1JR9A

Crystal structure of manganese superoxide dismutases from bacillus halodenitrificans
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
201
Chain Sequence
KFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNGALEGHEDLKNKSLNDLISNLDAVPENIRTAVRNNGGGHANHSLFWKLMSPNGGGKPTGEVADKINDKYGSFEKFQEEFAAAAAGRFGSGWAWLVVNNGEIEIMSTPIQDNPLMEGKKPILGLDVWEHAYYLKYQNKRPDYISAFWNVVNWDEVAAQYSQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords manganese superoxide dismutase
publication title Three-dimensional structure of manganese superoxide dismutase from Bacillus halodenitrificans, a component of the so-called "green protein".
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 56
structure length 201
sequence length 201
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1jr9A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1jr9A02
3EVKA 1BS3A 1I08A 2QKCA 1AP6A 1IX9A 1VEWA 1QNMA 1JA8A 1VARA 1EN6A 1I0HA 4GUNA 3AK2A 3BFRA 1AR5A 4FFKA 3C3TA 2AW9A 3OT7A 1GN3A 1BT8A 4BR6A 2CE4A 1JR9A 1D5NA 1PL4A 1EM1A 1MMMA 4E4EA 1B06A 1MSDA 1ZUQA 1N0JA 4YIOA 1MNGA 2CDYA 3K9SA 1ZSPA 1LUWA 1ZTEA 3LSUA 4X9QA 1EN5A 3KKYA 1LUVA 1KKCA 2ADQB 1BSMA 3CEIA 4YIPA 3RN4A 1GN4A 3IC9A 2QKAA 4JYYA 1XREA 1XDCA 1XUQA 1PM9A 4JZ2A 3DC5A 1SZXA 1MA1A 2GDSA 1EN4A 1XILA 5AG2A 1GN2A 4F6EA 5A9GA 1Y67A 2RCVA 1AVMA 1P7GA 3QVNA 1WB7A 1IXBA 4JZGA 4C7UA 1AR4A 3TJTA 3DC6A 1ZLZA 2ADPA 3MDSA 1N0NA 3AK3A 3C3SA 1WB8A 2P4KA 1GN6A 3AK1A 1AP5A 1IDSA
chains in the Genus database with same CATH superfamily
4O2AB 2GV9A 1Y6XA 2EBOA 3K08A 1M57C 4O4IB 4FZ1A 4O4LB 3DGEA 2W6JG 5ITZB 3SDLA 3CCSV 4O2BA 2QTOA 4JYCA 5BMVB 2PI5A 3OGIB 1N33B 3STLC 2WLIA 1I7FA 2HEPA 3U10A 4KHPB 2A3QA 1JJOA 1NQTA 3B4SA 1VQKV 4FZ0A 1H2GA 3E83A 2CAZC 4K0KO 4FPPA 3H1IH 3TCUA 1M57B 3S3WA 4ICGA 2WWWA 3UM7A 1YJNV 4DV5B 3D3IA 1UFIA 3VQXA 3DSQA 1NZ6A 1AI4A 1OV9A 4WFHA 2ZDIC 2OTJV 5H5NA 3SYOA 1K5SA 1Q6UA 1FOUA 3JAWA 2BOCC 3K06A 3EHBB 1OJHA 1H2NA 1YTFD 2PUSA 2UXNA 3CD6V 2WAMA 4EB6A 2LJ2A 1N32B 2PZSA 1P7BA 4TUYA 4GX1A 2DOSA 3CXHF 3P3NA 3R65A 5B1AC 3D3QA 3N2KA 1E1QG 4U3FH 1ZL8A 4LP8A 4UVCA 2IW5A 3CCUV 1S5JA 1K33A 2QWQB 1IBMB 3QG5A 1FAFA 4D7TA 4UUJC 4NXNB 2YIAA 1M90W 4P9PA 2WA3A 3C3SA 2PYJA 1R1BA 4FM1A 3RFRA 2P5OA 3ASNC 1Q6HA 3G71V 4OPHA 4NXMB 4UB6Z 1I0HA 1SC5B 1O9HA 5B1AB 4MVOA 5BY1A 2OYQA 3RVZA 1HR0O 2EIJC 4F4LA 4DV0O 2WLNA 4LNUB 2IU3A 1OCRC 4BR6A 5B5EZ 4YHHB 4I7ZB 5LP6A 3MHHC 5IT9N 1JVMA 1VQ5V 2XAGA 1S72V 4A5UB 3ASNB 4DR2B 3OUFA 1JJ2U 2A79B 3MAQA 2IBZH 4XDLA 4ZI7A 1KYOF 4TQFA 4LF4O 4X64O 4D7SA 2IH1C 1BSMA 2Z0AA 2EIJB 1OCRB 2QKAA 1H2KA 2MW2B 2QM8A 3ML0A 3OE7G 4X88A 2AGAA 2ZQMA 5J2UB 2DYRC 2XOKG 1XNQO 2R9AA 3JATB 1MA1A 2Q7EA 1W0JG 1K92A 3IAYA 4CH5A 1GN2A 3G6BA 3SYAA 2UUBO 1L0NH 4MW8A 3CRMA 3P30A 4QJFB 5KMGA 3APQA 3T1CA 3CJHA 3NXSA 1HR0B 1B04A 3ZMTA 4DRXA 1LNQA 1BL8A 2F43G 3O65A 2NR5A 4F6RA 3F7YC 4DV1B 1L0LH 1ZWIC 3FAVA 1KP3A 4NYKA 3C90A 4NB5A 2FKXA 4PI0A 4ZIBA 2DYRB 1K8AW 2KB1A 2KKWA 4LFBO 3QO5A 5CB4B 2XT9A 4G2KA 5IWAB 1Y4MA 4QIWF 2Q4PA 4NR1A 5GONA 3T1YO 4GKJB 2Q5ZA 3CPWU 3KCYA 3OEHG 2NLJC 4GKKB 1WAZA 3OM3B 3ICXA 3G6EV 2UUAB 2JDIG 1PNMA 4DR5O 3LNMB 1J5EB 3TK1A 2YXYA 1Q7YW 2ZE6A 4K3AA 3CCJV 1PL4A 4DV2B 4X89A 4DV6O 1K9MW 4DR3B 4B3SO 4PA6A 4BIZA 2CDYA 1I5YA 2EZOA 2MK3A 5BXZA 1FXKA 2P67A 3RVYA 5KLVH 1QVGU 1K7DA 1R6KA 4DR6B 1FFTB 1LUVA 4YY3O 3HKDA 1WP8A 3JAMN 4KXRA 2JGUA 3RN4A 4JI2B 3CB2A 4DUZO 4N23A 4FLYA 1QU7A 3HKCA 5CMUA 1Y74A 1TUBA 2NN4A 2HR3A 1O9GA 1SERA 5EBLC 2E5LO 1Y76B 4J41A 3TXQA 1R73A 4X65O 3RGBA 3ZJZA 2CGOA 3I5DA 4JZGA 3T1HB 1S5LZ 1FJGO 2X6BA 1HNWB 1SQGA 1BCCH 2V1DA 2HG5C 4PA9A 5IYCO 1T5EA 4KFMA 4DV7O 2UXBO 2LFSA 4I5SA 4B3SB 3E2EA 4DV3O 4PDRA 4I50A 1XI1A 1JPXA 5IJ9B 4N21A 4MTGA 4NTWA 1BZKA 1XNRO 4LR3A 3L71H 2CUGA 3HKEB 3N2GB 4J80A 2YXHA 4X20B 2R9RB 3ZRWA 2OCHA 2HHHB 3T2MA 1AR5A 4B3TO 3RYCB 3P32A 1Z5VA 3TGUH 1B6QA 1VQ4V 3LSQA 2BOBC 2HKOA 1YHQV 4XDJA 4I0XA 5DN6G 1VQ7V 1P49A 3ZHVA 1VQ8V 1JFFA 2XUMA 5KUKA 3QF7A 3FFQA 2CH7A 1XMQB 2QR4A 2HVKC 4U3JA 5B3SC 2QDOA 4LWSB 1NKDA 2AHYA 2RMKB 3RYHB 2QTSA 2F66C 1X4TA 3ZHTA 2UXCB 4EEQA 2FL4A 1NS1A 2GBOA 3GVMA 3F7VC 1S77D 2LGQA 2ZCEA 4IHJA 4C7UA 3OR6C 5B3SB 2EJRA 1Z2GA 3CC4V 5IYDO 3OMIB 1IBLB 2WLHA 3VBBA 1HW7A 3ZCCA 1GH6A 2AXTZ 2DWDC 2XTAA 4UV9A 2EINC 1YSCA 3JD2A 5L3EA 4I4TB 1KMIZ 3H1JH 4LF7O 1IBKB 1DLBA 3T4DA 2B1IA 4RO2A 2Q0AA 1YZBA 1NH2B 1DK1A 5HFMA 1I08A 3F5TA 1XMOB 4JI7O 1JA8A 2P90A 2Q6AA 4FLXA 1I94O 3K57A 4FFBB 1LR1A 1MZEA 4CS2A 1NI8A 1GO3F 2EULA 3K5OA 1QR8A 4I55A 4MVUA 4XBFA 2OTLV 1RFYA 2Y4UA 3ASOC 2EINB 3ZHUA 5IJ0B 5IYZA 1N4CA 4IGGA 2ITCC 5C93A 4FM0A 1MNGA 4H0LB 5EZYB 3AG3C 4H13B 4LF6O 3J81N 3FB8C 1EN5A 3CCEV 4HNAA 3ZMSA 3B8MA 4PHZA 3JSNA 1KKCA 1NT2B 4YIPA 4J42A 5EBMC 4G27B 4PDMA 4WBNA 5BR8O 5LA6A 4NTYA 5EC1C 3ASOB 2ZR3A 1YJ9V 1SESA 4DR7O 2P22C 3O9OA 2RJZA 2YEVB 1RSOA 1MOFA 2Q0OC 4R7CA 1X59A 3CYOA 3LUTB 4IYHA 4KL1A 1P7GA 2QWRB 3AG3B 2UUCB 3OMAB 1YXBA 1L8DA 5J9PC 3HB3B 3FYIB 4MVSA 3K0DA 4PA4A 3B8NA 2WSSG 1N33O 3SJCC 3MHSC 3SGIA 1N0NA 1Q43A 2QWNB 1MSWD 1FPOA 2HJDA 4OPAA 4KHPO 4PDVA 3HR0A 4JTAB 5J2TB 2DN9A 4MVMA 3ABKC 4Z2WA 1SA0A 3JALA 4JI6B 4DV4B 2PY5A 3JASA 1IJGA 3ZRSA 4DV5O 2WLLB 2X6CA 1AJNA 2QKSA 1M56C 1SRYA 4WFEA 4JAVA 2JGDA 1B3QA 2RDCA 1G8MA 4X1YB 3SPJA 4QPJA 2PGGA 3CX5F 3BRCA 3ABKB 3ZS8C 1K4DC 1FXVA 4L87A 1HNZB 1TA8A 1N32O 4CS3A 1KUQA 2ZXWC 4OGQB 5LOVA 4B3RB 5CBGA 3UT5A 3E8FA 1M56B 5H2FZ 5KHIA 4GX2A 1IBMO 4UCSA 2ZNIA 3L70H 3CCRV 1JX9A 1VF7A 4NXNO 1IVSA 2GDSA 3DXRA 4CS4A 1K34A 5AG2A 1AJPA 4MVQA 3SYQA 3K3WA 3CCQV 1OZ0A 4J11A 4AILC 2RCVA 4NXMO 3E22A 1JCHA 4X1KB 2ZXWB 5DEDA 1H8HG 4GZRB 4LC1A 3Q4HA 2RN9A 3CXCU 1DF5A 4UB8Z 5F2VO 4ZKIA 1ZLZA 2H94A 3EFFK 5LHHA 4JI3O 4TT3G 1ORQC 3OTFA 3CMAV 1JNBA 4YHHO 1WA8A 2F23A 2KG7A 2RNBA 4FJCC 3WU2Z 3PJSK 4FLZA 1SQPH 1AJQA 2ZIOA 3TETA 1N34B 4JTCB 2DQ3A 3IGAC 4DR2O 5D5QA 3U11A 4RWUA 1NVPB 1J95A 3LDDA 3A0HZ 1FS0G 3ABLC 2CTRA 2XASA 4JI4B 3X2QC 5K1XA 4TV8B 4ZHQB 2V7QG 3LDCA 3RYFA 5FNVB 2ODMA 3DTUB 3OD4A 2W6IG 1IXMA 4H37A 1EBOA 1RPOA 4IT5A 5GTIZ 3H9VA 5IY5C 5KX5B 3RYIB 3SPCA 4PD4F 2ARHA 3OTOB 4PV1B 2DE0X 4UVBA 2IM9A 4O4JA 3D36C 1DF4A 1R6TA 4JI3B 2L35A 2GUZA 2ADQB 3ABLB 3AEIA 1SQVH 4DV1O 3X2QB 1VF6A 4O4HA 3SPGA 3JAKA 2BE3A 5JH7B 2BSKA 3SJQC 1XREA 2GHYA 5D5PA 4IYIA 4QPKA 3JARA 3CCVV 3KG2A 2ITDC 4TV9A 5IY5B 1F23A 4X1IB 3OUSA 5IWAO 5LXTA 3FYEB 1H8EG 4GKJO 5LMNB 4AQYB 1NJIW 2V4DA 1Y66A 4GKKO 1MABG 1FFXB 2UUAO 2A06H 3FX7A 4U7NA 1J5EO 1VQ6V 5B1BC 1YITV 3QTCA 4DV2O 3E8BA 1YF2A 2Q7HA 3T4ZA 3UCSC 5B66Z 3HKBB 4JI5B 3ZHRA 5JQGA 5L3CA 2UU9B 2BTQA 4DR3O 4JI0B 3CE2A 2NNUA 3BPZA 1NU1H 3FB7C 2QWPB 5LMUB 1OCOC 1NH2D 1QNMA 4DO2A 5CA0A 1GTOA 4DR6O 3ETDA 2WLKA 3ZEDA 1PV0A 4JI2O 1Q8IA 1P84F 3CSXA 4IIJA 3WFVA 5CA1A 5B1BB 2QJ1A 1BQ0A 2N05A 2QGNA 1TUEB 4B7EA 3VQYA 2EZPA 1UJWB 2B5UA 5K1PA 1HWYA 1VIBA 5CBHA 5LHIA 4YJ3B 3LSUA 1OCOB 4FMTA 1PKXA 3ZMZA 5JCOC 4QE9A 1KU9A 4O2AA 3OR7C 3KKYA 3BABA 2IJKA 4O4IA 4JYBA 4O4LA 2Q9LA 4JI8B 3T1HO 2X6AA 3E35A 3W7SA 5ITZA 2VWJA 5JVDB 1HNWO 3IC9A 4I9WA 1R3KC 5BMVA 5KA5A 3ZMUA 1VP7A 1YVWA 1XUQA 4D6TH 1W59A 3DC5A 2LFRA 1VQ9V 1G6UA 2RQ6A 3SJAC 5KHKA 4DXWA 5EBWC 2PYLA 2ATKC 3CRAA 2ZM6B 1Q86W 3QVNA 1WN7A 3RBZA 3AG2C 4MTFA 4H33A 4K8ZA 2HHHO 3K58A 4IL6Z 4LF5B 2QWOB 3CWBH 2EX3A 1AILA 5C8YB 1VMGA 4EFEA 4TWKA 3RT3C 1FXHA 2E3CA 2JEUA 3FKSG 1W2BU 4MTXA 4UCVA 3WG7C 1ZX3A 4J9ZB 4UCRA 1PD3A 3LNNA 2UXXA 1XMQO 3AG2B 3AK2A 1AB3A 2EIMC 4PELA 1YIJV 2DWEC 2OCCC 1GN3A 3BVOA 2R70A 2ZDIA 3B77A 2ZE5A 3GB7C 2JS5A 5EIBD 4X8AA 5LL6Y 3BEHA 2UXCO 3B2EE 1YTFB 4RAIA 4YIOA 4ZOLB 1ZSPA 3WG7B 1TVKB 4JAAA 1QR9A 4JAUA 1HP8A 4WFAV 5LYJB 2EIMB 1OCZC 1BMFG 2X0LA 4LFAB 1IBLO 4LNUA 4J10A 5EYPB 1SF9A 1NTKH 1SZXA 3ZHQA 1EN4A 3R66A 1IBKO 2YI8A 1WNSA 2LO1A 3CP1A 1XMOO 3ABMC 3N27A 1VQPV 1MZFA 3BAAA 1IXBA 2KQXA 2YUAA 5DM6V 1GM9A 3QO7A 4O2BB 1AR4A 4LF9O 2ZT9B 3CRCA 4EFBA 2UXDB 1OCZB 4DR4B 4HYOA 1JMKC 4LF8B 3KDRA 2WLIB 2YC0A 3RW0A 1H2LA 4JI1B 5J2UA 4NTXA 5KHHA 2HFEC 3JATA 1N36B 4P9OA 1AP5A 3FB5C 1V55C 1D2DA 1FYJA 1TGOA 3KZIZ 3ABMB 1R3JC 4TQDA 1Q5OA 4GUNA 1NVPD 1KBHA 5KAIZ 4DR1B 3M8AA 4GLXA 1ENVA 3OT7A 4JYAB 5CA3A 1NTMH 2PTMA 2Q8VA 1D5NA 3JAWB 2EIKC 5FLXN 1SQQH 2JK5C 3L73H 2LW7A 1S3JA 1DGSA 4B3MB 5GW7A 4EB6B 3FD9A 5JWPA 5CB4A 4WFFA 1V55B 5B1OA 5KA6A 4TUYB 3W7WA 4LF9B 2UUCO 1WPXA 3BA8A 3N2KB 3WB0A 1ZL8B 1E79G 1Q90D 1YEWA 5FPRA 1H38A 3K79A 3I55V 4JASA 5KAFZ 3VQVA 2E74B 3E8HA 4GX0A 3A2FA 3ETEA 3JD4A 5LP6C 3JSLA 2EIKB 1QBZA 1OHHG 3OMNB 4EKWA 4X66B 4PA7A 2QSAA 2YIBD 4K35A 4OXSA 4KUMA 1BQZA 2OWOA 3GWOA 3QNEA 3K5MA 3ETGA 4R8CA 4JI6O 4JTDB 2FTKA 1KC8W 4DV4O 4H44B 1A32A 2DMXA 2N04A 1SS3A 2C2AA 1YJWV 1EZVH 2Q67A 4YJ2B 3ZN0A 5LP6B 2F1MA 4B08A 4W4KA 2Y69C 1B06A 3GWKC 1IDSA 1SQBH 3EVKA 2O57A 1HNZO 1Y76A 3ZBHA 4ZI7B 1G1XB 1VARA 4ASUG 3APOA 3K04A 5EC2C 4B3RO 2B9ZA 1R3IC 5LBQA 1L1FA 2Z5UA 3K0GA 2A7WA 3BY6A 1MMMA 2ILMA 4MT8A 2QM7A 1SETA 2Y69B 5E1AC 2VQFB 3EXAA 2HLDG 4QE7A 5IJ9A 4HAMA 2R72A 1V54C 3K03A 5KMGB 3CJHB 2VQEB 4JV5B 3WB1A 4DRXB 2H3OA 5H6QA 3HKEA 3N2GA 1SQFA 3SJBC 4F6RB 4X20A 1BHAA 1MG1A 3PN1A 1P4RA 1SKVA 4DW1A 1M9NA 3FAVB 2FMLA 3RYCA 3L74H 4DUYB 3JYCA 1HNXB 5LHGA 1PM9A 4B7KA 1QLNA 3W7UA 1FXKC 1V54B 5GONB 4BW5A 1N34O 3QO8A 1XEQA 3OW2U 3IC7A 4XDKA 2P6JA 2P7TC 1CP9A 5CBFA 3ETQA 4LWSA 4JI4O 1DTOA 3MDSA 4LH6A 3SPHA 1XOUA 3AG4C 3RYHA 3H1HH 5HFLA 1N8RW 5IYBO 5IE9A 5EK0A 1Q6IA 2K9PA 1FXKB 1VQOV 4UCTA 3F5WC 3OTOO 1AP6A 1IX9A 4Q20A 3AG1C 3E89A 1EN6A 2CK3G 1S0VA 3HKDB 4FIPC 3OAAG 1RP3B 2VS0A 3C3TA 2DJVA 3SPIA 4OX9O 4JGSA 3E8GA 1WPBA 4P2ZA 3OGCC 3HKCB 3AG4B 4GCZA 1Y74B 1TUBB 3K59A 3B09A 2FYUH 2WA4A 1VQLV 4GX5A 2JJ1G 2Y48A 1K73W 4I9QA 1MSDA 1ZUQA 4I4TA 2F4VB 2ZINA 1AI5A 1IZ3A 3J7AU 2M6YA 1ZTEA 4X9QA 4BIOA 3IFXA 2OIEA 3AG1B 3L72H 5LMNO 4AQYO 4L8JA 1JOYA 2ZNJA 1AROP 4FFBA 1V9PA 2IH3C 3L9DA 2M7WA 3W7XA 1XDCA 4I50B 1PL0A 3G4SV 2G38A 4J7JA 5IJ0A 4X62O 4U7OA 4RUFA 1YCIA 3SYPA 4JI5O 1IURA 2UU9O 4TSFG 5CN0A 4JI0O 4K0KB 1NR7A 3LDEA 5LMUO 1M5IA 3CS5A 5EZYA 2XHBA 5LGUA 3ZRWB 2PI4A 4OX9B 2FB5A 1FD9A 2CTWA 2ZE7A 2VWKA 2P06A 4QGPA 2Z3YA 3G67A 3RWRD 4I0XB 1TAEA 3STZC 4CZZA 4MS2A 4ABMA 4JPRA 5DECA 3JD3A 1EZJA 4MVRA 1JFFB 2GTSA 4YJ2A 3AG7A 5JJEB 2YEVA 1KQSU 4NKGB 1VQMV 1W0KG 2QKCA 2CH7B 2OT5A 4Z1MG 4U3JB 2YDEA 4JI8O 4FFKA 4WF9V 5E79Z 5KUMA 2XNDG 4CH3A 1BT8A 5FL7G 2E76B 4X62B 3OFNG 1Q82W 1CEZA 2XAQA 2A0LA 1GKFA 1Z5WA 1R3LC 3SYCA 4P30A 3CRRA 1UPGA 4LCUC 2BTOA 3ZRVA 3JCZA 3CC7V 5J2TA 2ZD9A 3K9SA 2XAJA 3UO2A 1WP7A 2ZM6O 4IHJB 2K1EA 5H6RA 5IDJA 3CRQA 1VQNV 4RQFA 1M93A 3CEIA 1F4MA 4DV0B 2CTQA 4LF5O 2WLLA 5H9CA 4AHCA 2D3OW 3THOA 4J7ZA 2Y4TA 4BAYA 4DK0A 1BHBA 2LQTA 2IJIA 4RQEA 4UFZA 3H1KH 3WB2A 2JJ2G 4W4LA 5JJJB 2JVDA 4X1YA 1M4UA 1NTZH 3A0RA 1CXZB 1H2SB 3ZMVA 1K4CC 3ZHSA 2L6LA 5KHGA 3U0ZA 3JCUZ 1BE3H 1WB7A 4LF4B 2ETNA 4X64B 1XL6A 1GMGA 3L75H 3A0BZ 2KSDA 4CC5A 4I55B 5L3GA 5IYZB 1URFA 3TXSA 1XNQB 3ZX6A 5JJNB 2DW4A 2IJJA 1F4NA 4PJ0Z 1QCEA 1SZTA 1S76D 1GN6A 3OEEG 2UUBB 3AK1A 1NR1A 1OCCC 1QVFU 3NR7A 4HNAB 4FM2A 2AZ0A 3SR2C 4X1KA 1KP2A 3S3XA 2YICA 3CCMV 3IJ4A 3A8TA 4WBNB 4LFAO 5LA6B 2HVJC 2CE4A 1G4YB 1PNLA 1Q3EA 3VQWA 1KD1W 2XAFA 3H01A 3BA9A 4E4EA 1RSOB 2X7RB 4LFBB 4PA3A 4FLTA 3ABTA 1KECA 2QA4V 1KB9F 3UKMA 4WFBV 1NBMG 1LUWA 1OCCB 3T1YB 1H5WA 2CGNA 1S5HC 2LW1A 3E86A 2EJ7A 2QEXV 5L3DA 1WJZA 4FVMA 2UXDO 1GN4A 4E2LA 4DR4O 4DR5B 4TV8A 4MTOA 4ZHQA 4JYYA 4LF8O 1XHZA 2Q73A 4FK5C 5FNVA 4CC6A 4PI2A 4JI1O 1Q81W 4DV6B 1COWG 5FPOA 2GTAA 1N36O 2OIGA 1SA0B 3JALB 2JS3A 5KX5A 3RYIA 3JASB 2F95B 3W7TA 1AI6A 1ZAUA 3D8CA 2Q7GA 4UCUA 2OCCB 1E1RG 4YY3B 1K5QA 5A2QN 4DR1O 3JD0A 2HJFC 2XAHA 4DUZB 1D5AA 1I5XA 2ZR2A 2JGDB 4JYAO 5JH7A 4BW9A 3ZIAG 1XHXA 2Y0PA 3CCLV 2YIBA 4GYCB 1QLEC 1GAXA 1WB8A 4J7KA 4B3MO 2P4KA 2E5LB 1HDJA 4X1IA 2YI9A 3UQ8A 3K5LA 4PDLA 1BS3A 2YSUB 1VEWA 4X65B 3BHPA 5LOVB 4MW3A 1AI7A 4TOIA 5L3FA 2D2CB 2EILC 3D36A 2IJHA 3UT5B 2ZIMA 1FKAO 3BFRA 4R50A 4JF3A 1FJGB 2ZKOA 4R6ZA 4DV7B 1FFXA 3K9AA 1CPYA 2UXBB 4J9YB 3UO3A 4LH7A 3B40A 1EM1A 1GRJA 3K5NA 4DV3B 4K8XA 2WLJA 3DXRB 2DQ0A 4X66O 1QLEB 5BZBA 3HKBA 3E22B 1XNRB 4FLWA 3LSSA 3BCCH 1SQXH 3HPLC 3Q4HB 2EILB 4WCEV 4B3TB 2Q68A 5LGNA 4KP4A 4CH6A 4GT1A 2W0XA 4BWAA 5B1NA 2CTPA 1WA8B 2KG7B 2B1GA 2W0FC 1PP9H 4NVPA 5LGTA 3M99B 2JIZG 4LFCO 1U97A 3ZRXA 1XILA 4Z1VA 2ZE8A 1Y67A 4DK1A 1AVMA 1VF5B 1THZA 4YJ3A 1GM8A 4CBCA 1QQCA 4FLUA 2WLMA 3J80N 1VF6C 4HZ3A 2A9HA 4G28B 3RYFB 3M7MX 2GSMB 5JVDA 2ADPA 1BGYH 3MD0A 3CC2V 2IU0A 3AK3A 1YDXA 1KKDA 4WFGA 2P4VA 5GTHZ 2VQFO 4UVAA 2F93B 3H1LH 3G80A 1YI2V 2H8PC 4O4JB 1WLEA 2VQEO 4JV5O 2QE7G 4ZBMA 4QNHB 4MSWC 5JCOA 2GUZB 2Y0IA 2JEXA 4O4HB 3JAKB 4Q6GA 3CMEV 3FB6C 2AW9A 1QHTA 2BSKB 1K3EA 4DUYO 4LFCB 1JR9A 1RPRA 5C8YA 1HNXO 2AZ2A 3JARB 2LP7A 1F51A 2VRZA 4TV9B 4UCOA 2QM4A 1GK9A 4LF7B 1ROPA 1N0JA 1XQ8A 5LXTB 2BCCH 4UV8A 4RUEA 1PNKA 1H2MA 4HBNA 1EFRG 5TISZ 1F7YA 1US6A 2DYSC 3CHXA 4JI7B 1RM1C 1I94B 1AR1B 4FLVA 4BIUA 4MVZA 4DYLA 2YIDA 5KHJA 4JZ2A 5JQGB 2BTQB 2LGWA 2YS8A 4LBEC 5EIBC 1M1KW 2AHZA 2PF4E 3VOUA 1XL4A 4F6EA 5A9GA 4UXNA 2N74A 3KCXA 2WPDG 2Q69A 4ZOLA 4DW0A 4LF6B 1R6NA 2DYSB 5CA0B 3ZN1A 3I56V 3P3PA 1TVKA 2YXLA 1RM1B 1JQ0A 3ABUA 2E75B 2JRIA 2HP8A 5LYJA 3TJTA 1PPJH 3DC6A 2R9IA 4IIJB 5CA1B 5BR8B 1GM7A 3JD1A 4CH4A 4DR7B 5L3BA 5EYPA 4YXWG 4AI8A 1U96A 2F4VO 1XBLA 1K97A
chains in the Genus database with same CATH topology
3EVKA 1BS3A 1I08A 2QKCA 1AP6A 1IX9A 1VEWA 1QNMA 1JA8A 1VARA 1EN6A 1I0HA 4GUNA 3AK2A 3BFRA 1AR5A 4FFKA 3C3TA 2AW9A 3OT7A 1GN3A 1BT8A 4BR6A 2CE4A 1JR9A 1D5NA 1PL4A 1EM1A 1MMMA 4E4EA 1B06A 1MSDA 1ZUQA 1N0JA 4YIOA 1MNGA 2CDYA 3K9SA 1ZSPA 1LUWA 1ZTEA 3LSUA 4X9QA 1EN5A 3KKYA 1LUVA 1KKCA 2ADQB 1BSMA 3CEIA 4YIPA 3RN4A 1GN4A 3IC9A 2QKAA 4JYYA 1XREA 1XDCA 1XUQA 1PM9A 4JZ2A 3DC5A 1SZXA 1MA1A 2GDSA 1EN4A 1XILA 5AG2A 1GN2A 4F6EA 5A9GA 1Y67A 2RCVA 1AVMA 1P7GA 3QVNA 1WB7A 1IXBA 4JZGA 4C7UA 1AR4A 3TJTA 3DC6A 1ZLZA 2ADPA 3MDSA 3KDRA 1N0NA 3AK3A 3C3SA 1WB8A 2P4KA 1GN6A 3AK1A 1AP5A 1IDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVK A;  1BS3 A;  1I08 A;  2QKC A;  1AP6 A;  1IX9 A;  1VEW A;  1QNM A;  1JA8 A;  1VAR A;  1EN6 A;  1I0H A;  4GUN A;  3AK2 A;  3BFR A;  1AR5 A;  4FFK A;  3C3T A;  2AW9 A;  3OT7 A;  1GN3 A;  1BT8 A;  4BR6 A;  2CE4 A;  1JR9 A;  1D5N A;  1PL4 A;  1EM1 A;  1MMM A;  4E4E A;  1B06 A;  1MSD A;  1ZUQ A;  1N0J A;  4YIO A;  1MNG A;  2CDY A;  3K9S A;  1ZSP A;  1LUW A;  1ZTE A;  3LSU A;  4X9Q A;  1EN5 A;  3KKY A;  1LUV A;  1KKC A;  2ADQ B;  1BSM A;  3CEI A;  4YIP A;  3RN4 A;  1GN4 A;  3IC9 A;  2QKA A;  4JYY A;  1XRE A;  1XDC A;  1XUQ A;  1PM9 A;  4JZ2 A;  3DC5 A;  1SZX A;  1MA1 A;  2GDS A;  1EN4 A;  1XIL A;  5AG2 A;  1GN2 A;  4F6E A;  5A9G A;  1Y67 A;  2RCV A;  1AVM A;  1P7G A;  3QVN A;  1WB7 A;  1IXB A;  4JZG A;  4C7U A;  1AR4 A;  3TJT A;  3DC6 A;  1ZLZ A;  2ADP A;  3MDS A;  1N0N A;  3AK3 A;  3C3S A;  1WB8 A;  2P4K A;  1GN6 A;  3AK1 A;  1AP5 A;  1IDS A; 
#chains in the Genus database with same CATH topology
 4O2A B;  2GV9 A;  1Y6X A;  2EBO A;  3K08 A;  1M57 C;  4O4I B;  4FZ1 A;  4O4L B;  3DGE A;  2W6J G;  5ITZ B;  3SDL A;  3CCS V;  4O2B A;  2QTO A;  4JYC A;  5BMV B;  2PI5 A;  3OGI B;  1N33 B;  3STL C;  2WLI A;  1I7F A;  2HEP A;  3U10 A;  4KHP B;  2A3Q A;  1JJO A;  1NQT A;  3B4S A;  1VQK V;  4FZ0 A;  1H2G A;  3E83 A;  2CAZ C;  4K0K O;  4FPP A;  3H1I H;  3TCU A;  1M57 B;  3S3W A;  4ICG A;  2WWW A;  3UM7 A;  1YJN V;  4DV5 B;  3D3I A;  1UFI A;  3VQX A;  3DSQ A;  1NZ6 A;  1AI4 A;  1OV9 A;  4WFH A;  2ZDI C;  2OTJ V;  5H5N A;  3SYO A;  1K5S A;  1Q6U A;  1FOU A;  3JAW A;  2BOC C;  3K06 A;  3EHB B;  1OJH A;  1H2N A;  1YTF D;  2PUS A;  2UXN A;  3CD6 V;  2WAM A;  4EB6 A;  2LJ2 A;  1N32 B;  2PZS A;  1P7B A;  4TUY A;  4GX1 A;  2DOS A;  3CXH F;  3P3N A;  3R65 A;  5B1A C;  3D3Q A;  3N2K A;  1E1Q G;  4U3F H;  1ZL8 A;  4LP8 A;  4UVC A;  2IW5 A;  3CCU V;  1S5J A;  1K33 A;  2QWQ B;  1IBM B;  3QG5 A;  1FAF A;  4D7T A;  4UUJ C;  4NXN B;  2YIA A;  1M90 W;  4P9P A;  2WA3 A;  3C3S A;  2PYJ A;  1R1B A;  4FM1 A;  3RFR A;  2P5O A;  3ASN C;  1Q6H A;  3G71 V;  4OPH A;  4NXM B;  4UB6 Z;  1I0H A;  1SC5 B;  1O9H A;  5B1A B;  4MVO A;  5BY1 A;  2OYQ A;  3RVZ A;  1HR0 O;  2EIJ C;  4F4L A;  4DV0 O;  2WLN A;  4LNU B;  2IU3 A;  1OCR C;  4BR6 A;  5B5E Z;  4YHH B;  4I7Z B;  5LP6 A;  3MHH C;  5IT9 N;  1JVM A;  1VQ5 V;  2XAG A;  1S72 V;  4A5U B;  3ASN B;  4DR2 B;  3OUF A;  1JJ2 U;  2A79 B;  3MAQ A;  2IBZ H;  4XDL A;  4ZI7 A;  1KYO F;  4TQF A;  4LF4 O;  4X64 O;  4D7S A;  2IH1 C;  1BSM A;  2Z0A A;  2EIJ B;  1OCR B;  2QKA A;  1H2K A;  2MW2 B;  2QM8 A;  3ML0 A;  3OE7 G;  4X88 A;  2AGA A;  2ZQM A;  5J2U B;  2DYR C;  2XOK G;  1XNQ O;  2R9A A;  3JAT B;  1MA1 A;  2Q7E A;  1W0J G;  1K92 A;  3IAY A;  4CH5 A;  1GN2 A;  3G6B A;  3SYA A;  2UUB O;  1L0N H;  4MW8 A;  3CRM A;  3P30 A;  4QJF B;  5KMG A;  3APQ A;  3T1C A;  3CJH A;  3NXS A;  1HR0 B;  1B04 A;  3ZMT A;  4DRX A;  1LNQ A;  1BL8 A;  2F43 G;  3O65 A;  2NR5 A;  4F6R A;  3F7Y C;  4DV1 B;  1L0L H;  1ZWI C;  3FAV A;  1KP3 A;  4NYK A;  3C90 A;  4NB5 A;  2FKX A;  4PI0 A;  4ZIB A;  2DYR B;  1K8A W;  2KB1 A;  2KKW A;  4LFB O;  3QO5 A;  5CB4 B;  2XT9 A;  4G2K A;  5IWA B;  1Y4M A;  4QIW F;  2Q4P A;  4NR1 A;  5GON A;  3T1Y O;  4GKJ B;  2Q5Z A;  3CPW U;  3KCY A;  3OEH G;  2NLJ C;  4GKK B;  1WAZ A;  3OM3 B;  3ICX A;  3G6E V;  2UUA B;  2JDI G;  1PNM A;  4DR5 O;  3LNM B;  1J5E B;  3TK1 A;  2YXY A;  1Q7Y W;  2ZE6 A;  4K3A A;  3CCJ V;  1PL4 A;  4DV2 B;  4X89 A;  4DV6 O;  1K9M W;  4DR3 B;  4B3S O;  4PA6 A;  4BIZ A;  2CDY A;  1I5Y A;  2EZO A;  2MK3 A;  5BXZ A;  1FXK A;  2P67 A;  3RVY A;  5KLV H;  1QVG U;  1K7D A;  1R6K A;  4DR6 B;  1FFT B;  1LUV A;  4YY3 O;  3HKD A;  1WP8 A;  3JAM N;  4KXR A;  2JGU A;  3RN4 A;  4JI2 B;  3CB2 A;  4DUZ O;  4N23 A;  4FLY A;  1QU7 A;  3HKC A;  5CMU A;  1Y74 A;  1TUB A;  2NN4 A;  2HR3 A;  1O9G A;  1SER A;  5EBL C;  2E5L O;  1Y76 B;  4J41 A;  3TXQ A;  1R73 A;  4X65 O;  3RGB A;  3ZJZ A;  2CGO A;  3I5D A;  4JZG A;  3T1H B;  1S5L Z;  1FJG O;  2X6B A;  1HNW B;  1SQG A;  1BCC H;  2V1D A;  2HG5 C;  4PA9 A;  5IYC O;  1T5E A;  4KFM A;  4DV7 O;  2UXB O;  2LFS A;  4I5S A;  4B3S B;  3E2E A;  4DV3 O;  4PDR A;  4I50 A;  1XI1 A;  1JPX A;  5IJ9 B;  4N21 A;  4MTG A;  4NTW A;  1BZK A;  1XNR O;  4LR3 A;  3L71 H;  2CUG A;  3HKE B;  3N2G B;  4J80 A;  2YXH A;  4X20 B;  2R9R B;  3ZRW A;  2OCH A;  2HHH B;  3T2M A;  1AR5 A;  4B3T O;  3RYC B;  3P32 A;  1Z5V A;  3TGU H;  1B6Q A;  1VQ4 V;  3LSQ A;  2BOB C;  2HKO A;  1YHQ V;  4XDJ A;  4I0X A;  5DN6 G;  1VQ7 V;  1P49 A;  3ZHV A;  1VQ8 V;  1JFF A;  2XUM A;  5KUK A;  3QF7 A;  3FFQ A;  2CH7 A;  1XMQ B;  2QR4 A;  2HVK C;  4U3J A;  5B3S C;  2QDO A;  4LWS B;  1NKD A;  2AHY A;  2RMK B;  3RYH B;  2QTS A;  2F66 C;  1X4T A;  3ZHT A;  2UXC B;  4EEQ A;  2FL4 A;  1NS1 A;  2GBO A;  3GVM A;  3F7V C;  1S77 D;  2LGQ A;  2ZCE A;  4IHJ A;  4C7U A;  3OR6 C;  5B3S B;  2EJR A;  1Z2G A;  3CC4 V;  5IYD O;  3OMI B;  1IBL B;  2WLH A;  3VBB A;  1HW7 A;  3ZCC A;  1GH6 A;  2AXT Z;  2DWD C;  2XTA A;  4UV9 A;  2EIN C;  1YSC A;  3JD2 A;  5L3E A;  4I4T B;  1KMI Z;  3H1J H;  4LF7 O;  1IBK B;  1DLB A;  3T4D A;  2B1I A;  4RO2 A;  2Q0A A;  1YZB A;  1NH2 B;  1DK1 A;  5HFM A;  1I08 A;  3F5T A;  1XMO B;  4JI7 O;  1JA8 A;  2P90 A;  2Q6A A;  4FLX A;  1I94 O;  3K57 A;  4FFB B;  1LR1 A;  1MZE A;  4CS2 A;  1NI8 A;  1GO3 F;  2EUL A;  3K5O A;  1QR8 A;  4I55 A;  4MVU A;  4XBF A;  2OTL V;  1RFY A;  2Y4U A;  3ASO C;  2EIN B;  3ZHU A;  5IJ0 B;  5IYZ A;  1N4C A;  4IGG A;  2ITC C;  5C93 A;  4FM0 A;  1MNG A;  4H0L B;  5EZY B;  3AG3 C;  4H13 B;  4LF6 O;  3J81 N;  3FB8 C;  1EN5 A;  3CCE V;  4HNA A;  3ZMS A;  3B8M A;  4PHZ A;  3JSN A;  1KKC A;  1NT2 B;  4YIP A;  4J42 A;  5EBM C;  4G27 B;  4PDM A;  4WBN A;  5BR8 O;  5LA6 A;  4NTY A;  5EC1 C;  3ASO B;  2ZR3 A;  1YJ9 V;  1SES A;  4DR7 O;  2P22 C;  3O9O A;  2RJZ A;  2YEV B;  1RSO A;  1MOF A;  2Q0O C;  4R7C A;  1X59 A;  3CYO A;  3LUT B;  4IYH A;  4KL1 A;  1P7G A;  2QWR B;  3AG3 B;  2UUC B;  3OMA B;  1YXB A;  1L8D A;  5J9P C;  3HB3 B;  3FYI B;  4MVS A;  3K0D A;  4PA4 A;  3B8N A;  2WSS G;  1N33 O;  3SJC C;  3MHS C;  3SGI A;  1N0N A;  1Q43 A;  2QWN B;  1MSW D;  1FPO A;  2HJD A;  4OPA A;  4KHP O;  4PDV A;  3HR0 A;  4JTA B;  5J2T B;  2DN9 A;  4MVM A;  3ABK C;  4Z2W A;  1SA0 A;  3JAL A;  4JI6 B;  4DV4 B;  2PY5 A;  3JAS A;  1IJG A;  3ZRS A;  4DV5 O;  2WLL B;  2X6C A;  1AJN A;  2QKS A;  1M56 C;  1SRY A;  4WFE A;  4JAV A;  2JGD A;  1B3Q A;  2RDC A;  1G8M A;  4X1Y B;  3SPJ A;  4QPJ A;  2PGG A;  3CX5 F;  3BRC A;  3ABK B;  3ZS8 C;  1K4D C;  1FXV A;  4L87 A;  1HNZ B;  1TA8 A;  1N32 O;  4CS3 A;  1KUQ A;  2ZXW C;  4OGQ B;  5LOV A;  4B3R B;  5CBG A;  3UT5 A;  3E8F A;  1M56 B;  5H2F Z;  5KHI A;  4GX2 A;  1IBM O;  4UCS A;  2ZNI A;  3L70 H;  3CCR V;  1JX9 A;  1VF7 A;  4NXN O;  1IVS A;  2GDS A;  3DXR A;  4CS4 A;  1K34 A;  5AG2 A;  1AJP A;  4MVQ A;  3SYQ A;  3K3W A;  3CCQ V;  1OZ0 A;  4J11 A;  4AIL C;  2RCV A;  4NXM O;  3E22 A;  1JCH A;  4X1K B;  2ZXW B;  5DED A;  1H8H G;  4GZR B;  4LC1 A;  3Q4H A;  2RN9 A;  3CXC U;  1DF5 A;  4UB8 Z;  5F2V O;  4ZKI A;  1ZLZ A;  2H94 A;  3EFF K;  5LHH A;  4JI3 O;  4TT3 G;  1ORQ C;  3OTF A;  3CMA V;  1JNB A;  4YHH O;  1WA8 A;  2F23 A;  2KG7 A;  2RNB A;  4FJC C;  3WU2 Z;  3PJS K;  4FLZ A;  1SQP H;  1AJQ A;  2ZIO A;  3TET A;  1N34 B;  4JTC B;  2DQ3 A;  3IGA C;  4DR2 O;  5D5Q A;  3U11 A;  4RWU A;  1NVP B;  1J95 A;  3LDD A;  3A0H Z;  1FS0 G;  3ABL C;  2CTR A;  2XAS A;  4JI4 B;  3X2Q C;  5K1X A;  4TV8 B;  4ZHQ B;  2V7Q G;  3LDC A;  3RYF A;  5FNV B;  2ODM A;  3DTU B;  3OD4 A;  2W6I G;  1IXM A;  4H37 A;  1EBO A;  1RPO A;  4IT5 A;  5GTI Z;  3H9V A;  5IY5 C;  5KX5 B;  3RYI B;  3SPC A;  4PD4 F;  2ARH A;  3OTO B;  4PV1 B;  2DE0 X;  4UVB A;  2IM9 A;  4O4J A;  3D36 C;  1DF4 A;  1R6T A;  4JI3 B;  2L35 A;  2GUZ A;  2ADQ B;  3ABL B;  3AEI A;  1SQV H;  4DV1 O;  3X2Q B;  1VF6 A;  4O4H A;  3SPG A;  3JAK A;  2BE3 A;  5JH7 B;  2BSK A;  3SJQ C;  1XRE A;  2GHY A;  5D5P A;  4IYI A;  4QPK A;  3JAR A;  3CCV V;  3KG2 A;  2ITD C;  4TV9 A;  5IY5 B;  1F23 A;  4X1I B;  3OUS A;  5IWA O;  5LXT A;  3FYE B;  1H8E G;  4GKJ O;  5LMN B;  4AQY B;  1NJI W;  2V4D A;  1Y66 A;  4GKK O;  1MAB G;  1FFX B;  2UUA O;  2A06 H;  3FX7 A;  4U7N A;  1J5E O;  1VQ6 V;  5B1B C;  1YIT V;  3QTC A;  4DV2 O;  3E8B A;  1YF2 A;  2Q7H A;  3T4Z A;  3UCS C;  5B66 Z;  3HKB B;  4JI5 B;  3ZHR A;  5JQG A;  5L3C A;  2UU9 B;  2BTQ A;  4DR3 O;  4JI0 B;  3CE2 A;  2NNU A;  3BPZ A;  1NU1 H;  3FB7 C;  2QWP B;  5LMU B;  1OCO C;  1NH2 D;  1QNM A;  4DO2 A;  5CA0 A;  1GTO A;  4DR6 O;  3ETD A;  2WLK A;  3ZED A;  1PV0 A;  4JI2 O;  1Q8I A;  1P84 F;  3CSX A;  4IIJ A;  3WFV A;  5CA1 A;  5B1B B;  2QJ1 A;  1BQ0 A;  2N05 A;  2QGN A;  1TUE B;  4B7E A;  3VQY A;  2EZP A;  1UJW B;  2B5U A;  5K1P A;  1HWY A;  1VIB A;  5CBH A;  5LHI A;  4YJ3 B;  3LSU A;  1OCO B;  4FMT A;  1PKX A;  3ZMZ A;  5JCO C;  4QE9 A;  1KU9 A;  4O2A A;  3OR7 C;  3KKY A;  3BAB A;  2IJK A;  4O4I A;  4JYB A;  4O4L A;  2Q9L A;  4JI8 B;  3T1H O;  2X6A A;  3E35 A;  3W7S A;  5ITZ A;  2VWJ A;  5JVD B;  1HNW O;  3IC9 A;  4I9W A;  1R3K C;  5BMV A;  5KA5 A;  3ZMU A;  1VP7 A;  1YVW A;  1XUQ A;  4D6T H;  1W59 A;  3DC5 A;  2LFR A;  1VQ9 V;  1G6U A;  2RQ6 A;  3SJA C;  5KHK A;  4DXW A;  5EBW C;  2PYL A;  2ATK C;  3CRA A;  2ZM6 B;  1Q86 W;  3QVN A;  1WN7 A;  3RBZ A;  3AG2 C;  4MTF A;  4H33 A;  4K8Z A;  2HHH O;  3K58 A;  4IL6 Z;  4LF5 B;  2QWO B;  3CWB H;  2EX3 A;  1AIL A;  5C8Y B;  1VMG A;  4EFE A;  4TWK A;  3RT3 C;  1FXH A;  2E3C A;  2JEU A;  3FKS G;  1W2B U;  4MTX A;  4UCV A;  3WG7 C;  1ZX3 A;  4J9Z B;  4UCR A;  1PD3 A;  3LNN A;  2UXX A;  1XMQ O;  3AG2 B;  3AK2 A;  1AB3 A;  2EIM C;  4PEL A;  1YIJ V;  2DWE C;  2OCC C;  1GN3 A;  3BVO A;  2R70 A;  2ZDI A;  3B77 A;  2ZE5 A;  3GB7 C;  2JS5 A;  5EIB D;  4X8A A;  5LL6 Y;  3BEH A;  2UXC O;  3B2E E;  1YTF B;  4RAI A;  4YIO A;  4ZOL B;  1ZSP A;  3WG7 B;  1TVK B;  4JAA A;  1QR9 A;  4JAU A;  1HP8 A;  4WFA V;  5LYJ B;  2EIM B;  1OCZ C;  1BMF G;  2X0L A;  4LFA B;  1IBL O;  4LNU A;  4J10 A;  5EYP B;  1SF9 A;  1NTK H;  1SZX A;  3ZHQ A;  1EN4 A;  3R66 A;  1IBK O;  2YI8 A;  1WNS A;  2LO1 A;  3CP1 A;  1XMO O;  3ABM C;  3N27 A;  1VQP V;  1MZF A;  3BAA A;  1IXB A;  2KQX A;  2YUA A;  5DM6 V;  1GM9 A;  3QO7 A;  4O2B B;  1AR4 A;  4LF9 O;  2ZT9 B;  3CRC A;  4EFB A;  2UXD B;  1OCZ B;  4DR4 B;  4HYO A;  1JMK C;  4LF8 B;  3KDR A;  2WLI B;  2YC0 A;  3RW0 A;  1H2L A;  4JI1 B;  5J2U A;  4NTX A;  5KHH A;  2HFE C;  3JAT A;  1N36 B;  4P9O A;  1AP5 A;  3FB5 C;  1V55 C;  1D2D A;  1FYJ A;  1TGO A;  3KZI Z;  3ABM B;  1R3J C;  4TQD A;  1Q5O A;  4GUN A;  1NVP D;  1KBH A;  5KAI Z;  4DR1 B;  3M8A A;  4GLX A;  1ENV A;  3OT7 A;  4JYA B;  5CA3 A;  1NTM H;  2PTM A;  2Q8V A;  1D5N A;  3JAW B;  2EIK C;  5FLX N;  1SQQ H;  2JK5 C;  3L73 H;  2LW7 A;  1S3J A;  1DGS A;  4B3M B;  5GW7 A;  4EB6 B;  3FD9 A;  5JWP A;  5CB4 A;  4WFF A;  1V55 B;  5B1O A;  5KA6 A;  4TUY B;  3W7W A;  4LF9 B;  2UUC O;  1WPX A;  3BA8 A;  3N2K B;  3WB0 A;  1ZL8 B;  1E79 G;  1Q90 D;  1YEW A;  5FPR A;  1H38 A;  3K79 A;  3I55 V;  4JAS A;  5KAF Z;  3VQV A;  2E74 B;  3E8H A;  4GX0 A;  3A2F A;  3ETE A;  3JD4 A;  5LP6 C;  3JSL A;  2EIK B;  1QBZ A;  1OHH G;  3OMN B;  4EKW A;  4X66 B;  4PA7 A;  2QSA A;  2YIB D;  4K35 A;  4OXS A;  4KUM A;  1BQZ A;  2OWO A;  3GWO A;  3QNE A;  3K5M A;  3ETG A;  4R8C A;  4JI6 O;  4JTD B;  2FTK A;  1KC8 W;  4DV4 O;  4H44 B;  1A32 A;  2DMX A;  2N04 A;  1SS3 A;  2C2A A;  1YJW V;  1EZV H;  2Q67 A;  4YJ2 B;  3ZN0 A;  5LP6 B;  2F1M A;  4B08 A;  4W4K A;  2Y69 C;  1B06 A;  3GWK C;  1IDS A;  1SQB H;  3EVK A;  2O57 A;  1HNZ O;  1Y76 A;  3ZBH A;  4ZI7 B;  1G1X B;  1VAR A;  4ASU G;  3APO A;  3K04 A;  5EC2 C;  4B3R O;  2B9Z A;  1R3I C;  5LBQ A;  1L1F A;  2Z5U A;  3K0G A;  2A7W A;  3BY6 A;  1MMM A;  2ILM A;  4MT8 A;  2QM7 A;  1SET A;  2Y69 B;  5E1A C;  2VQF B;  3EXA A;  2HLD G;  4QE7 A;  5IJ9 A;  4HAM A;  2R72 A;  1V54 C;  3K03 A;  5KMG B;  3CJH B;  2VQE B;  4JV5 B;  3WB1 A;  4DRX B;  2H3O A;  5H6Q A;  3HKE A;  3N2G A;  1SQF A;  3SJB C;  4F6R B;  4X20 A;  1BHA A;  1MG1 A;  3PN1 A;  1P4R A;  1SKV A;  4DW1 A;  1M9N A;  3FAV B;  2FML A;  3RYC A;  3L74 H;  4DUY B;  3JYC A;  1HNX B;  5LHG A;  1PM9 A;  4B7K A;  1QLN A;  3W7U A;  1FXK C;  1V54 B;  5GON B;  4BW5 A;  1N34 O;  3QO8 A;  1XEQ A;  3OW2 U;  3IC7 A;  4XDK A;  2P6J A;  2P7T C;  1CP9 A;  5CBF A;  3ETQ A;  4LWS A;  4JI4 O;  1DTO A;  3MDS A;  4LH6 A;  3SPH A;  1XOU A;  3AG4 C;  3RYH A;  3H1H H;  5HFL A;  1N8R W;  5IYB O;  5IE9 A;  5EK0 A;  1Q6I A;  2K9P A;  1FXK B;  1VQO V;  4UCT A;  3F5W C;  3OTO O;  1AP6 A;  1IX9 A;  4Q20 A;  3AG1 C;  3E89 A;  1EN6 A;  2CK3 G;  1S0V A;  3HKD B;  4FIP C;  3OAA G;  1RP3 B;  2VS0 A;  3C3T A;  2DJV A;  3SPI A;  4OX9 O;  4JGS A;  3E8G A;  1WPB A;  4P2Z A;  3OGC C;  3HKC B;  3AG4 B;  4GCZ A;  1Y74 B;  1TUB B;  3K59 A;  3B09 A;  2FYU H;  2WA4 A;  1VQL V;  4GX5 A;  2JJ1 G;  2Y48 A;  1K73 W;  4I9Q A;  1MSD A;  1ZUQ A;  4I4T A;  2F4V B;  2ZIN A;  1AI5 A;  1IZ3 A;  3J7A U;  2M6Y A;  1ZTE A;  4X9Q A;  4BIO A;  3IFX A;  2OIE A;  3AG1 B;  3L72 H;  5LMN O;  4AQY O;  4L8J A;  1JOY A;  2ZNJ A;  1ARO P;  4FFB A;  1V9P A;  2IH3 C;  3L9D A;  2M7W A;  3W7X A;  1XDC A;  4I50 B;  1PL0 A;  3G4S V;  2G38 A;  4J7J A;  5IJ0 A;  4X62 O;  4U7O A;  4RUF A;  1YCI A;  3SYP A;  4JI5 O;  1IUR A;  2UU9 O;  4TSF G;  5CN0 A;  4JI0 O;  4K0K B;  1NR7 A;  3LDE A;  5LMU O;  1M5I A;  3CS5 A;  5EZY A;  2XHB A;  5LGU A;  3ZRW B;  2PI4 A;  4OX9 B;  2FB5 A;  1FD9 A;  2CTW A;  2ZE7 A;  2VWK A;  2P06 A;  4QGP A;  2Z3Y A;  3G67 A;  3RWR D;  4I0X B;  1TAE A;  3STZ C;  4CZZ A;  4MS2 A;  4ABM A;  4JPR A;  5DEC A;  3JD3 A;  1EZJ A;  4MVR A;  1JFF B;  2GTS A;  4YJ2 A;  3AG7 A;  5JJE B;  2YEV A;  1KQS U;  4NKG B;  1VQM V;  1W0K G;  2QKC A;  2CH7 B;  2OT5 A;  4Z1M G;  4U3J B;  2YDE A;  4JI8 O;  4FFK A;  4WF9 V;  5E79 Z;  5KUM A;  2XND G;  4CH3 A;  1BT8 A;  5FL7 G;  2E76 B;  4X62 B;  3OFN G;  1Q82 W;  1CEZ A;  2XAQ A;  2A0L A;  1GKF A;  1Z5W A;  1R3L C;  3SYC A;  4P30 A;  3CRR A;  1UPG A;  4LCU C;  2BTO A;  3ZRV A;  3JCZ A;  3CC7 V;  5J2T A;  2ZD9 A;  3K9S A;  2XAJ A;  3UO2 A;  1WP7 A;  2ZM6 O;  4IHJ B;  2K1E A;  5H6R A;  5IDJ A;  3CRQ A;  1VQN V;  4RQF A;  1M93 A;  3CEI A;  1F4M A;  4DV0 B;  2CTQ A;  4LF5 O;  2WLL A;  5H9C A;  4AHC A;  2D3O W;  3THO A;  4J7Z A;  2Y4T A;  4BAY A;  4DK0 A;  1BHB A;  2LQT A;  2IJI A;  4RQE A;  4UFZ A;  3H1K H;  3WB2 A;  2JJ2 G;  4W4L A;  5JJJ B;  2JVD A;  4X1Y A;  1M4U A;  1NTZ H;  3A0R A;  1CXZ B;  1H2S B;  3ZMV A;  1K4C C;  3ZHS A;  2L6L A;  5KHG A;  3U0Z A;  3JCU Z;  1BE3 H;  1WB7 A;  4LF4 B;  2ETN A;  4X64 B;  1XL6 A;  1GMG A;  3L75 H;  3A0B Z;  2KSD A;  4CC5 A;  4I55 B;  5L3G A;  5IYZ B;  1URF A;  3TXS A;  1XNQ B;  3ZX6 A;  5JJN B;  2DW4 A;  2IJJ A;  1F4N A;  4PJ0 Z;  1QCE A;  1SZT A;  1S76 D;  1GN6 A;  3OEE G;  2UUB B;  3AK1 A;  1NR1 A;  1OCC C;  1QVF U;  3NR7 A;  4HNA B;  4FM2 A;  2AZ0 A;  3SR2 C;  4X1K A;  1KP2 A;  3S3X A;  2YIC A;  3CCM V;  3IJ4 A;  3A8T A;  4WBN B;  4LFA O;  5LA6 B;  2HVJ C;  2CE4 A;  1G4Y B;  1PNL A;  1Q3E A;  3VQW A;  1KD1 W;  2XAF A;  3H01 A;  3BA9 A;  4E4E A;  1RSO B;  2X7R B;  4LFB B;  4PA3 A;  4FLT A;  3ABT A;  1KEC A;  2QA4 V;  1KB9 F;  3UKM A;  4WFB V;  1NBM G;  1LUW A;  1OCC B;  3T1Y B;  1H5W A;  2CGN A;  1S5H C;  2LW1 A;  3E86 A;  2EJ7 A;  2QEX V;  5L3D A;  1WJZ A;  4FVM A;  2UXD O;  1GN4 A;  4E2L A;  4DR4 O;  4DR5 B;  4TV8 A;  4MTO A;  4ZHQ A;  4JYY A;  4LF8 O;  1XHZ A;  2Q73 A;  4FK5 C;  5FNV A;  4CC6 A;  4PI2 A;  4JI1 O;  1Q81 W;  4DV6 B;  1COW G;  5FPO A;  2GTA A;  1N36 O;  2OIG A;  1SA0 B;  3JAL B;  2JS3 A;  5KX5 A;  3RYI A;  3JAS B;  2F95 B;  3W7T A;  1AI6 A;  1ZAU A;  3D8C A;  2Q7G A;  4UCU A;  2OCC B;  1E1R G;  4YY3 B;  1K5Q A;  5A2Q N;  4DR1 O;  3JD0 A;  2HJF C;  2XAH A;  4DUZ B;  1D5A A;  1I5X A;  2ZR2 A;  2JGD B;  4JYA O;  5JH7 A;  4BW9 A;  3ZIA G;  1XHX A;  2Y0P A;  3CCL V;  2YIB A;  4GYC B;  1QLE C;  1GAX A;  1WB8 A;  4J7K A;  4B3M O;  2P4K A;  2E5L B;  1HDJ A;  4X1I A;  2YI9 A;  3UQ8 A;  3K5L A;  4PDL A;  1BS3 A;  2YSU B;  1VEW A;  4X65 B;  3BHP A;  5LOV B;  4MW3 A;  1AI7 A;  4TOI A;  5L3F A;  2D2C B;  2EIL C;  3D36 A;  2IJH A;  3UT5 B;  2ZIM A;  1FKA O;  3BFR A;  4R50 A;  4JF3 A;  1FJG B;  2ZKO A;  4R6Z A;  4DV7 B;  1FFX A;  3K9A A;  1CPY A;  2UXB B;  4J9Y B;  3UO3 A;  4LH7 A;  3B40 A;  1EM1 A;  1GRJ A;  3K5N A;  4DV3 B;  4K8X A;  2WLJ A;  3DXR B;  2DQ0 A;  4X66 O;  1QLE B;  5BZB A;  3HKB A;  3E22 B;  1XNR B;  4FLW A;  3LSS A;  3BCC H;  1SQX H;  3HPL C;  3Q4H B;  2EIL B;  4WCE V;  4B3T B;  2Q68 A;  5LGN A;  4KP4 A;  4CH6 A;  4GT1 A;  2W0X A;  4BWA A;  5B1N A;  2CTP A;  1WA8 B;  2KG7 B;  2B1G A;  2W0F C;  1PP9 H;  4NVP A;  5LGT A;  3M99 B;  2JIZ G;  4LFC O;  1U97 A;  3ZRX A;  1XIL A;  4Z1V A;  2ZE8 A;  1Y67 A;  4DK1 A;  1AVM A;  1VF5 B;  1THZ A;  4YJ3 A;  1GM8 A;  4CBC A;  1QQC A;  4FLU A;  2WLM A;  3J80 N;  1VF6 C;  4HZ3 A;  2A9H A;  4G28 B;  3RYF B;  3M7M X;  2GSM B;  5JVD A;  2ADP A;  1BGY H;  3MD0 A;  3CC2 V;  2IU0 A;  3AK3 A;  1YDX A;  1KKD A;  4WFG A;  2P4V A;  5GTH Z;  2VQF O;  4UVA A;  2F93 B;  3H1L H;  3G80 A;  1YI2 V;  2H8P C;  4O4J B;  1WLE A;  2VQE O;  4JV5 O;  2QE7 G;  4ZBM A;  4QNH B;  4MSW C;  5JCO A;  2GUZ B;  2Y0I A;  2JEX A;  4O4H B;  3JAK B;  4Q6G A;  3CME V;  3FB6 C;  2AW9 A;  1QHT A;  2BSK B;  1K3E A;  4DUY O;  4LFC B;  1JR9 A;  1RPR A;  5C8Y A;  1HNX O;  2AZ2 A;  3JAR B;  2LP7 A;  1F51 A;  2VRZ A;  4TV9 B;  4UCO A;  2QM4 A;  1GK9 A;  4LF7 B;  1ROP A;  1N0J A;  1XQ8 A;  5LXT B;  2BCC H;  4UV8 A;  4RUE A;  1PNK A;  1H2M A;  4HBN A;  1EFR G;  5TIS Z;  1F7Y A;  1US6 A;  2DYS C;  3CHX A;  4JI7 B;  1RM1 C;  1I94 B;  1AR1 B;  4FLV A;  4BIU A;  4MVZ A;  4DYL A;  2YID A;  5KHJ A;  4JZ2 A;  5JQG B;  2BTQ B;  2LGW A;  2YS8 A;  4LBE C;  5EIB C;  1M1K W;  2AHZ A;  2PF4 E;  3VOU A;  1XL4 A;  4F6E A;  5A9G A;  4UXN A;  2N74 A;  3KCX A;  2WPD G;  2Q69 A;  4ZOL A;  4DW0 A;  4LF6 B;  1R6N A;  2DYS B;  5CA0 B;  3ZN1 A;  3I56 V;  3P3P A;  1TVK A;  2YXL A;  1RM1 B;  1JQ0 A;  3ABU A;  2E75 B;  2JRI A;  2HP8 A;  5LYJ A;  3TJT A;  1PPJ H;  3DC6 A;  2R9I A;  4IIJ B;  5CA1 B;  5BR8 B;  1GM7 A;  3JD1 A;  4CH4 A;  4DR7 B;  5L3B A;  5EYP A;  4YXW G;  4AI8 A;  1U96 A;  2F4V O;  1XBL A;  1K97 A; 
#chains in the Genus database with same CATH homology
 3EVK A;  1BS3 A;  1I08 A;  2QKC A;  1AP6 A;  1IX9 A;  1VEW A;  1QNM A;  1JA8 A;  1VAR A;  1EN6 A;  1I0H A;  4GUN A;  3AK2 A;  3BFR A;  1AR5 A;  4FFK A;  3C3T A;  2AW9 A;  3OT7 A;  1GN3 A;  1BT8 A;  4BR6 A;  2CE4 A;  1JR9 A;  1D5N A;  1PL4 A;  1EM1 A;  1MMM A;  4E4E A;  1B06 A;  1MSD A;  1ZUQ A;  1N0J A;  4YIO A;  1MNG A;  2CDY A;  3K9S A;  1ZSP A;  1LUW A;  1ZTE A;  3LSU A;  4X9Q A;  1EN5 A;  3KKY A;  1LUV A;  1KKC A;  2ADQ B;  1BSM A;  3CEI A;  4YIP A;  3RN4 A;  1GN4 A;  3IC9 A;  2QKA A;  4JYY A;  1XRE A;  1XDC A;  1XUQ A;  1PM9 A;  4JZ2 A;  3DC5 A;  1SZX A;  1MA1 A;  2GDS A;  1EN4 A;  1XIL A;  5AG2 A;  1GN2 A;  4F6E A;  5A9G A;  1Y67 A;  2RCV A;  1AVM A;  1P7G A;  3QVN A;  1WB7 A;  1IXB A;  4JZG A;  4C7U A;  1AR4 A;  3TJT A;  3DC6 A;  1ZLZ A;  2ADP A;  3MDS A;  3KDR A;  1N0N A;  3AK3 A;  3C3S A;  1WB8 A;  2P4K A;  1GN6 A;  3AK1 A;  1AP5 A;  1IDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...