V 1D5AA 4NB5A 1W0JG 4YHHO 3MDSA 1G1XB 3DC5A 2ZNIA 3ABTA 4K8XA 3AG3B 3CC2V 4PELA 2Y48A 4TQFA 1SS3A 4XDLA 3CCLV 3JASA 4W4KA 3E35A 4JI4B 1XDCA 3TXSA 4CH3A 2JGUA 5CMUA 2QR4A 1EN5A 3ML0A 1YITV 1QHTA 1N32B 5BZBA 1SERA 2OCHA 4DV5B 4NXNO 2HKOA 3EHBB 1J5EB 2Y0IA 2A7WA 4X9QA 1JFFB 3K59A 1E1RG 3TETA 3B4SA 1M90W 4WFEA 1OCZC 5BR8O 3A8TA 3KG2A 1JCHA 1F51A 2EINB 4HZ3A 3CJHB 3BVOA 4LNUB 4JI5B 2JS3A 3VQXA 4ASUG 1DLBA 3K9AA 3ABLC 1FXKC 5JVDA 1Q6HA 3HKBB 3E8FA 4ABMA 3CD6V 2HEPA 3I56V 1YIJV 1XHXA 2Z5UA 1R6KA 5LXTA 4DV3B 2P4KA 3K3WA 2B1IA 4JI3B 1OCCC 3LSUA 1QLEC 4LH6A 4O2AB 2BOCC 3ZBHA 3Q4HB 1YJWV 4JV5O 1IXMA 4JI8O 2F1MA 2PI4A 2G38A 2RQ6A 3ABMB 3IFXA 4JI0B 2DWEC 2ZXWB 2E76B 1GN2A 1GK9A 2P67A 4EFBA 1NKDA 3TGUH 4FFBB 1IBKO 3MHHC 1RPRA 3RYIA 1NVPD 4LF6O 5CBFA 2Q67A 2KSDA 1BGYH 4EFEA 5IYDO 3RYCA 1IDSA 1MMMA 1GM8A 2O57A 4O4IA 4YY3B 4OPHA 3CC7V 2ODMA 5CB4B 5CBGA 4X66B 1HR0B 1XOUA 1GM7A 5LHGA 4HYOA 1DF4A 4LWSB 1L1FA 3F5WC 4O2BA 2OYQA 3P30A 2ITDC 4FLXA 5EC2C 1NJIW 1NH2B 2E5LO 3CWBH 1TA8A 4GCZA 5JQGB 1NQTA 4DR3B 2NN4A 3SYOA 4DUYO 2E74B 4MVOA 4FLVA 1FKAO 1SQGA 4YIPA 2YXHA 4X64B 1S76D 1YCIA 5IWAB 2ZKOA 1OHHG 1SQVH 2QWRB 3CMEV 1MNGA 4CS3A 1XEQA 4DR1B 4B3SO 3AG3C 1MG1A 4J9YB 2CGNA 5KX5A 1WLEA 2VQEO 4DRXA 3ETGA 1H38A 1L0NH 5FL7G 4X1KA 2RCVA 4CC6A 4I9WA 3DXRB 2X6CA 2HVKC 2CAZC 1W0KG 2JIZG 3OEEG 4GT1A 4IHJA 2F23A 5LP6A 2W0XA 5EBWC 2KKWA 2YIDA 3TXQA 4DR2O 4DXWA 5LMUO 3MD0A 3JASB 5C8YA 2ZD9A 3SPIA 4J7ZA 2M7WA 1IBLB 2UUCO 2EINC 3OGIB 3G6BA 1F4MA 4PI2A 4K35A 4XDKA 3UT5A 2IW5A 1AVMA 3JAKA 2IJHA 1TVKB 5HFLA 5JJEB 1MZFA 3E89A 2PZSA 4QNHB 3RWRD 4P30A 2EULA 4MVMA 1I0HA 5IYZA 2DWDC 3WFVA 1BMFG 1WNSA 2ZE6A 5JVDB 4JAUA 2WLLB 2DJVA 1NTMH 2ZXWC 4IT5A 5LHHA 2BTOA 4GKJO 4X62B 1Q82W 1VQMV 3ZCCA 2HVJC 4J7JA 1URFA 5LXTB 1XMQO 5DN6G 3ZS8C 3IC7A 3R65A 5JH7A 3D36C 4LFCO 1Q6UA 3VQYA 2OTJV 4DR7B 3DC6A 4BW9A 4JYAB 1RPOA 2Y4UA 5LYJB 1L8DA 1ZX3A 4L87A 1KYOF 5B3SB 1RM1B 1S0VA 3AG4B 3RYIB 3D3IA 1JQ0A 4NXMO 4WFHA 1A32A 2LFRA 4PA6A 3ZRWA 3KCXA 4PI0A 3RGBA 3APOA 2AXTZ 3S3WA 4BWAA 3QTCA 4LFAO 1Y66A 1YXBA 3JAWA 2WSSG 3B2EE 4O4IB 1F23A 1AILA 4LF8O 1SQQH 1H2KA 4NTWA 4PV1B 4G2KA 1XNRB 3ZHRA 1KMIZ 4DR4B 3HKDA 5EBMC 1YTFD 4CBCA 4U3JB 1WP7A 1UFIA 2PYJA 3I5DA 2KB1A 3W7XA 2VQFO 1K4CC 5H6QA 4OPAA 4LH7A 4QPKA 3OMIB 3RYHA 5CA3A 4CS4A 2YSUB 1IURA 2IJIA 3CCUV 5FPRA 3ETDA 2A06H 3CCMV 3W7UA 3OE7G 2OTLV 3DGEA 1YHQV 4TUYB 3P32A 5KHIA 2ATKC 2W6JG 3ASNB 1SZTA 1YDXA 3OTOO 1G4YB 1E1QG 3EVKA 3K5NA 3APQA 1SA0A 5D5QA 4DRXB 4IYIA 2HFEC 3FAVA 4GKKB 2MK3A 1PNKA 1MOFA 4I5SA 3OMAB 5CA1B 1R3JC 5B1AB 4AHCA 4FFKA 1DGSA 4H37A 1K33A 3LNMB 5CA0B 4I0XB 5LP6B 2BE3A 1WPXA 3HKCB 2PYLA 3C3SA 1NR7A 4LCUC 4I9QA 5LMNB 5C8YB 5DM6V 4DV7B 1V54B 1ENVA 1VARA 1Z2GA 1NI8A 4YHHB 1QVGU 4WCEV 2JJ2G 2QE7G 5A9GA 2YIAA 3AK1A 5HFMA 2YS8A 3VBBA 4J41A 4N23A 3ZHVA 1MA1A 1JJ2U 4HAMA 4YIOA 4DW1A 3ZEDA 4D6TH 1M9NA 4X20A 1JR9A 1HW7A 3TJTA 2GTAA 2NR5A 3S3XA 4DV1O 2AGAA 4NXNB 3G71V 2VWJA 3B8NA 1SQXH 3H1IH 4TV8A 2OIGA 1Q43A 1AB3A 2F4VO 1TUEB 4JYCA 3GB7C 2B5UA 5EIBC 4RQEA 5CBHA 5BR8B 4X1YA 5B3SC 1K5QA 1RM1C 3CC4V 2CH7B 3AG4C 1QNMA 4TSFG 1QR9A 4AILC 2WLJA 1Q8IA 3NXSA 3UQ8A 1OV9A 3SJAC 2JGDA 2QKSA 3X2QB 2GUZA 5EK0A 1V9PA 1TGOA 2ZDIA 3GVMA 2IU0A 1N33B 2Q5ZA 1VQOV 1X59A 4O4JA 1LR1A 1YJNV 2YEVA 2Q0OC 1VIBA 2Z3YA 4JV5B 4UB8Z 1AI5A 5IY5B 2CTPA 4JI8B 5DECA 1N8RW 2UXCB 3FFQA 3QO7A 1B6QA 2YXLA 4UVBA 2EIKB 1NTKH 4NYKA 2X0LA 4RO2A 2Y0PA 3LSSA 1XHZA 4MT8A 2VS0A 3QO5A 4O4HA 1FFXB 5D5PA 1BZKA 3F5TA 1D2DA 4PA3A 5FNVA 4J11A 2P6JA 3D8CA 1IBKB 3P3PA 1JX9A 3CS5A 5KHJA 1XMOO 3QNEA 4LF5B 4LF6B 4MW8A 2ZR3A 4KP4A 3ASNC 4IIJA 2EIMB 1M93A 4JPRA 4QPJA 2A0LA 5L3BA 1JMKC 3HB3B 3N2GB 1O9GA 2LO1A 4FPPA 4D7TA 2BCCH 4I4TA 1FOUA 4CH4A 4H44B 2UXDO 3HPLC 3KCYA 4J10A 5LP6C 1N36B 4YJ2B 2E5LB 3FYIB 4B3TO 4FLTA 1AR4A 4DUYB 3CRCA 1Z5VA 1V54C 4EEQA 1IBMO 2WLKA 4DR5B 2H94A 3OTFA 2WWWA 1H2LA 3THOA 2Q4PA 2UUBO 3OW2U 1U96A 1QQCA 1S5LZ 1K3EA 2KG7A 2XASA 5A2QN 3IGAC 4FIPC 1TUBA 3J80N 4MVRA 5EYPA 2UU9O 1FFTB 4U7OA 2QM4A 4DUZO 2ZE7A 1K5SA 3QVNA 1Q6IA 1AI6A 3ZJZA 1MSDA 4X89A 3ZN1A 1SQFA 3FKSG 4AQYO 4DR2B 3ZHQA 5LMUB 1K97A 1AP5A 5BXZA 2UUCB 1XL4A 3FYEB 4X20B 5GTHZ 1JOYA 3OR7C 2HG5C 4LF9B 4K3AA 3T2MA 1FJGO 3X2QC 4W4LA 4KXRA 2EX3A 5KHKA 2DN9A 4HNAB 2N04A 4LF4O 1VEWA 4JYBA 4UUJC 1S3JA 4X1YB 2XTAA 5GONA 4R50A 3IAYA 1HNXB 2XAHA 1K73W 1HNWO 5IJ9B 3PN1A 5IY5C 2RN9A 1UJWB 4X1IB 1JVMA 2EIKC 2ADQB 1QBZA 4BR6A 4X65O 2ZM6O 3H9VA 3VOUA 1Q90D 2Q9LA 2GUZB 4JI1O 1OCOB 2XT9A 4LC1A 1MSWD 1FAFA 5IYBO 3A0HZ 1XMQB 3K0DA 4O4JB 2YICA 5CN0A 3BRCA 4IYHA 1GH6A 4B7KA 4R7CA 2WLIA 2ZQMA 2HHHO 4QIWF 2UXBO 2Q7EA 3A0BZ 3D3QA 5LOVB 4CC5A 1XILA 3L72H 4PDMA 2N05A 1ZL8A 5KMGB 4RUEA 3RT3C 2Q7GA 2JJ1G 3NR7A 3ZIAG 2BTQB 1AJQA 1AR1B 3ZRSA 2Q69A 1GO3F 2RMKB 3TCUA 2F93B 1ROPA 1CXZB 1KKDA 4OX9O 1ZSPA 5K1PA 5KA5A 5LHIA 4H0LB 1HNZO 1R3LC 4FK5C 4I4TB 3JAMN 1KB9F 4QE7A 2JVDA 1GRJA 3K57A 4FLWA 5H6RA 2CE4A 1H2NA 5J2UB 1F7YA 4L8JA 3FB6C 1XNQO 1AR5A 3C3TA 4RQFA 1Q86W 1M57B 3HKEB 1SQBH 1XREA 1VF6A 4D7SA 4YJ3A 5F2VO 3L71H 2DW4A 4JI6O 2ADPA 3LDCA 4BIOA 4RAIA 2IBZH 2YUAA 3ZMZA 3PJSK 1Z5WA 3OEHG 1NTZH 1EZVH 4J42A 1N32O 2IJKA 4LFBO 3K5LA 3OTOB 1X4TA 5KAIZ 2PI5A 4JAVA 5J2TA 5DEDA 3RW0A 1J5EO 2X6BA 2Y69B 2JDIG 1OJHA
chains in the Genus database with same CATH topology
1ZLZA 4X9QA 1LUVA 1EM1A 1N0JA 4C7UA 1EN4A 3EVKA 1PM9A 1JA8A 5AG2A 4YIPA 1ZUQA 1I08A 1XILA 3BFRA 3QVNA 4GUNA 1BT8A 1MNGA 1MSDA 4F6EA 4FFKA 1N0NA 4JZ2A 1GN3A 1SZXA 3IC9A 4JYYA 3C3SA 3DC6A 1Y67A 3KDRA 1D5NA 2P4KA 1IX9A 1PL4A 2GDSA 2RCVA 1ZSPA 3CEIA 3LSUA 1VARA 1ZTEA 1WB8A 1AP5A 4E4EA 2QKCA 1WB7A 1IXBA 2AW9A 2CE4A 1BS3A 5A9GA 1GN6A 1GN2A 3AK1A 1AR5A 3AK3A 3C3TA 1BSMA 1MA1A 1XREA 1VEWA 3K9SA 4YIOA 1B06A 2CDYA 3KKYA 3MDSA 3DC5A 1P7GA 2ADPA 3AK2A 1JR9A 1AVMA 3TJTA 1LUWA 1XUQA 3RN4A 1IDSA 1MMMA 1AR4A 1KKCA 2ADQB 4BR6A 1XDCA 1AP6A 3OT7A 1EN5A 1GN4A 1I0HA 4JZGA 1EN6A 2QKAA 1QNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLZ A;  4X9Q A;  1LUV A;  1EM1 A;  1N0J A;  4C7U A;  1EN4 A;  3EVK A;  1PM9 A;  1JA8 A;  5AG2 A;  4YIP A;  1ZUQ A;  1I08 A;  1XIL A;  3BFR A;  3QVN A;  4GUN A;  1BT8 A;  1MNG A;  1MSD A;  4F6E A;  4FFK A;  1N0N A;  4JZ2 A;  1GN3 A;  1SZX A;  3IC9 A;  4JYY A;  3C3S A;  3DC6 A;  1Y67 A;  1D5N A;  2P4K A;  1IX9 A;  1PL4 A;  2GDS A;  2RCV A;  1ZSP A;  3CEI A;  3LSU A;  1VAR A;  1ZTE A;  1WB8 A;  1AP5 A;  4E4E A;  2QKC A;  1WB7 A;  1IXB A;  2AW9 A;  2CE4 A;  1BS3 A;  5A9G A;  1GN6 A;  1GN2 A;  3AK1 A;  1AR5 A;  3AK3 A;  3C3T A;  1BSM A;  1MA1 A;  1XRE A;  1VEW A;  3K9S A;  4YIO A;  1B06 A;  2CDY A;  3KKY A;  3MDS A;  3DC5 A;  1P7G A;  2ADP A;  3AK2 A;  1JR9 A;  1AVM A;  3TJT A;  1LUW A;  1XUQ A;  3RN4 A;  1IDS A;  1MMM A;  1AR4 A;  1KKC A;  2ADQ B;  4BR6 A;  1XDC A;  1AP6 A;  3OT7 A;  1EN5 A;  1GN4 A;  1I0H A;  4JZG A;  1EN6 A;  2QKA A;  1QNM A; 
#chains in the Genus database with same CATH topology
 3IJ4 A;  3CSX A;  3K06 A;  2YIB D;  3U0Z A;  3E22 A;  4NVP A;  2A9H A;  3QG5 A;  3CX5 F;  2ZE5 A;  1Q3E A;  4LP8 A;  2R9A A;  5LA6 A;  3T1H O;  2ARH A;  3SGI A;  1FYJ A;  2FML A;  3JAL A;  3ETQ A;  1K7D A;  5B1O A;  4MVS A;  5J9P C;  4JZ2 A;  3U11 A;  4BIU A;  2P22 C;  2QJ1 A;  3KZI Z;  4FVM A;  1YSC A;  3ABM C;  4DV3 O;  5H9C A;  1M5I A;  4JI3 O;  1VQL V;  3OFN G;  2AHY A;  1OCO C;  3ABU A;  2H3O A;  1R6N A;  5IJ0 A;  1DK1 A;  2IH3 C;  2GDS A;  2JRI A;  5JCO A;  5KHH A;  3GWO A;  3T1Y B;  3TK1 A;  2R72 A;  2L35 A;  3ZMS A;  2P06 A;  5GON B;  4E4E A;  3RBZ A;  2WPD G;  3JAR A;  4JI0 O;  4CH6 A;  4NKG B;  1WB7 A;  1BS3 A;  3JD3 A;  4R8C A;  3FB5 C;  1VQ5 V;  4ZBM A;  4WBN A;  4DV1 B;  4EKW A;  3SYA A;  3WU2 Z;  4AI8 A;  1Q7Y W;  4F6R A;  2OCC B;  4FJC C;  2F4V B;  3JAT A;  1K34 A;  3K58 A;  2V7Q G;  1FXK A;  4YY3 O;  1LUW A;  2WLM A;  4GX1 A;  2F95 B;  4JGS A;  1H2M A;  3RYC B;  4QGP A;  2QWO B;  3F7Y C;  2WA4 A;  5FLX N;  4ZHQ A;  3E86 A;  4MTX A;  1WJZ A;  3JD1 A;  4K0K B;  3W7W A;  1XL6 A;  4B3R O;  3SJQ C;  3CRQ A;  3H01 A;  1YI2 V;  1CEZ A;  4O2B B;  4DR3 O;  2EIJ B;  5IYC O;  3SYC A;  2P5O A;  5KUK A;  2FL4 A;  3BEH A;  4JTC B;  3SYQ A;  5IDJ A;  1KU9 A;  2YDE A;  1KD1 W;  1FD9 A;  1J95 A;  1M57 C;  2K1E A;  1P4R A;  3F7V C;  1I08 A;  1AJN A;  2PGG A;  3OM3 B;  4DR1 O;  3AG2 B;  3RYF A;  1NVP B;  4PA9 A;  3ZHS A;  1GAX A;  2ITC C;  3ZMU A;  2DMX A;  1M4U A;  4WFF A;  1VMG A;  1SKV A;  1WAZ A;  1ARO P;  1WPB A;  4DV4 B;  1XMO B;  5KX5 B;  5LGT A;  3B77 A;  2IH1 C;  4JTA B;  1SRY A;  2PF4 E;  4YJ3 B;  3MHS C;  1PL4 A;  1IJG A;  3ASO B;  3DSQ A;  2P90 A;  4X1K B;  2Y69 C;  3AG7 A;  2ZR2 A;  4IHJ B;  4TV9 A;  1RFY A;  1P49 A;  3SPC A;  4JI2 O;  2WA3 A;  3CRR A;  4GYC B;  4DV2 O;  1V55 B;  1VQ8 V;  3E2E A;  4H33 A;  2PTM A;  3SJC C;  5BMV A;  4LR3 A;  3CXH F;  4QJF B;  1U97 A;  1I94 O;  2EJR A;  4DV6 O;  2CDY A;  5LGN A;  3BA8 A;  5GW7 A;  2B1G A;  1NZ6 A;  1TAE A;  1KC8 W;  1GM9 A;  5K1X A;  4BIZ A;  3UT5 B;  4UCT A;  4KUM A;  2DYS B;  3JAK B;  1Y4M A;  3MAQ A;  1K4D C;  2HJF C;  1VQK V;  2RDC A;  1M1K W;  4CZZ A;  2UU9 B;  4WFA V;  4MTF A;  5IYZ B;  3JAL B;  3L73 H;  1JFF A;  3BY6 A;  2DYR B;  4MSW C;  1LUV A;  1PNL A;  1EM1 A;  2ZCE A;  3OR6 C;  2QGN A;  4CS2 A;  1BCC H;  1EBO A;  3CP1 A;  2QWQ B;  4AQY B;  2OCC C;  3CJH A;  4UCS A;  4LNU A;  3M8A A;  1KEC A;  3BFR A;  5IJ0 B;  2RNB A;  2D2C B;  1VQN V;  5JH7 B;  1US6 A;  3HKB A;  3WB2 A;  1N0N A;  2K9P A;  3UM7 A;  3JAR B;  1IZ3 A;  1S77 D;  4JYA O;  2IM9 A;  2FKX A;  1VQ6 V;  2LJ2 A;  3G4S V;  4FLZ A;  1JPX A;  3VQV A;  3HR0 A;  1FJG B;  4GX5 A;  4LF4 B;  1RP3 B;  1YF2 A;  4LBE C;  2IJJ A;  3JAT B;  1FXV A;  2EIJ C;  1NH2 D;  2CUG A;  1ORQ C;  3JYC A;  2EIL B;  3UO3 A;  3ZRW B;  2Q68 A;  2P4V A;  4B3M O;  5H2F Z;  2DQ0 A;  3AK3 A;  3STL C;  4J7K A;  4PD4 F;  2LGQ A;  3JAW B;  4FFB A;  4BAY A;  4DR6 O;  5EC1 C;  4X65 B;  3RFR A;  2QM7 A;  3D36 A;  3FB8 C;  4JI1 B;  3ZMV A;  3M99 B;  1K9M W;  3KKY A;  4IL6 Z;  1NR1 A;  1PP9 H;  3RVY A;  1PD3 A;  2W0F C;  3HKD B;  2R9I A;  3CRA A;  4JAS A;  2H8P C;  2UXN A;  2LQT A;  2EZO A;  1SF9 A;  3RYH B;  1N34 O;  4I50 A;  3T4D A;  4LWS A;  1YZB A;  1RSO A;  3ZRX A;  3OT7 A;  2HHH B;  4ZKI A;  3FD9 A;  3K08 A;  3ASO C;  4CH5 A;  2Q7H A;  4JZG A;  4XDJ A;  1F4N A;  5B1A C;  1S5J A;  5L3C A;  1XQ8 A;  1NBM G;  1N0J A;  1K8A W;  3AEI A;  4PDV A;  4FZ1 A;  4UXN A;  3I55 V;  3JD4 A;  1N4C A;  3CXC U;  1SA0 B;  2GHY A;  1Y76 A;  2N74 A;  3W7T A;  2C2A A;  4MW3 A;  2PUS A;  4GUN A;  3FAV B;  4UFZ A;  4F6E A;  1YTF B;  3E83 A;  2HJD A;  4ZOL A;  3H1L H;  1SZX A;  2DYS C;  4X8A A;  1R6T A;  2ZIO A;  4B3S B;  1JNB A;  2ETN A;  5LMN O;  5EZY A;  3E8H A;  1E79 G;  3CB2 A;  3KDR A;  3C90 A;  3BA9 A;  5BMV B;  3DXR A;  2VQE B;  2Q0A A;  5L3D A;  2RJZ A;  1I5Y A;  1YVW A;  2XND G;  4JI6 B;  1ZAU A;  5E79 Z;  2YI9 A;  2DYR C;  4OGQ B;  4UB6 Z;  4TQD A;  4NTX A;  5GTI Z;  2JEX A;  1L0L H;  2Q73 A;  4B08 A;  2P7T C;  4LFB B;  1SC5 B;  5JCO C;  4UCO A;  1HP8 A;  1TVK A;  3T1C A;  1FS0 G;  2QM8 A;  1DTO A;  1NT2 B;  5B66 Z;  1K92 A;  1HWY A;  4DV0 O;  4K8Z A;  4KHP O;  1ZWI C;  4G28 B;  1QR8 A;  3LSQ A;  2F43 G;  4FLY A;  2W6I G;  1G6U A;  3R66 A;  4TV8 B;  5EIB D;  4KFM A;  4JAA A;  3J81 N;  2EZP A;  2EJ7 A;  1Q5O A;  4N21 A;  1B3Q A;  4UVA A;  3FX7 A;  2FYU H;  1XBL A;  4JI7 O;  2LFS A;  3T1H B;  2EBO A;  2WLL A;  2YXY A;  2EIL C;  1GMG A;  1AJP A;  3M7M X;  4LF7 O;  2UXX A;  2WAM A;  4EB6 A;  1SET A;  2D3O W;  3B40 A;  2A3Q A;  1N33 O;  2X7R B;  2IU3 A;  2JGD B;  2NLJ C;  1R3I C;  4GKJ B;  3H1J H;  3H1H H;  2F66 C;  4MVQ A;  5KHG A;  1GTO A;  3SR2 C;  1PV0 A;  3OUS A;  3N2K A;  2UXC O;  4FM0 A;  2UUA O;  4GZR B;  2R9R B;  4QE9 A;  2YEV B;  4LFC B;  3E8G A;  3IC9 A;  3G67 A;  3WB1 A;  2Z0A A;  4PDL A;  5LYJ A;  3L75 H;  1G8M A;  2EIM C;  5JWP A;  2VRZ A;  2HP8 A;  1M56 B;  1S72 V;  4O4H B;  3WG7 B;  4LF5 O;  3JSL A;  1BHB A;  5FNV B;  1IXB A;  2AW9 A;  3A2F A;  3P3N A;  4Q6G A;  3OD4 A;  4NXM B;  2DE0 X;  3ZHT A;  4IIJ B;  2M6Y A;  4LFA B;  4JTD B;  4I50 B;  4UV9 A;  1RSO B;  3K5M A;  3DTU B;  1B06 A;  4LF8 B;  3K04 A;  2XOK G;  3LDE A;  5IT9 N;  4U3J A;  1N36 O;  3O9O A;  4B3R B;  2GSM B;  4FM2 A;  4DYL A;  4GX0 A;  3RN4 A;  3OUF A;  1W59 A;  1KP2 A;  2A79 B;  3ABK B;  2CGO A;  2VQF B;  3K79 A;  5C93 A;  4DR5 O;  4R6Z A;  4FM1 A;  1XI1 A;  1Y76 B;  2CK3 G;  3BPZ A;  4TUY A;  3CCS V;  1P84 F;  2ILM A;  1Y6X A;  5IE9 A;  5LBQ A;  2XAG A;  4ZOL B;  3STZ C;  3T4Z A;  4JI4 O;  1EN4 A;  2KG7 B;  4RWU A;  5EZY B;  4FLU A;  3CHX A;  3ETE A;  2LW1 A;  1KQS U;  2B9Z A;  3QO8 A;  1TUB B;  5EYP B;  5CA1 A;  2XAQ A;  1NS1 A;  4DV5 O;  3JSN A;  5TIS Z;  5CA0 A;  4I0X A;  4BW5 A;  1H5W A;  4GX2 A;  3HKC A;  1Y74 A;  1THZ A;  3BAA A;  4TOI A;  1Y67 A;  2CTR A;  3CE2 A;  4JI2 B;  2Q6A A;  4FZ0 A;  2XAF A;  4DV2 B;  1R1B A;  4DK1 A;  1KBH A;  2BOB C;  2CTQ A;  4FMT A;  4JI5 O;  1KP3 A;  3CEI A;  5B1B B;  1OCR B;  1I94 B;  2GV9 A;  3RVZ A;  2WLN A;  2YC0 A;  4DV6 B;  4YXW G;  2L6L A;  4MVZ A;  4LF9 O;  3WB0 A;  1GN6 A;  1VP7 A;  4NTY A;  4I7Z B;  2ZIN A;  2OWO A;  1P7B A;  5ITZ A;  3ICX A;  2XUM A;  2ZDI C;  1HNX O;  3UO2 A;  1O9H A;  4O4L A;  3SDL A;  5JJJ B;  2JS5 A;  1I5X A;  1QLN A;  3AG1 B;  4X88 A;  2YIB A;  4WF9 V;  3ZN0 A;  3GWK C;  1Q81 W;  4WFB V;  4EB6 B;  2JEU A;  1AP6 A;  1PKX A;  3EXA A;  2CH7 A;  1M56 C;  1GN4 A;  3LNN A;  3WG7 C;  2QKA A;  3SYP A;  3SJB C;  1H8H G;  3N27 A;  3N2K B;  3JD0 A;  3JD2 A;  3UKM A;  3L9D A;  1OZ0 A;  2OT5 A;  3L74 H;  4X66 O;  2WLI B;  1HR0 O;  1PM9 A;  4GLX A;  5AG2 A;  4MVU A;  1PNM A;  4P9O A;  5JJN B;  1ZUQ A;  4ZI7 A;  5H5N A;  2CTW A;  4PDR A;  5E1A C;  1NU1 H;  3FB7 C;  1SES A;  1ZL8 B;  5L3E A;  2DQ3 A;  2BSK A;  4J9Z B;  1R73 A;  3CCV V;  5L3G A;  4TWK A;  1VQP V;  3ZHU A;  4X64 O;  2Q8V A;  3ABK C;  3CCE V;  4ICG A;  3L70 H;  1FPO A;  5IWA O;  4I55 A;  1MZE A;  3CYO A;  4B3M B;  1FFX A;  2R70 A;  4UCR A;  4MTG A;  4DR6 B;  1W2B U;  2QWN B;  2Y4T A;  4MS2 A;  2LW7 A;  3CCR V;  4DW0 A;  2QKC A;  1CP9 A;  2HR3 A;  1WN7 A;  4F4L A;  1UPG A;  1WA8 A;  3N2G A;  4Z1V A;  3BAB A;  1EFR G;  1LNQ A;  5B5E Z;  3K9S A;  1N34 B;  2GBO A;  2PY5 A;  1GKF A;  2VWK A;  1VF7 A;  4P9P A;  5LL6 Y;  1P7G A;  3AK2 A;  4J80 A;  3CCQ V;  4YJ2 A;  3BHP A;  4HBN A;  3VQW A;  1XUQ A;  2AZ0 A;  4NR1 A;  3A0R A;  2UXD B;  1PL0 A;  5KAF Z;  1AI7 A;  3BCC H;  4PA7 A;  1KKC A;  1AI4 A;  1IBL O;  4B7E A;  2ZNJ A;  4B3T B;  4TT3 G;  2V1D A;  3K5O A;  4PJ0 Z;  1HDJ A;  5B1B C;  2QSA A;  4WFG A;  1OCR C;  2QTO A;  3W7S A;  5J2T B;  1EN6 A;  4UCV A;  4A5U B;  1IBM B;  4Z1M G;  1ZLZ A;  2NNU A;  4E2L A;  2XHB A;  2UUB B;  1Y74 B;  4C7U A;  2E75 B;  4XBF A;  3CPW U;  3E22 B;  3CCJ V;  1BHA A;  5KA6 A;  3SPJ A;  4G27 B;  5LA6 B;  3U10 A;  1MAB G;  4DUZ B;  1JJO A;  3AG1 C;  1GN3 A;  3QF7 A;  4X62 O;  3SPH A;  1CPY A;  3UCS C;  3OMN B;  1BQZ A;  2HLD G;  4UV8 A;  4JF3 A;  3T1Y O;  1H8E G;  1D5N A;  4P2Z A;  1IX9 A;  5ITZ B;  1VQ7 V;  1ZTE A;  1WP8 A;  2FTK A;  1VQ9 V;  4O4L B;  2QA4 V;  2QEX V;  1T5E A;  1YEW A;  4DR7 O;  2JK5 C;  4HNA A;  2QDO A;  3E8B A;  5KUM A;  4DV0 B;  1OCZ B;  3ZRV A;  3G6E V;  4PA4 A;  4WBN B;  4KHP B;  3ZX6 A;  4F6R B;  4O2A A;  3Q4H A;  5EBL C;  1BQ0 A;  5IJ9 A;  2MW2 B;  3LUT B;  3EFF K;  4H13 B;  3ABL B;  1FXK B;  3CRM A;  4JI7 B;  4X1I A;  5BY1 A;  5FPO A;  1PPJ H;  1SQP H;  1HNW B;  3H1K H;  4K0K O;  1DF5 A;  4UCU A;  4Z2W A;  1XNR O;  4IGG A;  2AZ2 A;  3ZMT A;  4LF7 B;  2KQX A;  4ZHQ B;  4DR4 O;  4OXS A;  2ZIM A;  2ZM6 B;  1OCC B;  1H2G A;  4Q20 A;  4ZI7 B;  3K0G A;  2OIE A;  2V4D A;  2ZT9 B;  1QLE B;  4U3F H;  1BL8 A;  1VQ4 V;  3J7A U;  3AG2 C;  4ZIB A;  5KLV H;  4DK0 A;  1BE3 H;  2BSK B;  3B8M A;  2UUA B;  2ZE8 A;  1QVF U;  4RUF A;  5CB4 A;  1COW G;  3OGC C;  4KL1 A;  1JA8 A;  5LOV A;  4U7N A;  1QCE A;  4I55 B;  4MTO A;  2E3C A;  3K03 A;  3CMA V;  1VF6 C;  5KMG A;  2UXB B;  1VF5 B;  1BT8 A;  1QU7 A;  5JQG A;  4DV4 O;  3RYF B;  1IVS A;  2BTQ A;  3SPG A;  2WLH A;  3O65 A;  1S5H C;  4JYY A;  4DO2 A;  1V55 C;  2QWP B;  4PHZ A;  1WA8 B;  3JCU Z;  2QTS A;  4GKK O;  3G80 A;  1H2S B;  2X6A A;  1EZJ A;  5LGU A;  5B1N A;  2XAJ A;  1WB8 A;  2GTS A;  5L3F A;  3B09 A;  1B04 A;  3LDD A;  4OX9 B;  5J2U A;  1HNZ B;  1FXH A;  4TV9 B;  3OAA G;  2FB5 A;  2AHZ A;  1R3K C;  2DOS A;  3HKE A;  4UVC A;  4DV7 O;  1I7F A;  1BSM A;  2LP7 A;  1XNQ B;  2LGW A;  3JCZ A;  1KUQ A;  2YI8 A;  1YJ9 V;  1D5A A;  4NB5 A;  1W0J G;  4YHH O;  3MDS A;  1G1X B;  3DC5 A;  2ZNI A;  3ABT A;  4K8X A;  3AG3 B;  3CC2 V;  4PEL A;  2Y48 A;  4TQF A;  1SS3 A;  4XDL A;  3CCL V;  3JAS A;  4W4K A;  3E35 A;  4JI4 B;  1XDC A;  3TXS A;  4CH3 A;  2JGU A;  5CMU A;  2QR4 A;  1EN5 A;  3ML0 A;  1YIT V;  1QHT A;  1N32 B;  5BZB A;  1SER A;  2OCH A;  4DV5 B;  4NXN O;  2HKO A;  3EHB B;  1J5E B;  2Y0I A;  2A7W A;  4X9Q A;  1JFF B;  3K59 A;  1E1R G;  3TET A;  3B4S A;  1M90 W;  4WFE A;  1OCZ C;  5BR8 O;  3A8T A;  3KG2 A;  1JCH A;  1F51 A;  2EIN B;  4HZ3 A;  3CJH B;  3BVO A;  4LNU B;  4JI5 B;  2JS3 A;  3VQX A;  4ASU G;  1DLB A;  3K9A A;  3ABL C;  1FXK C;  5JVD A;  1Q6H A;  3HKB B;  3E8F A;  4ABM A;  3CD6 V;  2HEP A;  3I56 V;  1YIJ V;  1XHX A;  2Z5U A;  1R6K A;  5LXT A;  4DV3 B;  2P4K A;  3K3W A;  2B1I A;  4JI3 B;  1OCC C;  3LSU A;  1QLE C;  4LH6 A;  4O2A B;  2BOC C;  3ZBH A;  3Q4H B;  1YJW V;  4JV5 O;  1IXM A;  4JI8 O;  2F1M A;  2PI4 A;  2G38 A;  2RQ6 A;  3ABM B;  3IFX A;  4JI0 B;  2DWE C;  2ZXW B;  2E76 B;  1GN2 A;  1GK9 A;  2P67 A;  4EFB A;  1NKD A;  3TGU H;  4FFB B;  1IBK O;  3MHH C;  1RPR A;  3RYI A;  1NVP D;  4LF6 O;  5CBF A;  2Q67 A;  2KSD A;  1BGY H;  4EFE A;  5IYD O;  3RYC A;  1IDS A;  1MMM A;  1GM8 A;  2O57 A;  4O4I A;  4YY3 B;  4OPH A;  3CC7 V;  2ODM A;  5CB4 B;  5CBG A;  4X66 B;  1HR0 B;  1XOU A;  1GM7 A;  5LHG A;  4HYO A;  1DF4 A;  4LWS B;  1L1F A;  3F5W C;  4O2B A;  2OYQ A;  3P30 A;  2ITD C;  4FLX A;  5EC2 C;  1NJI W;  1NH2 B;  2E5L O;  3CWB H;  1TA8 A;  4GCZ A;  5JQG B;  1NQT A;  4DR3 B;  2NN4 A;  3SYO A;  4DUY O;  2E74 B;  4MVO A;  4FLV A;  1FKA O;  1SQG A;  4YIP A;  2YXH A;  4X64 B;  1S76 D;  1YCI A;  5IWA B;  2ZKO A;  1OHH G;  1SQV H;  2QWR B;  3CME V;  1MNG A;  4CS3 A;  1XEQ A;  4DR1 B;  4B3S O;  3AG3 C;  1MG1 A;  4J9Y B;  2CGN A;  5KX5 A;  1WLE A;  2VQE O;  4DRX A;  3ETG A;  1H38 A;  1L0N H;  5FL7 G;  4X1K A;  2RCV A;  4CC6 A;  4I9W A;  3DXR B;  2X6C A;  2HVK C;  2CAZ C;  1W0K G;  2JIZ G;  3OEE G;  4GT1 A;  4IHJ A;  2F23 A;  5LP6 A;  2W0X A;  5EBW C;  2KKW A;  2YID A;  3TXQ A;  4DR2 O;  4DXW A;  5LMU O;  3MD0 A;  3JAS B;  5C8Y A;  2ZD9 A;  3SPI A;  4J7Z A;  2M7W A;  1IBL B;  2UUC O;  2EIN C;  3OGI B;  3G6B A;  1F4M A;  4PI2 A;  4K35 A;  4XDK A;  3UT5 A;  2IW5 A;  1AVM A;  3JAK A;  2IJH A;  1TVK B;  5HFL A;  5JJE B;  1MZF A;  3E89 A;  2PZS A;  4QNH B;  3RWR D;  4P30 A;  2EUL A;  4MVM A;  1I0H A;  5IYZ A;  2DWD C;  3WFV A;  1BMF G;  1WNS A;  2ZE6 A;  5JVD B;  4JAU A;  2WLL B;  2DJV A;  1NTM H;  2ZXW C;  4IT5 A;  5LHH A;  2BTO A;  4GKJ O;  4X62 B;  1Q82 W;  1VQM V;  3ZCC A;  2HVJ C;  4J7J A;  1URF A;  5LXT B;  1XMQ O;  5DN6 G;  3ZS8 C;  3IC7 A;  3R65 A;  5JH7 A;  3D36 C;  4LFC O;  1Q6U A;  3VQY A;  2OTJ V;  4DR7 B;  3DC6 A;  4BW9 A;  4JYA B;  1RPO A;  2Y4U A;  5LYJ B;  1L8D A;  1ZX3 A;  4L87 A;  1KYO F;  5B3S B;  1RM1 B;  1S0V A;  3AG4 B;  3RYI B;  3D3I A;  1JQ0 A;  4NXM O;  4WFH A;  1A32 A;  2LFR A;  4PA6 A;  3ZRW A;  3KCX A;  4PI0 A;  3RGB A;  3APO A;  2AXT Z;  3S3W A;  4BWA A;  3QTC A;  4LFA O;  1Y66 A;  1YXB A;  3JAW A;  2WSS G;  3B2E E;  4O4I B;  1F23 A;  1AIL A;  4LF8 O;  1SQQ H;  1H2K A;  4NTW A;  4PV1 B;  4G2K A;  1XNR B;  3ZHR A;  1KMI Z;  4DR4 B;  3HKD A;  5EBM C;  1YTF D;  4CBC A;  4U3J B;  1WP7 A;  1UFI A;  2PYJ A;  3I5D A;  2KB1 A;  3W7X A;  2VQF O;  1K4C C;  5H6Q A;  4OPA A;  4LH7 A;  4QPK A;  3OMI B;  3RYH A;  5CA3 A;  4CS4 A;  2YSU B;  1IUR A;  2IJI A;  3CCU V;  5FPR A;  3ETD A;  2A06 H;  3CCM V;  3W7U A;  3OE7 G;  2OTL V;  3DGE A;  1YHQ V;  4TUY B;  3P32 A;  5KHI A;  2ATK C;  2W6J G;  3ASN B;  1SZT A;  1YDX A;  3OTO O;  1G4Y B;  1E1Q G;  3EVK A;  3K5N A;  3APQ A;  1SA0 A;  5D5Q A;  4DRX B;  4IYI A;  2HFE C;  3FAV A;  4GKK B;  2MK3 A;  1PNK A;  1MOF A;  4I5S A;  3OMA B;  5CA1 B;  1R3J C;  5B1A B;  4AHC A;  4FFK A;  1DGS A;  4H37 A;  1K33 A;  3LNM B;  5CA0 B;  4I0X B;  5LP6 B;  2BE3 A;  1WPX A;  3HKC B;  2PYL A;  3C3S A;  1NR7 A;  4LCU C;  4I9Q A;  5LMN B;  5C8Y B;  5DM6 V;  4DV7 B;  1V54 B;  1ENV A;  1VAR A;  1Z2G A;  1NI8 A;  4YHH B;  1QVG U;  4WCE V;  2JJ2 G;  2QE7 G;  5A9G A;  2YIA A;  3AK1 A;  5HFM A;  2YS8 A;  3VBB A;  4J41 A;  4N23 A;  3ZHV A;  1MA1 A;  1JJ2 U;  4HAM A;  4YIO A;  4DW1 A;  3ZED A;  4D6T H;  1M9N A;  4X20 A;  1JR9 A;  1HW7 A;  3TJT A;  2GTA A;  2NR5 A;  3S3X A;  4DV1 O;  2AGA A;  4NXN B;  3G71 V;  2VWJ A;  3B8N A;  1SQX H;  3H1I H;  4TV8 A;  2OIG A;  1Q43 A;  1AB3 A;  2F4V O;  1TUE B;  4JYC A;  3GB7 C;  2B5U A;  5EIB C;  4RQE A;  5CBH A;  5BR8 B;  4X1Y A;  5B3S C;  1K5Q A;  1RM1 C;  3CC4 V;  2CH7 B;  3AG4 C;  1QNM A;  4TSF G;  1QR9 A;  4AIL C;  2WLJ A;  1Q8I A;  3NXS A;  3UQ8 A;  1OV9 A;  3SJA C;  2JGD A;  2QKS A;  3X2Q B;  2GUZ A;  5EK0 A;  1V9P A;  1TGO A;  2ZDI A;  3GVM A;  2IU0 A;  1N33 B;  2Q5Z A;  1VQO V;  1X59 A;  4O4J A;  1LR1 A;  1YJN V;  2YEV A;  2Q0O C;  1VIB A;  2Z3Y A;  4JV5 B;  4UB8 Z;  1AI5 A;  5IY5 B;  2CTP A;  4JI8 B;  5DEC A;  1N8R W;  2UXC B;  3FFQ A;  3QO7 A;  1B6Q A;  2YXL A;  4UVB A;  2EIK B;  1NTK H;  4NYK A;  2X0L A;  4RO2 A;  2Y0P A;  3LSS A;  1XHZ A;  4MT8 A;  2VS0 A;  3QO5 A;  4O4H A;  1FFX B;  5D5P A;  1BZK A;  3F5T A;  1D2D A;  4PA3 A;  5FNV A;  4J11 A;  2P6J A;  3D8C A;  1IBK B;  3P3P A;  1JX9 A;  3CS5 A;  5KHJ A;  1XMO O;  3QNE A;  4LF5 B;  4LF6 B;  4MW8 A;  2ZR3 A;  4KP4 A;  3ASN C;  4IIJ A;  2EIM B;  1M93 A;  4JPR A;  4QPJ A;  2A0L A;  5L3B A;  1JMK C;  3HB3 B;  3N2G B;  1O9G A;  2LO1 A;  4FPP A;  4D7T A;  2BCC H;  4I4T A;  1FOU A;  4CH4 A;  4H44 B;  2UXD O;  3HPL C;  3KCY A;  4J10 A;  5LP6 C;  1N36 B;  4YJ2 B;  2E5L B;  3FYI B;  4B3T O;  4FLT A;  1AR4 A;  4DUY B;  3CRC A;  1Z5V A;  1V54 C;  4EEQ A;  1IBM O;  2WLK A;  4DR5 B;  2H94 A;  3OTF A;  2WWW A;  1H2L A;  3THO A;  2Q4P A;  2UUB O;  3OW2 U;  1U96 A;  1QQC A;  1S5L Z;  1K3E A;  2KG7 A;  2XAS A;  5A2Q N;  3IGA C;  4FIP C;  1TUB A;  3J80 N;  4MVR A;  5EYP A;  2UU9 O;  1FFT B;  4U7O A;  2QM4 A;  4DUZ O;  2ZE7 A;  1K5S A;  3QVN A;  1Q6I A;  1AI6 A;  3ZJZ A;  1MSD A;  4X89 A;  3ZN1 A;  1SQF A;  3FKS G;  4AQY O;  4DR2 B;  3ZHQ A;  5LMU B;  1K97 A;  1AP5 A;  5BXZ A;  2UUC B;  1XL4 A;  3FYE B;  4X20 B;  5GTH Z;  1JOY A;  3OR7 C;  2HG5 C;  4LF9 B;  4K3A A;  3T2M A;  1FJG O;  3X2Q C;  4W4L A;  4KXR A;  2EX3 A;  5KHK A;  2DN9 A;  4HNA B;  2N04 A;  4LF4 O;  1VEW A;  4JYB A;  4UUJ C;  1S3J A;  4X1Y B;  2XTA A;  5GON A;  4R50 A;  3IAY A;  1HNX B;  2XAH A;  1K73 W;  1HNW O;  5IJ9 B;  3PN1 A;  5IY5 C;  2RN9 A;  1UJW B;  4X1I B;  1JVM A;  2EIK C;  2ADQ B;  1QBZ A;  4BR6 A;  4X65 O;  2ZM6 O;  3H9V A;  3VOU A;  1Q90 D;  2Q9L A;  2GUZ B;  4JI1 O;  1OCO B;  2XT9 A;  4LC1 A;  1MSW D;  1FAF A;  5IYB O;  3A0H Z;  1XMQ B;  3K0D A;  4O4J B;  2YIC A;  5CN0 A;  3BRC A;  4IYH A;  1GH6 A;  4B7K A;  4R7C A;  2WLI A;  2ZQM A;  2HHH O;  4QIW F;  2UXB O;  2Q7E A;  3A0B Z;  3D3Q A;  5LOV B;  4CC5 A;  1XIL A;  3L72 H;  4PDM A;  2N05 A;  1ZL8 A;  5KMG B;  4RUE A;  3RT3 C;  2Q7G A;  2JJ1 G;  3NR7 A;  3ZIA G;  2BTQ B;  1AJQ A;  1AR1 B;  3ZRS A;  2Q69 A;  1GO3 F;  2RMK B;  3TCU A;  2F93 B;  1ROP A;  1CXZ B;  1KKD A;  4OX9 O;  1ZSP A;  5K1P A;  5KA5 A;  5LHI A;  4H0L B;  1HNZ O;  1R3L C;  4FK5 C;  4I4T B;  3JAM N;  1KB9 F;  4QE7 A;  2JVD A;  1GRJ A;  3K57 A;  4FLW A;  5H6R A;  2CE4 A;  1H2N A;  5J2U B;  1F7Y A;  4L8J A;  3FB6 C;  1XNQ O;  1AR5 A;  3C3T A;  4RQF A;  1Q86 W;  1M57 B;  3HKE B;  1SQB H;  1XRE A;  1VF6 A;  4D7S A;  4YJ3 A;  5F2V O;  3L71 H;  2DW4 A;  4JI6 O;  2ADP A;  3LDC A;  4BIO A;  4RAI A;  2IBZ H;  2YUA A;  3ZMZ A;  3PJS K;  1Z5W A;  3OEH G;  1NTZ H;  1EZV H;  4J42 A;  1N32 O;  2IJK A;  4LFB O;  3K5L A;  3OTO B;  1X4T A;  5KAI Z;  2PI5 A;  4JAV A;  5J2T A;  5DED A;  3RW0 A;  1J5E O;  2X6B A;  2Y69 B;  2JDI G;  1OJH A; 
#chains in the Genus database with same CATH homology
 1ZLZ A;  4X9Q A;  1LUV A;  1EM1 A;  1N0J A;  4C7U A;  1EN4 A;  3EVK A;  1PM9 A;  1JA8 A;  5AG2 A;  4YIP A;  1ZUQ A;  1I08 A;  1XIL A;  3BFR A;  3QVN A;  4GUN A;  1BT8 A;  1MNG A;  1MSD A;  4F6E A;  4FFK A;  1N0N A;  4JZ2 A;  1GN3 A;  1SZX A;  3IC9 A;  4JYY A;  3C3S A;  3DC6 A;  1Y67 A;  3KDR A;  1D5N A;  2P4K A;  1IX9 A;  1PL4 A;  2GDS A;  2RCV A;  1ZSP A;  3CEI A;  3LSU A;  1VAR A;  1ZTE A;  1WB8 A;  1AP5 A;  4E4E A;  2QKC A;  1WB7 A;  1IXB A;  2AW9 A;  2CE4 A;  1BS3 A;  5A9G A;  1GN6 A;  1GN2 A;  3AK1 A;  1AR5 A;  3AK3 A;  3C3T A;  1BSM A;  1MA1 A;  1XRE A;  1VEW A;  3K9S A;  4YIO A;  1B06 A;  2CDY A;  3KKY A;  3MDS A;  3DC5 A;  1P7G A;  2ADP A;  3AK2 A;  1JR9 A;  1AVM A;  3TJT A;  1LUW A;  1XUQ A;  3RN4 A;  1IDS A;  1MMM A;  1AR4 A;  1KKC A;  2ADQ B;  4BR6 A;  1XDC A;  1AP6 A;  3OT7 A;  1EN5 A;  1GN4 A;  1I0H A;  4JZG A;  1EN6 A;  2QKA A;  1QNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...