1JR9A

Crystal structure of manganese superoxide dismutases from bacillus halodenitrificans
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
201
Chain Sequence
KFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNGALEGHEDLKNKSLNDLISNLDAVPENIRTAVRNNGGGHANHSLFWKLMSPNGGGKPTGEVADKINDKYGSFEKFQEEFAAAAAGRFGSGWAWLVVNNGEIEIMSTPIQDNPLMEGKKPILGLDVWEHAYYLKYQNKRPDYISAFWNVVNWDEVAAQYSQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of manganese superoxide dismutase from Bacillus halodenitrificans, a component of the so-called "green protein".
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords manganese superoxide dismutase
total genus 56
structure length 201
sequence length 201
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1jr9A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1jr9A02
1EN6A 4YIPA 1AR4A 1EN5A 1MA1A 1MMMA 1JA8A 1XUQA 1BSMA 4GUNA 3KKYA 1PM9A 1GN4A 3C3SA 1GN3A 2QKAA 1EN4A 1MSDA 1XILA 3OT7A 1ZSPA 3BFRA 4YIOA 1SZXA 1N0NA 2CDYA 1IDSA 4FFKA 1VEWA 2GDSA 4C7UA 1ZLZA 1AP6A 1JR9A 3C3TA 1GN6A 2AW9A 3DC5A 3IC9A 3LSUA 2ADQB 1I08A 2ADPA 3EVKA 3QVNA 1XREA 1N0JA 4JYYA 2QKCA 1I0HA 1BS3A 4F6EA 5A9GA 1AP5A 3TJTA 3AK2A 1Y67A 1KKCA 1MNGA 1P7GA 5AG2A 1GN2A 1ZUQA 2P4KA 1BT8A 3RN4A 1QNMA 1XDCA 4BR6A 3AK3A 4X9QA 1LUWA 1IX9A 4JZGA 1D5NA 1PL4A 1IXBA 1VARA 3K9SA 4E4EA 1EM1A 3DC6A 2CE4A 1B06A 1WB8A 3MDSA 1ZTEA 1AVMA 1WB7A 3CEIA 1AR5A 3AK1A 2RCVA 4JZ2A 1LUVA
chains in the Genus database with same CATH superfamily
3L74H 3JALB 3K03A 4B3RB 2XOKG 1GAXA 3U10A 3ZRSA 1N8RW 1OZ0A 2ZDIC 4XDLA 3GB7C 1AROP 1D2DA 1K33A 3GWKC 4MTOA 1E1RG 2WA3A 1R6TA 1GN4A 4X1KA 3SYOA 2IJJA 1EN4A 2BOBC 2Z5UA 2CK3G 4X64O 1DGSA 2JGDA 2FL4A 1V54B 2LQTA 4CZZA 3VOUA 1I94B 3ZBHA 3K5OA 5C8YA 5HFLA 4LFAB 3DC5A 1SQQH 1TAEA 2FB5A 1I08A 4OPAA 1VQMV 1VF5B 4MW3A 4BIZA 3QVNA 1XREA 2LW7A 1YCIA 5L3CA 4LCUC 1YITV 4CC5A 5CA1A 3AK2A 5B3SB 3G4SV 4X8AA 1NR1A 4R7CA 3WG7C 4DXWA 1MSWD 1QNMA 1N4CA 1FFXB 3IGAC 4X65B 3B4SA 3RYIA 4PI2A 5KA6A 3N2GB 2Y0IA 1US6A 4FZ1A 2YDEA 1K8AW 1QLEB 1Q8IA 5LXTB 4TV9A 4X88A 3H9VA 5D5QA 1PL4A 4GYCB 2CTPA 4DV3O 4X1IA 5EC2C 3K79A 3M99B 5K1PA 3JSLA 1NU1H 2DYSC 3DC6A 3BEHA 1WB8A 5E1AC 5GONA 1RPRA 4FZ0A 4QJFB 1S3JA 3BA9A 3JARA 1JQ0A 2BCCH 3F5TA 4KFMA 4G27B 2UUAB 3HKBB 5JJEB 4LF5O 5KHKA 5DECA 1LR1A 2UXCB 1P49A 3TCUA 5GTIZ 5JWPA 4HYOA 3ZMVA 5KHHA 4DR7B 2LO1A 5IT9N 5E79Z 5KAIZ 5CB4B 1F51A 3H1IH 5JQGA 1YSCA 2PF4E 4WBNB 3QF7A 3ZMSA 2HG5C 2YXLA 1SETA 3SJCC 2LFSA 3CS5A 3AG1B 3PN1A 4DR4O 1N33O 1R3LC 3ZS8C 4TUYB 5CA0A 4GKKO 5KHJA 1SQVH 2DN9A 1PD3A 1OJHA 5JJJB 3I56V 3JAMN 1L1FA 1KKCA 4JTAB 3WB2A 2OIGA 2VQEB 2RN9A 1GTOA 4DR1O 3ZN1A 5LA6A 4O4LA 1K5SA 3LDEA 3H01A 2RDCA 5CBFA 4JI6O 2X6AA 4NXNO 4JI2B 4ZOLA 3ETEA 4BR6A 4PDMA 1QCEA 1X59A 4LFAO 4B3MO 2PYLA 3ASOB 5TISZ 1ZL8B 4CH5A 1SF9A 1S5JA 2JS3A 3K3WA 3JAKB 1R6NA 1XL4A 2JJ2G 2QDOA 3KCXA 3ZN0A 4X1YB 4TV8A 2YEVB 5LGNA 2JDIG 3W7XA 1I94O 3K0DA 4J80A 5HFMA 4DR6O 4LF7O 1HWYA 5EYPA 1MA1A 4XDJA 1URFA 2M7WA 1A32A 1U96A 4JGSA 1JNBA 4I5SA 2YXYA 1PM9A 3VQWA 4DK1A 4RAIA 4ICGA 2W0FC 3L72H 1Y76A 2NNUA 2V7QG 2UUBB 1XNQB 4U3JA 2GTSA 3O65A 2ZINA 1S5LZ 1I5XA 3T1HO 1B6QA 4UCTA 4K8XA 4PV1B 4OX9B 1ZLZA 2QTSA 1ZWIC 1J5EO 3J7AU 3CYOA 4J7ZA 1UJWB 4PA9A 3B09A 3CRMA 4HAMA 2Y4UA 3ABMC 4EB6B 1AP5A 4PA7A 1WJZA 4JI0O 1QVGU 5IYZA 1P7GA 2YS8A 3CRRA 4MVOA 4DV2B 1YI2V 2WLLB 1ZUQA 3ZHUA 1J95A 2PY5A 3CCUV 3HR0A 4DYLA 2ZNIA 3B40A 4DV7B 2UXBB 2DWEC 4FK5C 4OGQB 1SA0A 4DR2B 1NVPB 1IURA 2AHZA 2QM4A 3T1YO 4MW8A 2QM8A 1LNQA 3K0GA 2ZDIA 3K57A 5IJ9B 5EIBC 4UV8A 2QA4V 2QWPB 3OGIB 3AG4B 4FFBA 1QU7A 3SYCA 1ZTEA 1WB7A 3IC7A 1SA0B 3CP1A 3AK1A 1K34A 3JD3A 2Y4TA 4OPHA 4WF9V 1AI5A 1HR0B 4X62B 4BW9A 1TUEB 5KHGA 2UXBO 1H8EG 3KG2A 1JA8A 1E1QG 1YEWA 3K04A 4ZI7A 2OIEA 4UCOA 4LF8O 2N05A 3OE7G 4I0XA 2P67A 1QR9A 2Q0AA 1VQ8V 3Q4HB 2UXCO 2L6LA 1GRJA 2Q8VA 1OHHG 4LF6O 4I7ZB 3ZRWA 2PGGA 4DV5O 1BCCH 1CEZA 3UT5A 1IDSA 3PJSK 4X66O 2F43G 1ZAUA 3RW0A 1JR9A 2K1EA 4ZHQA 2Q68A 2ADPA 4TV9B 2JEUA 5KMGB 1NR7A 1FPOA 3T1HB 1YXBA 3SPJA 3JATA 2DYRB 1KD1W 5FLXN 3WB0A 1P7BA 2C2AA 3RGBA 4DV0B 2KB1A 4RUEA 3FKSG 4QE7A 3I55V 4KHPB 4J7JA 2XTAA 3OMNB 4LF7B 3BCCH 2D2CB 2X6CA 1LUWA 4H44B 4JZGA 4TSFG 1D5NA 1TVKB 3LSQA 2F4VB 3OUSA 4FLWA 4ZHQB 1PNLA 5IYBO 5FPRA 2OCCB 2F95B 2UU9B 4RQEA 3A8TA 2XAGA 3APOA 1AB3A 3N2KB 3ABUA 2E5LB 3HKEB 2X7RB 4P30A 1M93A 1L0NH 3N27A 2IJKA 1Q3EA 2EIMC 2CH7B 4IHJA 2HP8A 2QTOA 1QHTA 3STZC 1QR8A 3RYFA 2B1IA 3OD4A 5B1BC 2UUCB 2MW2B 1N32O 3RYCA 3N2KA 1H2MA 2CAZC 3K59A 2Y0PA 4I9WA 2EZOA 1Y74B 1FOUA 4QPKA 1CXZB 1XOUA 4UB6Z 1SC5B 1N0NA 3DSQA 5FNVA 2ZE8A 4NTWA 1KMIZ 1IZ3A 3F5WC 2AW9A 1VF6A 2R70A 3RVZA 5JQGB 1AI6A 3LNNA 5BXZA 1N0JA 2VWKA 4GX0A 3T1YB 2HLDG 1NTKH 1XBLA 1PNKA 3TJTA 5IJ0B 4N21A 3RT3C 3ETGA 2FKXA 1OCCB 1GN2A 4O4IB 5CA1B 1VQLV 1VQ6V 4JYCA 3ML0A 2DW4A 3BA8A 1YDXA 1VQNV 1YF2A 2QM7A 1SQBH 3UO3A 1JPXA 4X62O 4DO2A 1R6KA 1HR0O 3QNEA 1VQ9V 4DR7O 1WAZA 3AEIA 2Q0OC 3SPHA 3SR2C 5JVDA 5DEDA 3K58A 1XMOO 1IBMO 4JPRA 4ZBMA 5JH7A 4LF8B 1VARA 3SDLA 3B8NA 4FM0A 1AJPA 3TGUH 4R6ZA 1HW7A 1QBZA 2A0LA 2UXDB 4O4HB 5B5EZ 2ZT9B 3CCJV 2EINC 1AR5A 3E8FA 1GO3F 4LWSA 2EILB 4U3JB 2IJHA 4KHPO 3DXRB 4U7NA 1TUBB 4YJ2B 5L3FA 4YIPA 5H2FZ 2AZ0A 1EN5A 3EXAA 2WLIA 3DTUB 1M57C 4NR1A 3UQ8A 2HEPA 3K5NA 2DOSA 3MD0A 3ZX6A 1KP2A 3E8HA 2A06H 2F23A 1SKVA 1VQOV 1BQ0A 3ZJZA 1HNXO 1VF6C 2PUSA 2LW1A 5LHGA 5H6QA 1V55C 1AI7A 2BTOA 3G67A 2P5OA 3B8MA 2EIKC 4O4HA 1XILA 4LFCO 2UU9O 4X20B 4HNAB 1TUBA 2UXXA 4X1KB 5L3EA 1WN7A 3C3TA 3KZIZ 1V54C 3SGIA 2QR4A 4YY3B 2JEXA 4D6TH 4LP8A 2VQFB 1I0HA 1H38A 5EBLC 2PI5A 2ITCC 3MAQA 2ZQMA 1DF4A 4U3FH 4JI5B 5LOVA 5AG2A 3ABLC 3T4ZA 4K0KO 3RFRA 3BHPA 4K8ZA 4L8JA 1JJ2U 1O9GA 2RNBA 2A3QA 1N32B 2IU0A 3OTOB 3E2EA 4MVMA 3C90A 4JAAA 4FIPC 3CCRV 4RWUA 5LA6B 1XQ8A 1JFFA 5L3BA 1S72V 4LFBO 1M9NA 4WFAV 1JJOA 4JF3A 3RYHA 3JAWB 1EZJA 3H1HH 4PDVA 4JV5B 1QLNA 2Q5ZA 1OCZB 1VQPV 1R73A 1HP8A 3L75H 2B1GA 2VQFO 3MHSC 4PDRA 4I55B 3U11A 1WA8A 4G28B 2YIDA 4B3MB 1OV9A 4DV3B 4UV9A 4J42A 2OTLV 2V1DA 3AG2C 1XI1A 3CRAA 3JAWA 2QJ1A 1MZFA 4YJ2A 4JI8O 2ZNJA 1M4UA 4MVQA 3FX7A 2QE7G 3D8CA 1KBHA 3HB3B 3SPIA 3CCSV 3EFFK 1BMFG 4DV0O 4CS2A 4JYBA 4PA6A 1QVFU 3FYEB 1T5EA 4LF4O 3JCZA 1ZL8A 4DRXB 1TVKA 2ADQB 3OGCC 3OM3B 3BRCA 5FPOA 4JAVA 2ZE7A 3B77A 2ZM6O 2HVKC 2F1MA 3UKMA 5DM6V 1RM1B 4N23A 1NQTA 1WP8A 1K4CC 4AQYB 3HPLC 1GKFA 1SRYA 2JK5C 4BAYA 2WLIB 3ZHVA 3M7MX 4MTFA 1FXKA 4NTYA 2EIKB 1Q90D 5IDJA 1WLEA 3P3NA 3K06A 4LF9B 3WFVA 2E75B 1FJGO 3RYCB 3ABTA 2V4DA 1Y66A 2IJIA 1VQ4V 1R1BA 4B3SO 1R3IC 4TT3G 1RSOB 2RCVA 5JH7B 1ORQC 4YJ3B 2R9RB 4DV6B 4QIWF 5EC1C 4AILC 5CN0A 3CCLV 3AG7A 4IYIA 2XAJA 1AILA 4H13B 5IYZB 5J9PC 4R8CA 2GSMB 1RSOA 3C3SA 4H33A 5CBGA 4B3RO 4O2AB 4DV4O 2GV9A 1MSDA 5H9CA 4EKWA 2YI8A 4O4IA 3CC7V 1SS3A 1R3KC 2EJRA 5IJ0A 1N36O 1AI4A 4I50A 2P4VA 4UCUA 5KA5A 2AGAA 4YXWG 5L3GA 1K97A 4UB8Z 3D36A 5A9GA 4J7KA 5CA3A 3B2EE 4P9OA 3ZMZA 4DR3O 4CH4A 5CBHA 3CX5F 2OCCC 4DUYO 1G8MA 1RM1C 2PI4A 3OAAG 1M56C 1F23A 1AR1B 1M1KW 4LBEC 4UXNA 3JAKA 4JI3B 2BSKA 1W59A 4PELA 1MZEA 4CBCA 1BL8A 1FXKC 4E4EA 3ZRWB 2LGWA 2ZCEA 3CSXA 4QNHB 4JI1B 1SZTA 4DV1O 2QWNB 1NJIW 4G2KA 1HDJA 2DQ0A 3ASOC 1K7DA 4DR2O 4X64B 3X2QC 4J11A 4X66B 2GHYA 3FB5C 1N34B 5KUKA 2DYSB 1B3QA 1QLEC 3ZIAG 4JASA 1YIJV 2JJ1G 4LF6B 4JTDB 3OFNG 1VF7A 1CP9A 3ZRXA 1MMMA 4DV7O 3E22B 4DR3B 4JI0B 1K73W 3FAVB 1S77D 4W4KA 4F6RB 4UCVA 5H5NA 1NBMG 3OTFA 1IXMA 4B7EA 4K0KB 3T1CA 1H2GA 1IVSA 3CJHB 1NVPD 3CD6V 4WCEV 4L87A 2ZM6B 1NZ6A 4JI4B 3I5DA 3W7UA 1M5IA 1KB9F 1Q6HA 4ASUG 4KXRA 2FTKA 3TXQA 1NS1A 3A0HZ 2NN4A 3TETA 3LSUA 1G6UA 4WFHA 4JYYA 1BS3A 5ITZB 1XL6A 3W7SA 5A2QN 2IU3A 4I0XB 1MNGA 3AG1C 3FB7C 1BHAA 3OMAB 3L9DA 5CMUA 1XMQO 2JIZG 3JD1A 4LR3A 4P9PA 3OW2U 4J9YB 5LYJA 4XBFA 3SYPA 3FD9A 1KU9A 2LJ2A 1M57B 2EX3A 1O9HA 2CTQA 3P3PA 2QWOB 1AJQA 3D3QA 2Q7EA 4IIJA 1BE3H 2ODMA 3ABKC 5LHIA 2VWJA 3CC2V 5EBMC 4MVSA 1K4DC 5IY5B 4PJ0Z 4R50A 1UFIA 4UCRA 4B3TO 2QKSA 1V55B 1EM1A 5IJ9A 3K9AA 5BZBA 1WP7A 3JD4A 1FD9A 2E74B 1HNWO 2K9PA 3QO7A 3VQVA 2P6JA 4BIUA 1JX9A 1CPYA 1H2NA 4DUZB 3BVOA 3EHBB 3QO5A 4Z1VA 2N74A 1JVMA 3OEEG 4AQYO 2LP7A 4MT8A 3KKYA 1VP7A 4TQFA 2FMLA 1PV0A 4JI7O 4Q20A 1W0KG 2QSAA 3CHXA 1QQCA 5IYCO 3ZHSA 2KKWA 4YIOA 2DQ3A 2GTAA 4PI0A 5B3SC 4MVRA 2CDYA 2DE0X 4FVMA 2ZIMA 2WPDG 4HBNA 2R9IA 3G6EV 4PD4F 3LNMB 2QKCA 2WLHA 4JI4O 1GH6A 1D5AA 2Q67A 4J41A 4FM2A 3SPGA 2GBOA 1NTMH 1FFXA 2UUCO 5LP6A 4RQFA 1I5YA 1PKXA 2VRZA 3CRQA 1OCOB 1Q81W 4JI5O 2F93B 4TV8B 4U7OA 2Q9LA 4ZIBA 3S3WA 1OCOC 1HNZB 1WA8B 5EYPB 3JATB 1BGYH 5BMVA 5IY5C 2JRIA 3STLC 3RYHB 3HKCB 3T4DA 2X6BA 2YXHA 2ARHA 2A9HA 2CTWA 1K3EA 1UPGA 3ZEDA 2A7WA 4DR4B 1YTFB 2KG7A 4FMTA 1P84F 3HKDB 3BY6A 1KKDA 4LFBB 3OUFA 2P90A 2XASA 4DW1A 1VMGA 4B7KA 4TOIA 1RP3B 4FPPA 2KSDA 3ASNB 3CRCA 1Y6XA 1BSMA 1N34O 4CS4A 3L71H 3CCVV 4ZKIA 4O4JA 4DUYB 2KG7B 4MTGA 2QKAA 1FYJA 3OT7A 4GKJO 4UVCA 1M56B 4X1IB 5D5PA 4TUYA 5CA0B 1NT2B 1MABG 5LOVB 4B08A 2Q7GA 5LXTA 2IH3C 4PHZA 3HKDA 3J80N 3JD2A 1XHZA 3HKEA 1H2LA 4JI3O 3OEHG 2XNDG 2HVJC 2KQXA 3JD0A 3CWBH 5GW7A 3UO2A 2B5UA 3W7WA 4DV1B 2WLMA 3GWOA 1F4NA 2XT9A 1OCZC 4BW5A 4X20A 2ITDC 1KC8W 5BMVB 2P4KA 5IWAB 2RMKB 1NH2B 2LFRA 3A2FA 3ZCCA 3HKBA 4GLXA 4NXMO 4O2BB 4KL1A 2HJDA 3E8GA 5J2TB 1GMGA 1IBLO 4DR5O 4W4LA 4HZ3A 1RPOA 5KX5A 4UVBA 2PZSA 1KQSU 3IJ4A 4WFEA 2BTQA 1KP3A 4I4TB 2L35A 5LMNO 5BR8O 3CMAV 4LWSB 1X4TA 2R72A 2WLNA 4LFCB 4O2BA 2HHHB 5LMUB 1IBKO 3L73H 2Q6AA 5LHHA 3E83A 5B1NA 1PP9H 4NXMB 4QPJA 1BQZA 1Z2GA 2Q4PA 4H0LB 1Q86W 2M6YA 3E8BA 3APQA 5J2TA 1JMKC 1OCRB 4OX9O 4NVPA 2F4VO 4DV2O 3ZMTA 1H8HG 1SERA 2P7TC 2P22C 1H5WA 1SQFA 2X0LA 2YC0A 2YI9A 4GX2A 1Q82W 2CGNA 2GUZA 1Y74A 2DWDC 3K5LA 2QEXV 3G80A 3QG5A 5DN6G 2H94A 2OT5A 4WFFA 3J81N 4LF9O 2RJZA 3UCSC 1AP6A 4P2ZA 1EBOA 1GM8A 1FS0G 3ZMUA 1S0VA 5KUMA 3QO8A 2AHYA 1MG1A 4A5UB 3E22A 1FAFA 4GKJB 2R9AA 1L8DA 4IIJB 4F4LA 4F6EA 2QWRB 1FFTB 1H2KA 2E76B 4D7TA 1WPXA 3NXSA 5FNVB 2PYJA 4NB5A 2UUAO 1BT8A 1Z5WA 3RN4A 5GTHZ 3FB8C 2YIAA 3AG3B 1XNRO 2AZ2A 1TGOA 3BAAA 3TK1A 1N36B 5EIBD 3P32A 3P30A 4IHJB 4AHCA 4LF4B 1PL0A 1FXVA 4RUFA 2BSKB 4DV4B 1L0LH 1WNSA 5LGTA 4YHHB 2WA4A 3GVMA 1YTFD 1THZA 3MDSA 4KUMA 3QTCA 4IT5A 2P06A 4EFEA 2EJ7A 2EIJC 4DR1B 2B9ZA 4GT1A 1PPJH 4JZ2A 5EK0A 1I7FA 1GM7A 4GX5A 4EEQA 2ILMA 3K5MA 3HKCA 1AR4A 5IYDO 3WU2Z 3OMIB 4TWKA 5LGUA 4Z1MG 3TXSA 2JS5A 1XUQA 1DLBA 3H1JH 1SQPH 3F7VC 4Z2WA 1MOFA 4IGGA 3OTOO 5BR8B 4JAUA 2Z3YA 5LP6C 2W6JG 2OWOA 5BY1A 3ZHRA 3DXRA 5LP6B 3RBZA 3UT5B 2DYRC 1OCRC 1ZSPA 2E3CA 1U97A 3JARB 1IBLB 1RFYA 5KAFZ 2IH1C 2D3OW 3EVKA 5LMNB 3KCYA 2YICA 3THOA 5L3DA 5F2VO 2NLJC 1EFRG 4UVAA 2YUAA 5KHIA 4K35A 4DR5B 4WFBV 2AXTZ 3N2GA 3S3XA 1XDCA 5FL7G 1K92A 4NYKA 4ZI7B 4DR6B 3JASB 2IBZH 2ZD9A 5LMUO 3Q4HA 4Q6GA 4GCZA 1YVWA 4AI8A 2W6IG 3AG3C 1G4YB 1NH2D 2ZE5A 2ZR2A 1IXBA 2WAMA 3RVYA 2CGOA 4KP4A 1F7YA 2JGUA 4MSWC 4OXSA 4EFBA 4F6RA 5KMGA 3RYFB 1F4MA 1VIBA 4D7SA 3JYCA 2CH7A 2YIBA 1WPBA 2Y69B 4CS3A 4IL6Z 4ABMA 2XAFA 3CXCU 2UXNA 4JI2O 3IAYA 4NXNB 3ZRVA 1XMOB 3KDRA 3FB6C 3JASA 1YJ9V 3ICXA 5KLVH 1IJGA 3VQXA 2DMXA 3OR7C 3H1LH 1R3JC 2WWWA 3WB1A 2VQEO 1XMQB 3W7TA 5CB4A 1XNRB 4CC6A 4E2LA 1AJNA 3R66A 4MS2A 3FYIB 3ETDA 2HKOA 2HJFC 3CJHA 4FFKA 3CXHF 4C7UA 3A0BZ 4DW0A 3ZHQA 3ZHTA 2EIJB 2VS0A 3IC9A 3T2MA 4XDKA 3FAVA 5KX5B 3FFQA 4H37A 1YJWV 2Q7HA 2HR3A 4BIOA 1Q6UA 1Q7YW 3R65A 2N04A 5GONB 1Y67A 3DGEA 2EBOA 4FLZA 3CB2A 2ZKOA 3CCQV 3CMEV 1W2BU 1HNXB 3A0RA 4CH6A 3L70H 2CUGA 4JI8B 1Y76B 1DK1A 1Y4MA 2Q69A 2UUBO 1XNQO 4DUZO 3UM7A 4MVUA 1FXHA 2QWQB 5J2UA 3AG4C 4X9QA 2BOCC 3CPWU 3RYIB 2YSUB 2UXDO 1JOYA 1HNWB 4QE9A 5EBWC 1W0JG 3SJBC 2WLLA 1PNMA 5B1AC 4NTXA 1B06A 2ZIOA 1JCHA 4CH3A 5B1AB 2OTJV 2IM9A 5EZYB 1JFFB 1SQXH 2HFEC 1GK9A 2Z0AA 1ROPA 4UCSA 5JCOC 1K5QA 3G6BA 2FYUH 1LUVA 1S5HC 4TQDA 2ZE6A 4JI7B 4J9ZB 5J2UB 3IFXA 1ENVA 1KUQA 2BE3A 2JGDB 4PDLA 2YIBD 3OR6C 3SPCA 2IW5A 5JJNB 3BPZA 1E79G 2XHBA 4GUNA 3BABA 1J5EB 1ZX3A 1SESA 4FM1A 3LUTB 5K1XA 4FLTA 4O4LB 4JYAO 2NR5A 1YZBA 1SZXA 2WLJA 1Z5VA 2Y48A 3SYAA 4WFGA 1VEWA 4FFBB 2O57A 2E5LO 4I50B 2RQ6A 1GN6A 4GKKB 1XEQA 1Q5OA 1NTZH 2ATKC 1VQ5V 4JV5O 4O2AA 4B3TB 3CC4V 2DJVA 3D36C 4YHHO 1COWG 1Q6IA 1V9PA 2XAHA 3VBBA 1BHBA 1B04A 4WBNA 4K3AA 4MVZA 4EB6A 3JSNA 4LC1A 2ZXWB 5LYJB 2QGNA 3JCUZ 2ETNA 1XHXA 1FJGB 3VQYA 5B66Z 3AK3A 1FKAO 3LSSA 5JCOA 1IX9A 3ETQA 4J10A 2EILC 4YJ3A 4FLXA 5C93A 3AG2B 2EULA 3CCEV 3U0ZA 3K9SA 4GZRB 2H3OA 2JVDA 3LDCA 4I4TA 4YY3O 4HNAA 3ASNC 5JVDB 4DV5B 4LH7A 1AVMA 4FJCC 2BTQB 4IYHA 5H6RA 1Q43A 2WSSG 2WLKA 3ABKB 2EIMB 4QGPA 3CE2A 1EN6A 4FLYA 4X65O 1YHQV 4LNUB 4NKGB 2F66C 1FXKB 4I9QA 1NI8A 3K08A 3LDDA 3H1KH 2YEVA 2XUMA 1KYOF 3WG7B 2Q73A 3E86A 3X2QB 2OYQA 1P4RA 4LH6A 4JI1O 3G71V 5IWAO 1K9MW 1GN3A 1H2SB 3E89A 4DRXA 3BFRA 3NR7A 4FLVA 4X1YA 4LNUA 1G1XB 2GDSA 5EZYA 5C8YB 4PA3A 1KECA 1HNZO 3ABLB 5B1BB 2LGQA 2MK3A 4GX1A 1M90W 2Y69C 2G38A 4BWAA 4JI6B 1VQ7V 4B3SB 3D3IA 3SJQC 1EZVH 3SJAC 4O4JB 1IBMB 3RWRD 3MHHC 1YJNV 4ZOLB 2A79B 4X89A 2ZR3A 1IBKB 4RO2A 3CCMV 3JALA 2HHHO 5LBQA 3M8AA 4DV6O 3F7YC 1S76D 3E35A 5ITZA 5LL6Y 2CTRA 2PTMA 5B1OA 4UUJC 2ZXWC 1BZKA 1VQKV 2OCHA 4JTCB 1N33B 1NKDA 4PA4A 1OCCC 2W0XA 4FLUA 3SYQA 1SQGA 2CE4A 4MTXA 4LF5B 2H8PC 3ABMB 2EZPA 2EINB 2XAQA 4JYAB 3CEIA 1DF5A 1DTOA 1TA8A 4UFZA 2GUZB 4I55A 3O9OA 1GM9A 5IE9A 4DK0A
chains in the Genus database with same CATH topology
1EN6A 4YIPA 1AR4A 1EN5A 3KDRA 1MA1A 1MMMA 1JA8A 1XUQA 1BSMA 4GUNA 3KKYA 1PM9A 1GN4A 3C3SA 1GN3A 2QKAA 1EN4A 1MSDA 1XILA 3OT7A 1ZSPA 3BFRA 4YIOA 1SZXA 1N0NA 2CDYA 1IDSA 4FFKA 1VEWA 2GDSA 4C7UA 1ZLZA 1AP6A 1JR9A 3C3TA 1GN6A 2AW9A 3DC5A 3IC9A 3LSUA 2ADQB 1I08A 2ADPA 3EVKA 3QVNA 1XREA 1N0JA 4JYYA 2QKCA 1I0HA 1BS3A 4F6EA 5A9GA 1AP5A 3TJTA 3AK2A 1Y67A 1KKCA 1MNGA 1P7GA 5AG2A 1GN2A 1ZUQA 2P4KA 1BT8A 3RN4A 1QNMA 1XDCA 4BR6A 3AK3A 4X9QA 1LUWA 1IX9A 4JZGA 1D5NA 1PL4A 1IXBA 1VARA 3K9SA 4E4EA 1EM1A 3DC6A 2CE4A 1B06A 1WB8A 3MDSA 1ZTEA 1AVMA 1WB7A 3CEIA 1AR5A 3AK1A 2RCVA 4JZ2A 1LUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EN6 A;  4YIP A;  1AR4 A;  1EN5 A;  1MA1 A;  1MMM A;  1JA8 A;  1XUQ A;  1BSM A;  4GUN A;  3KKY A;  1PM9 A;  1GN4 A;  3C3S A;  1GN3 A;  2QKA A;  1EN4 A;  1MSD A;  1XIL A;  3OT7 A;  1ZSP A;  3BFR A;  4YIO A;  1SZX A;  1N0N A;  2CDY A;  1IDS A;  4FFK A;  1VEW A;  2GDS A;  4C7U A;  1ZLZ A;  1AP6 A;  1JR9 A;  3C3T A;  1GN6 A;  2AW9 A;  3DC5 A;  3IC9 A;  3LSU A;  2ADQ B;  1I08 A;  2ADP A;  3EVK A;  3QVN A;  1XRE A;  1N0J A;  4JYY A;  2QKC A;  1I0H A;  1BS3 A;  4F6E A;  5A9G A;  1AP5 A;  3TJT A;  3AK2 A;  1Y67 A;  1KKC A;  1MNG A;  1P7G A;  5AG2 A;  1GN2 A;  1ZUQ A;  2P4K A;  1BT8 A;  3RN4 A;  1QNM A;  1XDC A;  4BR6 A;  3AK3 A;  4X9Q A;  1LUW A;  1IX9 A;  4JZG A;  1D5N A;  1PL4 A;  1IXB A;  1VAR A;  3K9S A;  4E4E A;  1EM1 A;  3DC6 A;  2CE4 A;  1B06 A;  1WB8 A;  3MDS A;  1ZTE A;  1AVM A;  1WB7 A;  3CEI A;  1AR5 A;  3AK1 A;  2RCV A;  4JZ2 A;  1LUV A; 
#chains in the Genus database with same CATH topology
 3L74 H;  3JAL B;  3K03 A;  4B3R B;  2XOK G;  1GAX A;  3U10 A;  3ZRS A;  1N8R W;  1OZ0 A;  2ZDI C;  4XDL A;  3GB7 C;  1ARO P;  1D2D A;  1K33 A;  3GWK C;  4MTO A;  1E1R G;  2WA3 A;  1R6T A;  1GN4 A;  4X1K A;  3SYO A;  2IJJ A;  1EN4 A;  2BOB C;  2Z5U A;  2CK3 G;  4X64 O;  1DGS A;  2JGD A;  2FL4 A;  1V54 B;  2LQT A;  4CZZ A;  3VOU A;  1I94 B;  3ZBH A;  3K5O A;  5C8Y A;  5HFL A;  4LFA B;  3DC5 A;  1SQQ H;  1TAE A;  2FB5 A;  1I08 A;  4OPA A;  1VQM V;  1VF5 B;  4MW3 A;  4BIZ A;  3QVN A;  1XRE A;  2LW7 A;  1YCI A;  5L3C A;  4LCU C;  1YIT V;  4CC5 A;  5CA1 A;  3AK2 A;  5B3S B;  3G4S V;  4X8A A;  1NR1 A;  4R7C A;  3WG7 C;  4DXW A;  1MSW D;  1QNM A;  1N4C A;  1FFX B;  3IGA C;  4X65 B;  3B4S A;  3RYI A;  4PI2 A;  5KA6 A;  3N2G B;  2Y0I A;  1US6 A;  4FZ1 A;  2YDE A;  1K8A W;  1QLE B;  1Q8I A;  5LXT B;  4TV9 A;  4X88 A;  3H9V A;  5D5Q A;  1PL4 A;  4GYC B;  2CTP A;  4DV3 O;  4X1I A;  5EC2 C;  3K79 A;  3M99 B;  5K1P A;  3JSL A;  1NU1 H;  2DYS C;  3DC6 A;  3BEH A;  1WB8 A;  5E1A C;  5GON A;  1RPR A;  4FZ0 A;  4QJF B;  1S3J A;  3BA9 A;  3JAR A;  1JQ0 A;  2BCC H;  3F5T A;  4KFM A;  4G27 B;  2UUA B;  3HKB B;  5JJE B;  4LF5 O;  5KHK A;  5DEC A;  1LR1 A;  2UXC B;  1P49 A;  3TCU A;  5GTI Z;  5JWP A;  4HYO A;  3ZMV A;  5KHH A;  4DR7 B;  2LO1 A;  5IT9 N;  5E79 Z;  5KAI Z;  5CB4 B;  1F51 A;  3H1I H;  5JQG A;  1YSC A;  2PF4 E;  4WBN B;  3QF7 A;  3ZMS A;  2HG5 C;  2YXL A;  1SET A;  3SJC C;  2LFS A;  3CS5 A;  3AG1 B;  3PN1 A;  4DR4 O;  1N33 O;  1R3L C;  3ZS8 C;  4TUY B;  5CA0 A;  4GKK O;  5KHJ A;  1SQV H;  2DN9 A;  1PD3 A;  1OJH A;  5JJJ B;  3I56 V;  3JAM N;  1L1F A;  1KKC A;  4JTA B;  3WB2 A;  2OIG A;  2VQE B;  2RN9 A;  1GTO A;  4DR1 O;  3ZN1 A;  5LA6 A;  4O4L A;  1K5S A;  3LDE A;  3H01 A;  2RDC A;  5CBF A;  4JI6 O;  2X6A A;  4NXN O;  4JI2 B;  4ZOL A;  3ETE A;  4BR6 A;  4PDM A;  1QCE A;  1X59 A;  4LFA O;  4B3M O;  2PYL A;  3ASO B;  5TIS Z;  1ZL8 B;  4CH5 A;  1SF9 A;  1S5J A;  2JS3 A;  3K3W A;  3JAK B;  1R6N A;  1XL4 A;  2JJ2 G;  2QDO A;  3KCX A;  3ZN0 A;  4X1Y B;  4TV8 A;  2YEV B;  5LGN A;  2JDI G;  3W7X A;  1I94 O;  3K0D A;  4J80 A;  5HFM A;  4DR6 O;  4LF7 O;  1HWY A;  5EYP A;  1MA1 A;  4XDJ A;  1URF A;  2M7W A;  1A32 A;  1U96 A;  4JGS A;  1JNB A;  4I5S A;  2YXY A;  1PM9 A;  3VQW A;  4DK1 A;  4RAI A;  4ICG A;  2W0F C;  3L72 H;  1Y76 A;  2NNU A;  2V7Q G;  2UUB B;  1XNQ B;  4U3J A;  2GTS A;  3O65 A;  2ZIN A;  1S5L Z;  1I5X A;  3T1H O;  1B6Q A;  4UCT A;  4K8X A;  4PV1 B;  4OX9 B;  1ZLZ A;  2QTS A;  1ZWI C;  1J5E O;  3J7A U;  3CYO A;  4J7Z A;  1UJW B;  4PA9 A;  3B09 A;  3CRM A;  4HAM A;  2Y4U A;  3ABM C;  4EB6 B;  1AP5 A;  4PA7 A;  1WJZ A;  4JI0 O;  1QVG U;  5IYZ A;  1P7G A;  2YS8 A;  3CRR A;  4MVO A;  4DV2 B;  1YI2 V;  2WLL B;  1ZUQ A;  3ZHU A;  1J95 A;  2PY5 A;  3CCU V;  3HR0 A;  4DYL A;  2ZNI A;  3B40 A;  4DV7 B;  2UXB B;  2DWE C;  4FK5 C;  4OGQ B;  1SA0 A;  4DR2 B;  1NVP B;  1IUR A;  2AHZ A;  2QM4 A;  3T1Y O;  4MW8 A;  2QM8 A;  1LNQ A;  3K0G A;  2ZDI A;  3K57 A;  5IJ9 B;  5EIB C;  4UV8 A;  2QA4 V;  2QWP B;  3OGI B;  3AG4 B;  4FFB A;  1QU7 A;  3SYC A;  1ZTE A;  1WB7 A;  3IC7 A;  1SA0 B;  3CP1 A;  3AK1 A;  1K34 A;  3JD3 A;  2Y4T A;  4OPH A;  4WF9 V;  1AI5 A;  1HR0 B;  4X62 B;  4BW9 A;  1TUE B;  5KHG A;  2UXB O;  1H8E G;  3KG2 A;  1JA8 A;  1E1Q G;  1YEW A;  3K04 A;  4ZI7 A;  2OIE A;  4UCO A;  4LF8 O;  2N05 A;  3OE7 G;  4I0X A;  2P67 A;  1QR9 A;  2Q0A A;  1VQ8 V;  3Q4H B;  2UXC O;  2L6L A;  1GRJ A;  2Q8V A;  1OHH G;  4LF6 O;  4I7Z B;  3ZRW A;  2PGG A;  4DV5 O;  1BCC H;  1CEZ A;  3UT5 A;  1IDS A;  3PJS K;  4X66 O;  2F43 G;  1ZAU A;  3RW0 A;  1JR9 A;  2K1E A;  4ZHQ A;  2Q68 A;  2ADP A;  4TV9 B;  2JEU A;  5KMG B;  1NR7 A;  1FPO A;  3T1H B;  1YXB A;  3SPJ A;  3JAT A;  2DYR B;  1KD1 W;  5FLX N;  3WB0 A;  1P7B A;  2C2A A;  3RGB A;  4DV0 B;  2KB1 A;  4RUE A;  3FKS G;  4QE7 A;  3I55 V;  4KHP B;  4J7J A;  2XTA A;  3OMN B;  4LF7 B;  3BCC H;  2D2C B;  2X6C A;  1LUW A;  4H44 B;  4JZG A;  4TSF G;  1D5N A;  1TVK B;  3LSQ A;  2F4V B;  3OUS A;  4FLW A;  4ZHQ B;  1PNL A;  5IYB O;  5FPR A;  2OCC B;  2F95 B;  2UU9 B;  4RQE A;  3A8T A;  2XAG A;  3APO A;  1AB3 A;  3N2K B;  3ABU A;  2E5L B;  3HKE B;  2X7R B;  4P30 A;  1M93 A;  1L0N H;  3N27 A;  2IJK A;  1Q3E A;  2EIM C;  2CH7 B;  4IHJ A;  2HP8 A;  2QTO A;  1QHT A;  3STZ C;  1QR8 A;  3RYF A;  2B1I A;  3OD4 A;  5B1B C;  2UUC B;  2MW2 B;  1N32 O;  3RYC A;  3N2K A;  1H2M A;  2CAZ C;  3K59 A;  2Y0P A;  4I9W A;  2EZO A;  1Y74 B;  1FOU A;  4QPK A;  1CXZ B;  1XOU A;  4UB6 Z;  1SC5 B;  1N0N A;  3DSQ A;  5FNV A;  2ZE8 A;  4NTW A;  1KMI Z;  1IZ3 A;  3F5W C;  2AW9 A;  1VF6 A;  2R70 A;  3RVZ A;  5JQG B;  1AI6 A;  3LNN A;  5BXZ A;  1N0J A;  2VWK A;  4GX0 A;  3T1Y B;  2HLD G;  1NTK H;  1XBL A;  1PNK A;  3TJT A;  5IJ0 B;  4N21 A;  3RT3 C;  3ETG A;  2FKX A;  1OCC B;  1GN2 A;  4O4I B;  5CA1 B;  1VQL V;  1VQ6 V;  4JYC A;  3ML0 A;  2DW4 A;  3BA8 A;  1YDX A;  1VQN V;  1YF2 A;  2QM7 A;  1SQB H;  3UO3 A;  1JPX A;  4X62 O;  4DO2 A;  1R6K A;  1HR0 O;  3QNE A;  1VQ9 V;  4DR7 O;  1WAZ A;  3AEI A;  2Q0O C;  3SPH A;  3SR2 C;  5JVD A;  5DED A;  3K58 A;  1XMO O;  1IBM O;  4JPR A;  4ZBM A;  5JH7 A;  4LF8 B;  1VAR A;  3SDL A;  3B8N A;  4FM0 A;  1AJP A;  3TGU H;  4R6Z A;  1HW7 A;  1QBZ A;  2A0L A;  2UXD B;  4O4H B;  5B5E Z;  2ZT9 B;  3CCJ V;  2EIN C;  1AR5 A;  3E8F A;  1GO3 F;  4LWS A;  2EIL B;  4U3J B;  2IJH A;  4KHP O;  3DXR B;  4U7N A;  1TUB B;  4YJ2 B;  5L3F A;  4YIP A;  5H2F Z;  2AZ0 A;  1EN5 A;  3EXA A;  2WLI A;  3DTU B;  1M57 C;  4NR1 A;  3UQ8 A;  2HEP A;  3K5N A;  2DOS A;  3MD0 A;  3ZX6 A;  1KP2 A;  3E8H A;  2A06 H;  2F23 A;  1SKV A;  1VQO V;  1BQ0 A;  3ZJZ A;  1HNX O;  1VF6 C;  2PUS A;  2LW1 A;  5LHG A;  5H6Q A;  1V55 C;  1AI7 A;  2BTO A;  3G67 A;  2P5O A;  3B8M A;  2EIK C;  4O4H A;  1XIL A;  4LFC O;  2UU9 O;  4X20 B;  4HNA B;  1TUB A;  2UXX A;  4X1K B;  5L3E A;  1WN7 A;  3C3T A;  3KZI Z;  1V54 C;  3SGI A;  2QR4 A;  4YY3 B;  2JEX A;  4D6T H;  4LP8 A;  2VQF B;  1I0H A;  1H38 A;  5EBL C;  2PI5 A;  2ITC C;  3MAQ A;  2ZQM A;  1DF4 A;  4U3F H;  4JI5 B;  5LOV A;  5AG2 A;  3ABL C;  3T4Z A;  4K0K O;  3RFR A;  3BHP A;  4K8Z A;  4L8J A;  1JJ2 U;  1O9G A;  2RNB A;  2A3Q A;  1N32 B;  2IU0 A;  3OTO B;  3E2E A;  4MVM A;  3C90 A;  4JAA A;  4FIP C;  3CCR V;  4RWU A;  5LA6 B;  1XQ8 A;  1JFF A;  5L3B A;  1S72 V;  4LFB O;  1M9N A;  4WFA V;  1JJO A;  4JF3 A;  3RYH A;  3JAW B;  1EZJ A;  3H1H H;  4PDV A;  4JV5 B;  1QLN A;  2Q5Z A;  1OCZ B;  1VQP V;  1R73 A;  1HP8 A;  3L75 H;  2B1G A;  2VQF O;  3MHS C;  4PDR A;  4I55 B;  3U11 A;  1WA8 A;  4G28 B;  2YID A;  4B3M B;  1OV9 A;  4DV3 B;  4UV9 A;  4J42 A;  2OTL V;  2V1D A;  3AG2 C;  1XI1 A;  3CRA A;  3JAW A;  2QJ1 A;  1MZF A;  4YJ2 A;  4JI8 O;  2ZNJ A;  1M4U A;  4MVQ A;  3FX7 A;  2QE7 G;  3D8C A;  1KBH A;  3HB3 B;  3SPI A;  3CCS V;  3EFF K;  1BMF G;  4DV0 O;  4CS2 A;  4JYB A;  4PA6 A;  1QVF U;  3FYE B;  1T5E A;  4LF4 O;  3JCZ A;  1ZL8 A;  4DRX B;  1TVK A;  2ADQ B;  3OGC C;  3OM3 B;  3BRC A;  5FPO A;  4JAV A;  2ZE7 A;  3B77 A;  2ZM6 O;  2HVK C;  2F1M A;  3UKM A;  5DM6 V;  1RM1 B;  4N23 A;  1NQT A;  1WP8 A;  1K4C C;  4AQY B;  3HPL C;  1GKF A;  1SRY A;  2JK5 C;  4BAY A;  2WLI B;  3ZHV A;  3M7M X;  4MTF A;  1FXK A;  4NTY A;  2EIK B;  1Q90 D;  5IDJ A;  1WLE A;  3P3N A;  3K06 A;  4LF9 B;  3WFV A;  2E75 B;  1FJG O;  3RYC B;  3ABT A;  2V4D A;  1Y66 A;  2IJI A;  1VQ4 V;  1R1B A;  4B3S O;  1R3I C;  4TT3 G;  1RSO B;  2RCV A;  5JH7 B;  1ORQ C;  4YJ3 B;  2R9R B;  4DV6 B;  4QIW F;  5EC1 C;  4AIL C;  5CN0 A;  3CCL V;  3AG7 A;  4IYI A;  2XAJ A;  1AIL A;  4H13 B;  5IYZ B;  5J9P C;  4R8C A;  2GSM B;  1RSO A;  3C3S A;  4H33 A;  5CBG A;  4B3R O;  4O2A B;  4DV4 O;  2GV9 A;  1MSD A;  5H9C A;  4EKW A;  2YI8 A;  4O4I A;  3CC7 V;  1SS3 A;  1R3K C;  2EJR A;  5IJ0 A;  1N36 O;  1AI4 A;  4I50 A;  2P4V A;  4UCU A;  5KA5 A;  2AGA A;  4YXW G;  5L3G A;  1K97 A;  4UB8 Z;  3D36 A;  5A9G A;  4J7K A;  5CA3 A;  3B2E E;  4P9O A;  3ZMZ A;  4DR3 O;  4CH4 A;  5CBH A;  3CX5 F;  2OCC C;  4DUY O;  1G8M A;  1RM1 C;  2PI4 A;  3OAA G;  1M56 C;  1F23 A;  1AR1 B;  1M1K W;  4LBE C;  4UXN A;  3JAK A;  4JI3 B;  2BSK A;  1W59 A;  4PEL A;  1MZE A;  4CBC A;  1BL8 A;  1FXK C;  4E4E A;  3ZRW B;  2LGW A;  2ZCE A;  3CSX A;  4QNH B;  4JI1 B;  1SZT A;  4DV1 O;  2QWN B;  1NJI W;  4G2K A;  1HDJ A;  2DQ0 A;  3ASO C;  1K7D A;  4DR2 O;  4X64 B;  3X2Q C;  4J11 A;  4X66 B;  2GHY A;  3FB5 C;  1N34 B;  5KUK A;  2DYS B;  1B3Q A;  1QLE C;  3ZIA G;  4JAS A;  1YIJ V;  2JJ1 G;  4LF6 B;  4JTD B;  3OFN G;  1VF7 A;  1CP9 A;  3ZRX A;  1MMM A;  4DV7 O;  3E22 B;  4DR3 B;  4JI0 B;  1K73 W;  3FAV B;  1S77 D;  4W4K A;  4F6R B;  4UCV A;  5H5N A;  1NBM G;  3OTF A;  1IXM A;  4B7E A;  4K0K B;  3T1C A;  1H2G A;  1IVS A;  3CJH B;  1NVP D;  3CD6 V;  4WCE V;  4L87 A;  2ZM6 B;  1NZ6 A;  4JI4 B;  3I5D A;  3W7U A;  1M5I A;  1KB9 F;  1Q6H A;  4ASU G;  4KXR A;  2FTK A;  3TXQ A;  1NS1 A;  3A0H Z;  2NN4 A;  3TET A;  3LSU A;  1G6U A;  4WFH A;  4JYY A;  1BS3 A;  5ITZ B;  1XL6 A;  3W7S A;  5A2Q N;  2IU3 A;  4I0X B;  1MNG A;  3AG1 C;  3FB7 C;  1BHA A;  3OMA B;  3L9D A;  5CMU A;  1XMQ O;  2JIZ G;  3JD1 A;  4LR3 A;  4P9P A;  3OW2 U;  4J9Y B;  5LYJ A;  4XBF A;  3SYP A;  3FD9 A;  1KU9 A;  2LJ2 A;  1M57 B;  2EX3 A;  1O9H A;  2CTQ A;  3P3P A;  2QWO B;  1AJQ A;  3D3Q A;  2Q7E A;  4IIJ A;  1BE3 H;  2ODM A;  3ABK C;  5LHI A;  2VWJ A;  3CC2 V;  5EBM C;  4MVS A;  1K4D C;  5IY5 B;  4PJ0 Z;  4R50 A;  1UFI A;  4UCR A;  4B3T O;  2QKS A;  1V55 B;  1EM1 A;  5IJ9 A;  3K9A A;  5BZB A;  1WP7 A;  3JD4 A;  1FD9 A;  2E74 B;  1HNW O;  2K9P A;  3QO7 A;  3VQV A;  2P6J A;  4BIU A;  1JX9 A;  1CPY A;  1H2N A;  4DUZ B;  3BVO A;  3EHB B;  3QO5 A;  4Z1V A;  2N74 A;  1JVM A;  3OEE G;  4AQY O;  2LP7 A;  4MT8 A;  3KKY A;  1VP7 A;  4TQF A;  2FML A;  1PV0 A;  4JI7 O;  4Q20 A;  1W0K G;  2QSA A;  3CHX A;  1QQC A;  5IYC O;  3ZHS A;  2KKW A;  4YIO A;  2DQ3 A;  2GTA A;  4PI0 A;  5B3S C;  4MVR A;  2CDY A;  2DE0 X;  4FVM A;  2ZIM A;  2WPD G;  4HBN A;  2R9I A;  3G6E V;  4PD4 F;  3LNM B;  2QKC A;  2WLH A;  4JI4 O;  1GH6 A;  1D5A A;  2Q67 A;  4J41 A;  4FM2 A;  3SPG A;  2GBO A;  1NTM H;  1FFX A;  2UUC O;  5LP6 A;  4RQF A;  1I5Y A;  1PKX A;  2VRZ A;  3CRQ A;  1OCO B;  1Q81 W;  4JI5 O;  2F93 B;  4TV8 B;  4U7O A;  2Q9L A;  4ZIB A;  3S3W A;  1OCO C;  1HNZ B;  1WA8 B;  5EYP B;  3JAT B;  1BGY H;  5BMV A;  5IY5 C;  2JRI A;  3STL C;  3RYH B;  3HKC B;  3T4D A;  2X6B A;  2YXH A;  2ARH A;  2A9H A;  2CTW A;  1K3E A;  1UPG A;  3ZED A;  2A7W A;  4DR4 B;  1YTF B;  2KG7 A;  4FMT A;  1P84 F;  3HKD B;  3BY6 A;  1KKD A;  4LFB B;  3OUF A;  2P90 A;  2XAS A;  4DW1 A;  1VMG A;  4B7K A;  4TOI A;  1RP3 B;  4FPP A;  2KSD A;  3ASN B;  3CRC A;  1Y6X A;  1BSM A;  1N34 O;  4CS4 A;  3L71 H;  3CCV V;  4ZKI A;  4O4J A;  4DUY B;  2KG7 B;  4MTG A;  2QKA A;  1FYJ A;  3OT7 A;  4GKJ O;  4UVC A;  1M56 B;  4X1I B;  5D5P A;  4TUY A;  5CA0 B;  1NT2 B;  1MAB G;  5LOV B;  4B08 A;  2Q7G A;  5LXT A;  2IH3 C;  4PHZ A;  3HKD A;  3J80 N;  3JD2 A;  1XHZ A;  3HKE A;  1H2L A;  4JI3 O;  3OEH G;  2XND G;  2HVJ C;  2KQX A;  3JD0 A;  3CWB H;  5GW7 A;  3UO2 A;  2B5U A;  3W7W A;  4DV1 B;  2WLM A;  3GWO A;  1F4N A;  2XT9 A;  1OCZ C;  4BW5 A;  4X20 A;  2ITD C;  1KC8 W;  5BMV B;  2P4K A;  5IWA B;  2RMK B;  1NH2 B;  2LFR A;  3A2F A;  3ZCC A;  3HKB A;  4GLX A;  4NXM O;  4O2B B;  4KL1 A;  2HJD A;  3E8G A;  5J2T B;  1GMG A;  1IBL O;  4DR5 O;  4W4L A;  4HZ3 A;  1RPO A;  5KX5 A;  4UVB A;  2PZS A;  1KQS U;  3IJ4 A;  4WFE A;  2BTQ A;  1KP3 A;  4I4T B;  2L35 A;  5LMN O;  5BR8 O;  3CMA V;  4LWS B;  1X4T A;  2R72 A;  2WLN A;  4LFC B;  4O2B A;  2HHH B;  5LMU B;  1IBK O;  3L73 H;  2Q6A A;  5LHH A;  3E83 A;  5B1N A;  1PP9 H;  4NXM B;  4QPJ A;  1BQZ A;  1Z2G A;  2Q4P A;  4H0L B;  1Q86 W;  2M6Y A;  3E8B A;  3APQ A;  5J2T A;  1JMK C;  1OCR B;  4OX9 O;  4NVP A;  2F4V O;  4DV2 O;  3ZMT A;  1H8H G;  1SER A;  2P7T C;  2P22 C;  1H5W A;  1SQF A;  2X0L A;  2YC0 A;  2YI9 A;  4GX2 A;  1Q82 W;  2CGN A;  2GUZ A;  1Y74 A;  2DWD C;  3K5L A;  2QEX V;  3G80 A;  3QG5 A;  5DN6 G;  2H94 A;  2OT5 A;  4WFF A;  3J81 N;  4LF9 O;  2RJZ A;  3UCS C;  1AP6 A;  4P2Z A;  1EBO A;  1GM8 A;  1FS0 G;  3ZMU A;  1S0V A;  5KUM A;  3QO8 A;  2AHY A;  1MG1 A;  4A5U B;  3E22 A;  1FAF A;  4GKJ B;  2R9A A;  1L8D A;  4IIJ B;  4F4L A;  4F6E A;  2QWR B;  1FFT B;  1H2K A;  2E76 B;  4D7T A;  1WPX A;  3NXS A;  5FNV B;  2PYJ A;  4NB5 A;  2UUA O;  1BT8 A;  1Z5W A;  3RN4 A;  5GTH Z;  3FB8 C;  2YIA A;  3AG3 B;  1XNR O;  2AZ2 A;  1TGO A;  3BAA A;  3TK1 A;  1N36 B;  5EIB D;  3P32 A;  3P30 A;  4IHJ B;  4AHC A;  4LF4 B;  1PL0 A;  1FXV A;  4RUF A;  2BSK B;  4DV4 B;  1L0L H;  1WNS A;  5LGT A;  4YHH B;  2WA4 A;  3GVM A;  1YTF D;  1THZ A;  3MDS A;  4KUM A;  3QTC A;  4IT5 A;  2P06 A;  4EFE A;  2EJ7 A;  2EIJ C;  4DR1 B;  2B9Z A;  4GT1 A;  1PPJ H;  4JZ2 A;  5EK0 A;  1I7F A;  1GM7 A;  4GX5 A;  4EEQ A;  2ILM A;  3K5M A;  3HKC A;  1AR4 A;  5IYD O;  3WU2 Z;  3OMI B;  4TWK A;  5LGU A;  4Z1M G;  3TXS A;  2JS5 A;  1XUQ A;  1DLB A;  3H1J H;  1SQP H;  3F7V C;  4Z2W A;  1MOF A;  4IGG A;  3OTO O;  5BR8 B;  4JAU A;  2Z3Y A;  5LP6 C;  2W6J G;  2OWO A;  5BY1 A;  3ZHR A;  3DXR A;  5LP6 B;  3RBZ A;  3UT5 B;  2DYR C;  1OCR C;  1ZSP A;  2E3C A;  1U97 A;  3JAR B;  1IBL B;  1RFY A;  5KAF Z;  2IH1 C;  2D3O W;  3EVK A;  5LMN B;  3KCY A;  2YIC A;  3THO A;  5L3D A;  5F2V O;  2NLJ C;  1EFR G;  4UVA A;  2YUA A;  5KHI A;  4K35 A;  4DR5 B;  4WFB V;  2AXT Z;  3N2G A;  3S3X A;  1XDC A;  5FL7 G;  1K92 A;  4NYK A;  4ZI7 B;  4DR6 B;  3JAS B;  2IBZ H;  2ZD9 A;  5LMU O;  3Q4H A;  4Q6G A;  4GCZ A;  1YVW A;  4AI8 A;  2W6I G;  3AG3 C;  1G4Y B;  1NH2 D;  2ZE5 A;  2ZR2 A;  1IXB A;  2WAM A;  3RVY A;  2CGO A;  4KP4 A;  1F7Y A;  2JGU A;  4MSW C;  4OXS A;  4EFB A;  4F6R A;  5KMG A;  3RYF B;  1F4M A;  1VIB A;  4D7S A;  3JYC A;  2CH7 A;  2YIB A;  1WPB A;  2Y69 B;  4CS3 A;  4IL6 Z;  4ABM A;  2XAF A;  3CXC U;  2UXN A;  4JI2 O;  3IAY A;  4NXN B;  3ZRV A;  1XMO B;  3KDR A;  3FB6 C;  3JAS A;  1YJ9 V;  3ICX A;  5KLV H;  1IJG A;  3VQX A;  2DMX A;  3OR7 C;  3H1L H;  1R3J C;  2WWW A;  3WB1 A;  2VQE O;  1XMQ B;  3W7T A;  5CB4 A;  1XNR B;  4CC6 A;  4E2L A;  1AJN A;  3R66 A;  4MS2 A;  3FYI B;  3ETD A;  2HKO A;  2HJF C;  3CJH A;  4FFK A;  3CXH F;  4C7U A;  3A0B Z;  4DW0 A;  3ZHQ A;  3ZHT A;  2EIJ B;  2VS0 A;  3IC9 A;  3T2M A;  4XDK A;  3FAV A;  5KX5 B;  3FFQ A;  4H37 A;  1YJW V;  2Q7H A;  2HR3 A;  4BIO A;  1Q6U A;  1Q7Y W;  3R65 A;  2N04 A;  5GON B;  1Y67 A;  3DGE A;  2EBO A;  4FLZ A;  3CB2 A;  2ZKO A;  3CCQ V;  3CME V;  1W2B U;  1HNX B;  3A0R A;  4CH6 A;  3L70 H;  2CUG A;  4JI8 B;  1Y76 B;  1DK1 A;  1Y4M A;  2Q69 A;  2UUB O;  1XNQ O;  4DUZ O;  3UM7 A;  4MVU A;  1FXH A;  2QWQ B;  5J2U A;  3AG4 C;  4X9Q A;  2BOC C;  3CPW U;  3RYI B;  2YSU B;  2UXD O;  1JOY A;  1HNW B;  4QE9 A;  5EBW C;  1W0J G;  3SJB C;  2WLL A;  1PNM A;  5B1A C;  4NTX A;  1B06 A;  2ZIO A;  1JCH A;  4CH3 A;  5B1A B;  2OTJ V;  2IM9 A;  5EZY B;  1JFF B;  1SQX H;  2HFE C;  1GK9 A;  2Z0A A;  1ROP A;  4UCS A;  5JCO C;  1K5Q A;  3G6B A;  2FYU H;  1LUV A;  1S5H C;  4TQD A;  2ZE6 A;  4JI7 B;  4J9Z B;  5J2U B;  3IFX A;  1ENV A;  1KUQ A;  2BE3 A;  2JGD B;  4PDL A;  2YIB D;  3OR6 C;  3SPC A;  2IW5 A;  5JJN B;  3BPZ A;  1E79 G;  2XHB A;  4GUN A;  3BAB A;  1J5E B;  1ZX3 A;  1SES A;  4FM1 A;  3LUT B;  5K1X A;  4FLT A;  4O4L B;  4JYA O;  2NR5 A;  1YZB A;  1SZX A;  2WLJ A;  1Z5V A;  2Y48 A;  3SYA A;  4WFG A;  1VEW A;  4FFB B;  2O57 A;  2E5L O;  4I50 B;  2RQ6 A;  1GN6 A;  4GKK B;  1XEQ A;  1Q5O A;  1NTZ H;  2ATK C;  1VQ5 V;  4JV5 O;  4O2A A;  4B3T B;  3CC4 V;  2DJV A;  3D36 C;  4YHH O;  1COW G;  1Q6I A;  1V9P A;  2XAH A;  3VBB A;  1BHB A;  1B04 A;  4WBN A;  4K3A A;  4MVZ A;  4EB6 A;  3JSN A;  4LC1 A;  2ZXW B;  5LYJ B;  2QGN A;  3JCU Z;  2ETN A;  1XHX A;  1FJG B;  3VQY A;  5B66 Z;  3AK3 A;  1FKA O;  3LSS A;  5JCO A;  1IX9 A;  3ETQ A;  4J10 A;  2EIL C;  4YJ3 A;  4FLX A;  5C93 A;  3AG2 B;  2EUL A;  3CCE V;  3U0Z A;  3K9S A;  4GZR B;  2H3O A;  2JVD A;  3LDC A;  4I4T A;  4YY3 O;  4HNA A;  3ASN C;  5JVD B;  4DV5 B;  4LH7 A;  1AVM A;  4FJC C;  2BTQ B;  4IYH A;  5H6R A;  1Q43 A;  2WSS G;  2WLK A;  3ABK B;  2EIM B;  4QGP A;  3CE2 A;  1EN6 A;  4FLY A;  4X65 O;  1YHQ V;  4LNU B;  4NKG B;  2F66 C;  1FXK B;  4I9Q A;  1NI8 A;  3K08 A;  3LDD A;  3H1K H;  2YEV A;  2XUM A;  1KYO F;  3WG7 B;  2Q73 A;  3E86 A;  3X2Q B;  2OYQ A;  1P4R A;  4LH6 A;  4JI1 O;  3G71 V;  5IWA O;  1K9M W;  1GN3 A;  1H2S B;  3E89 A;  4DRX A;  3BFR A;  3NR7 A;  4FLV A;  4X1Y A;  4LNU A;  1G1X B;  2GDS A;  5EZY A;  5C8Y B;  4PA3 A;  1KEC A;  1HNZ O;  3ABL B;  5B1B B;  2LGQ A;  2MK3 A;  4GX1 A;  1M90 W;  2Y69 C;  2G38 A;  4BWA A;  4JI6 B;  1VQ7 V;  4B3S B;  3D3I A;  3SJQ C;  1EZV H;  3SJA C;  4O4J B;  1IBM B;  3RWR D;  3MHH C;  1YJN V;  4ZOL B;  2A79 B;  4X89 A;  2ZR3 A;  1IBK B;  4RO2 A;  3CCM V;  3JAL A;  2HHH O;  5LBQ A;  3M8A A;  4DV6 O;  3F7Y C;  1S76 D;  3E35 A;  5ITZ A;  5LL6 Y;  2CTR A;  2PTM A;  5B1O A;  4UUJ C;  2ZXW C;  1BZK A;  1VQK V;  2OCH A;  4JTC B;  1N33 B;  1NKD A;  4PA4 A;  1OCC C;  2W0X A;  4FLU A;  3SYQ A;  1SQG A;  2CE4 A;  4MTX A;  4LF5 B;  2H8P C;  3ABM B;  2EZP A;  2EIN B;  2XAQ A;  4JYA B;  3CEI A;  1DF5 A;  1DTO A;  1TA8 A;  4UFZ A;  2GUZ B;  4I55 A;  3O9O A;  1GM9 A;  5IE9 A;  4DK0 A; 
#chains in the Genus database with same CATH homology
 1EN6 A;  4YIP A;  1AR4 A;  1EN5 A;  3KDR A;  1MA1 A;  1MMM A;  1JA8 A;  1XUQ A;  1BSM A;  4GUN A;  3KKY A;  1PM9 A;  1GN4 A;  3C3S A;  1GN3 A;  2QKA A;  1EN4 A;  1MSD A;  1XIL A;  3OT7 A;  1ZSP A;  3BFR A;  4YIO A;  1SZX A;  1N0N A;  2CDY A;  1IDS A;  4FFK A;  1VEW A;  2GDS A;  4C7U A;  1ZLZ A;  1AP6 A;  1JR9 A;  3C3T A;  1GN6 A;  2AW9 A;  3DC5 A;  3IC9 A;  3LSU A;  2ADQ B;  1I08 A;  2ADP A;  3EVK A;  3QVN A;  1XRE A;  1N0J A;  4JYY A;  2QKC A;  1I0H A;  1BS3 A;  4F6E A;  5A9G A;  1AP5 A;  3TJT A;  3AK2 A;  1Y67 A;  1KKC A;  1MNG A;  1P7G A;  5AG2 A;  1GN2 A;  1ZUQ A;  2P4K A;  1BT8 A;  3RN4 A;  1QNM A;  1XDC A;  4BR6 A;  3AK3 A;  4X9Q A;  1LUW A;  1IX9 A;  4JZG A;  1D5N A;  1PL4 A;  1IXB A;  1VAR A;  3K9S A;  4E4E A;  1EM1 A;  3DC6 A;  2CE4 A;  1B06 A;  1WB8 A;  3MDS A;  1ZTE A;  1AVM A;  1WB7 A;  3CEI A;  1AR5 A;  3AK1 A;  2RCV A;  4JZ2 A;  1LUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...