1JR9A

Crystal structure of manganese superoxide dismutases from bacillus halodenitrificans
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
201
Chain Sequence
KFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNGALEGHEDLKNKSLNDLISNLDAVPENIRTAVRNNGGGHANHSLFWKLMSPNGGGKPTGEVADKINDKYGSFEKFQEEFAAAAAGRFGSGWAWLVVNNGEIEIMSTPIQDNPLMEGKKPILGLDVWEHAYYLKYQNKRPDYISAFWNVVNWDEVAAQYSQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords manganese superoxide dismutase
publication title Three-dimensional structure of manganese superoxide dismutase from Bacillus halodenitrificans, a component of the so-called "green protein".
pubmed doi rcsb
total genus 56
structure length 201
sequence length 201
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1jr9A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1jr9A02
2GDSA 3EVKA 1SZXA 2ADPA 1N0JA 4FFKA 4BR6A 1VEWA 1GN4A 1KKCA 3K9SA 1JA8A 1P7GA 4YIOA 4GUNA 1B06A 1EN4A 2ADQB 1EN5A 1AP5A 1LUVA 1VARA 3TJTA 3MDSA 1MNGA 4C7UA 3QVNA 4JZ2A 1QNMA 1GN3A 1XDCA 3RN4A 3BFRA 1AP6A 2CDYA 1XUQA 4F6EA 3AK2A 1IDSA 1AR5A 3IC9A 1XILA 2AW9A 3AK3A 1IXBA 1EM1A 1EN6A 2CE4A 3AK1A 1MSDA 1LUWA 3C3TA 3KKYA 2P4KA 3OT7A 1IX9A 1JR9A 1ZTEA 1AR4A 4E4EA 1GN2A 1ZSPA 5AG2A 1BSMA 1MMMA 4YIPA 1I08A 3LSUA 3DC6A 3DC5A 2QKCA 2QKAA 2RCVA 1PM9A 3CEIA 1BS3A 1I0HA 1GN6A 1D5NA 1ZLZA 3C3SA 1MA1A 5A9GA 1Y67A 4JYYA 4X9QA 1WB8A 1N0NA 1PL4A 4JZGA 1XREA 1WB7A 1ZUQA 1BT8A 1AVMA
chains in the Genus database with same CATH superfamily
3EVKA 2FB5A 1N0JA 3RVZA 4LF8B 4BIUA 1BCCH 1JQ0A 1K4DC 2Q0OC 2QKSA 5FPRA 3VQYA 2XAHA 2XASA 2EILC 5LXTA 3E86A 4B3MB 2HJFC 2DOSA 1M56B 3X2QC 2UUAB 1XNRB 2E75B 2QWRB 3ASOC 3E83A 5EC1C 1KMIZ 3AEIA 1HNXB 3ZIAG 2YIAA 1VARA 4NXNB 1OCRC 4PELA 1V55C 1AI4A 1M90W 1COWG 1FJGO 3T1HB 1ROPA 5LGUA 2GUZA 4ZBMA 4Z1VA 2F1MA 3AK2A 3PN1A 1D2DA 3IC9A 4HAMA 3JAMN 4WFFA 1XILA 2IW5A 1WAZA 1SQGA 3W7TA 2C2AA 1QLNA 1NTMH 3LDCA 1YXBA 3HKEA 2WLLB 1DTOA 3JASB 2GV9A 3P3NA 3HKBB 3OEHG 2XAQA 2YXHA 3IAYA 3HKDA 1ZTEA 4QE7A 4J9YB 4LC1A 1NTZH 4P2ZA 2HKOA 4YJ3A 3BRCA 3RVYA 3ZJZA 3L74H 4ZOLA 4YHHO 1I0HA 1GN6A 2Y69B 5FPOA 1BE3H 4HNAA 4WBNA 1RFYA 2Y4UA 4X9QA 3K57A 4F4LA 3OTOO 2DMXA 3FB8C 5H6QA 4ABMA 2W0FC 1GTOA 2ZINA 3W7XA 2WAMA 4KHPO 2H3OA 3AG4B 4FMTA 2QEXV 3DSQA 4FLWA 4LF4O 1VIBA 3G71V 4XDJA 3SYPA 3ZRVA 1GAXA 2XT9A 1IBMB 4OXSA 2R9RB 3JD0A 4YY3O 1Q86W 1H2NA 1QHTA 2NLJC 5H5NA 2EINB 3ETDA 1OZ0A 2P6JA 4NXMO 4R6ZA 4JZ2A 2EULA 4PA9A 4H44B 1F4NA 4DR4O 4P30A 3QO5A 4UCOA 1K8AW 3SJCC 1RSOB 4GKKO 4JPRA 1IDSA 4LF5B 4P9OA 4B3RO 3ABLB 3LUTB 1XNQO 1IXBA 4UV9A 1RPRA 2JJ2G 4AQYO 1U96A 1VQLV 1XMQB 1YTFB 1Q5OA 1MG1A 3JASA 1YVWA 3RYIB 1O9GA 3HKBA 2P4KA 3CRCA 5K1PA 2YUAA 4LH6A 3UT5B 5KA5A 1AJNA 4GCZA 2UXDO 5L3EA 4LFAO 1I94B 1BL8A 3OW2U 1H38A 4JI6O 1TAEA 1M57B 1OV9A 4KXRA 3LSUA 5LP6B 3EFFK 5KHIA 2RCVA 4JV5O 3TCUA 1N32B 3P30A 3T2MA 4JI4B 1WB8A 2WPDG 2ATKC 3A0RA 3JD1A 1ZUQA 4R7CA 4OX9O 1AVMA 2O57A 1KQSU 3SYCA 2QJ1A 5JCOC 1N34O 3FB5C 3LSSA 2D3OW 2M7WA 5FLXN 2IJHA 5F2VO 1XEQA 4DV1O 1L0LH 3OMIB 2N05A 2XHBA 4J41A 2IM9A 3CS5A 2X0LA 2ZE8A 4CBCA 1NKDA 3E8HA 3W7UA 2RN9A 3B77A 3K06A 2IBZH 1J95A 3AG3C 1IXMA 4D6TH 1SQPH 3Q4HB 2LP7A 3CCMV 4FLZA 4PHZA 3RGBA 3T1HO 2X6AA 1R6NA 1K34A 2QWNB 2UXCO 4PA7A 1H2KA 3AG2C 3HKCA 4NTYA 4KUMA 2A0LA 2OCHA 3SDLA 2UU9O 5CB4B 3VQVA 2Y0PA 1MSDA 1WLEA 3RYIA 3K03A 2Q7GA 1OCCC 2XOKG 2E3CA 3UT5A 4CS4A 2EIJC 3ABMB 1F4MA 5TISZ 3MD0A 1OCZB 3CHXA 4LNUB 2PYLA 2GTAA 4H33A 4H0LB 3CPWU 2A9HA 3N2KB 5AG2A 5LP6A 4DUZB 2B1IA 3DC5A 1I7FA 4UB8Z 1FFTB 4ZHQB 1QBZA 1QVGU 1PM9A 4FLVA 2X6CA 2ZDIC 3BA8A 4RUEA 4B3SB 1GM8A 4NTXA 3E8GA 2EZPA 1EFRG 2YS8A 4JI7O 1PKXA 1LR1A 1N0NA 1PL4A 1VMGA 1XREA 5IJ9B 4RQFA 4CZZA 1HP8A 1WB7A 4ZKIA 2PI5A 1LNQA 1PV0A 4CS3A 2NR5A 2ILMA 5KMGB 1XL4A 2GBOA 1KKCA 3K9SA 1HR0B 4FM2A 3ZS8C 4I4TB 3A0BZ 1AP5A 4MTOA 3HB3B 5LHHA 2CGOA 3Q4HA 2HLDG 2DYRC 1KP3A 1IZ3A 1ZX3A 3U0ZA 5GONB 3QO8A 4A5UB 1O9HA 3RYHB 2RDCA 1MABG 1W0JG 4CH4A 4N23A 3U11A 2EIKB 3OM3B 2QWQB 4J7JA 3C90A 2VQFB 4LF5O 2CDYA 4Z1MG 4X1YB 4O4LB 4LP8A 5IJ0B 2L6LA 3R66A 4KL1A 5LL6Y 2EILB 2Y48A 4CH3A 2CH7B 3KZIZ 3A2FA 4LNUA 1FJGB 1YITV 1K9MW 5J2UA 2QA4V 1WJZA 3N2KA 4IT5A 4NYKA 2DYSC 4ZHQA 3QF7A 2G38A 4J7ZA 4RWUA 1PD3A 4J7KA 4PA3A 1UPGA 3CYOA 3KCYA 4Q20A 4G28B 1MA1A 5IJ9A 3BEHA 3OR6C 4BWAA 5B1OA 5LGNA 4CC5A 2VQEO 1YZBA 1WA8B 2XAFA 3SJQC 5KMGA 1IURA 2QWOB 1RPOA 4GLXA 1R3LC 4I4TA 4YIOA 1FD9A 5JVDA 5EC2C 1B6QA 1H5WA 2RMKB 5LGTA 5B3SC 4YHHB 4I0XB 2BTQA 3CRRA 1WPBA 2Q4PA 3ABKC 4JGSA 4CC6A 5EIBD 2BSKB 3H1IH 1QLEC 5GONA 4X1KB 2EIMC 1KBHA 3RYHA 4JAVA 4JTAB 3ZEDA 2LO1A 4DV2O 5L3GA 4EKWA 4X1YA 4O4LA 5IJ0A 1TUBB 4LF4B 3CJHB 4WCEV 5KHHA 2CTWA 3CXHF 3AK3A 3VOUA 3K58A 2BE3A 1PNKA 4HZ3A 4IIJB 3UQ8A 4YY3B 3OUFA 4L87A 2CH7A 2A79B 3OGCC 4GX0A 3OT7A 1Y66A 1RM1C 3ZHRA 4UCRA 2DWDC 3QG5A 4DV5O 4I9QA 4NXMB 4DV7O 2VS0A 3VBBA 4DR4B 3OEEG 3BABA 1GRJA 3CE2A 3FYEB 1M9NA 3GWOA 2OTLV 4I5SA 3T4ZA 2WLJA 4AQYB 3B2EE 2QGNA 4B3SO 1WNSA 2DN9A 4IGGA 5EK0A 2F93B 4LF9O 1YJ9V 4NTWA 4JZGA 2ZT9B 4R8CA 3SPJA 1NJIW 3D36A 3R65A 2ARHA 2UXDB 1DF4A 2ZM6B 2CTRA 1SZXA 1HR0O 3RW0A 4JI6B 1MSWD 1H2MA 4TV8B 1N33O 1K5QA 1YF2A 4JV5B 4I0XA 3CRQA 4BAYA 1J5EO 3NR7A 3B8MA 2HHHB 2WLKA 4FK5C 4U7OA 2K9PA 1R3KC 3VQWA 3H01A 3MHHC 2H94A 5CBGA 2BSKA 4FZ1A 3CCRV 4OX9B 5IWAO 1Y6XA 3T4DA 1N34B 3O9OA 4ZI7B 4JI3O 2UXXA 3AG1C 2VQFO 5KHKA 1Z5WA 4DV1B 3ABUA 1YIJV 5LA6B 1TUBA 5IY5C 3CJHA 1KYOF 3ZRXA 4TV9B 5JJNB 3NXSA 3SPIA 3ZMVA 4IIJA 4MVRA 3EHBB 2CE4A 3AK1A 1LUWA 5FL7G 4UXNA 3ZHVA 4B08A 1OCOB 2OIEA 1KC8W 1BZKA 1XHXA 1SZTA 5CMUA 1KB9F 1AR4A 2RQ6A 2EBOA 2UXCB 2QDOA 4K35A 1JMKC 3FB7C 4QE9A 4XBFA 3MHSC 4RAIA 2UU9B 1AI7A 4FIPC 1YCIA 4O4HB 1UFIA 2UXBB 5BXZA 2OCCC 1BMFG 3K0DA 3CC4V 4X8AA 2KQXA 1CEZA 5FNVA 1Y74B 1GN4A 2KKWA 4TV8A 1KU9A 1N4CA 2Z3YA 3RFRA 5C8YB 4JAUA 2OT5A 1FYJA 1FPOA 4UVBA 2JRIA 1H2LA 4O2BB 1VQ9V 4JI7B 2QTSA 3F7YC 3SPHA 2B9ZA 3T1YO 1NQTA 4ZI7A 2HJDA 3K5OA 5LOVB 3B40A 5A2QN 2OYQA 3VQXA 1NZ6A 1FXKB 3MAQA 4TV9A 2MK3A 3SR2C 2IH1C 2XAJA 1JFFB 5KA6A 1PNLA 3CXCU 2A06H 1V54C 4DUYB 3ZMUA 1NH2D 4JI0B 4DV4B 1GKFA 4I9WA 3JATB 4DR5B 3C3TA 1JOYA 1IX9A 3SYAA 3M7MX 4I50B 4J10A 5EZYB 4LF7B 3HR0A 1FFXB 3ZHUA 3L9DA 5KAIZ 1EZJA 2AHZA 1VF6A 1M1KW 4TWKA 4UCUA 4JYCA 4DR7O 2WLLA 4TSFG 4X64O 4MVSA 3JD3A 4AHCA 4O4HA 3F5TA 1K3EA 3L71H 1VQPV 4ICGA 1NT2B 2D2CB 4PDLA 1N8RW 2HVKC 1FXHA 3BPZA 2ZM6O 2NN4A 2JK5C 2JDIG 3H1JH 4X66O 1M93A 2WWWA 3CX5F 4BR6A 1KUQA 3OUSA 3CD6V 5LHGA 2ZQMA 1P49A 2F43G 5DM6V 1KECA 2HHHO 3ASNC 4WFHA 3SYQA 3UO2A 2DYSB 3RT3C 4NB5A 4K0KB 3ABTA 2QWPB 3SPCA 3UM7A 3CCJV 3P32A 1VP7A 2PY5A 2F4VB 2VQEB 2F23A 1S5LZ 2ZDIA 4JTCB 1IBKB 5LOVA 5L3DA 3ETQA 1OJHA 2E74B 4O4IB 3QVNA 2ZXWB 1DGSA 1YJWV 1FXKA 3TXSA 4XDKA 2QTOA 4DR2O 2P7TC 4QJFB 3RN4A 1JFFA 1XUQA 1AJQA 4OGQB 5EBMC 2F95B 3H9VA 1S5HC 1VQKV 1S3JA 3IC7A 5IE9A 2UUCO 1F23A 3E8FA 5L3BA 4I50A 2WLNA 2A3QA 5EZYA 1FFXA 1QR9A 4UFZA 3LNNA 1RSOA 4PJ0Z 5HFMA 1HNZB 4DV2B 3ETEA 3UO3A 4MVMA 4TQDA 4UCSA 1HNWO 5CA0B 3E22B 4FLUA 3SJAC 4BIZA 1S76D 2DWEC 2UXBO 2LFSA 4GX5A 1Q7YW 2AXTZ 5B1AB 2WLIB 4UVAA 3JAWB 4DV5B 1P4RA 4DV7B 1OHHG 2EJRA 2FMLA 4LFCB 4QPKA 4JI1O 3K3WA 4FLYA 1NU1H 4EFEA 1JA8A 5BMVB 4PI2A 3E8BA 5IDJA 4DRXB 4W4LA 2ADQB 2ZIMA 1H8EG 2Q7HA 2Y69C 2DE0X 4ASUG 2BOBC 4LR3A 4NVPA 1EN5A 4LF9B 1TUEB 2N74A 5CA1B 3CCSV 4L8JA 4O4IA 2IU0A 1BGYH 1X59A 2E76B 1QNMA 3STZC 1T5EA 3JCZA 1SRYA 2P90A 3AG4C 5LMNO 3G4SV 3RYFB 1N33B 4X65B 2V4DA 3FX7A 4DUYO 4JI0O 1AR5A 4DV4O 1J5EB 2VRZA 1FAFA 4MVQA 3WU2Z 1L0NH 5B1BB 2JGUA 3QO7A 4DR5O 1TA8A 3M99B 2YICA 1BHBA 4DK1A 3CMEV 2QSAA 2EINC 3P3PA 5IWAB 4LF7O 3TK1A 1TGOA 4JI3B 4I7ZB 4FM1A 1NVPB 2PYJA 5BR8O 4MTGA 1CXZB 2XUMA 3IJ4A 4JASA 4WFGA 3WG7B 2HR3A 3LSQA 1GN2A 5CA0A 3IFXA 5CB4A 3ABLC 1M5IA 4EB6B 3E22A 3WB2A 3CB2A 5ITZB 3ZN0A 1Z2GA 2A7WA 1YJNV 1K7DA 3W7WA 2K1EA 3J80N 1D5NA 1V9PA 1ZLZA 4MVOA 1SQQH 2Z0AA 3X2QB 2WLIA 2X7RB 3ZHSA 5KX5B 3ASOB 1G6UA 3JAWA 4TT3G 1QR8A 5K1XA 4E2LA 1KKDA 1OCRB 1D5AA 1YTFD 3J7AU 3JALB 1V55B 5H2FZ 4GX2A 2E5LO 2ADPA 4FFKA 4FJCC 3K5LA 2R72A 2YSUB 5LP6C 5JJJB 2FKXA 4OPHA 4DRXA 2UUBO 2ZR2A 1VQ5V 2Q73A 2Q69A 2RNBA 4K0KO 5CA1A 2F4VO 3OGIB 3RBZA 3CP1A 2YI9A 3N27A 4X20B 3TJTA 1IBKO 5GTIZ 4Q6GA 1RP3B 1MNGA 4DXWA 4MW3A 1WP8A 4D7TA 2Q0AA 3JARB 4CS2A 4X89A 5EIBC 1GK9A 2OCCB 4U3FH 3RYFA 2FL4A 2KG7B 3OTFA 3QTCA 1A32A 4F6EA 2ITDC 3D3IA 1IBLB 1TVKB 4O2AB 3FD9A 5DECA 3WB1A 3QNEA 3T1YB 2QR4A 4UV8A 5KAFZ 4GKJO 1Y4MA 2FYUH 1THZA 3FYIB 4GX1A 4KFMA 1HNZO 3CCQV 3SGIA 4EB6A 1FOUA 4YIPA 3JAKB 2PUSA 3K0GA 5ITZA 1VQNV 2V7QG 1GM9A 5KLVH 4DV3O 4MTFA 1L1FA 2JEXA 5KX5A 1G8MA 3ZBHA 1Q6IA 3G80A 3ABMC 4LFCO 2WLHA 3G6EV 1JPXA 3LNMB 1QQCA 1W0KG 4FVMA 2OWOA 1OCZC 5CN0A 3JALA 2PZSA 1XOUA 2BOCC 4O4JB 4DR3B 5JJEB 2Q5ZA 4EFBA 2WA3A 3FAVB 5IYZB 4DR7B 4X64B 4FM0A 3U10A 3O65A 2JJ1G 1DK1A 1WA8A 2Y0IA 1VF5B 4X20A 4NR1A 5LYJB 5IT9N 3RYCB 2Z5UA 3L75H 4MVZA 2JGDB 4PDMA 4X66B 2HVJC 1R73A 3JARA 4OPAA 1IVSA 4X65O 4UUJC 3WFVA 2Q67A 2YIBA 3JD4A 3JD2A 2DQ3A 4G27B 2DQ0A 1TVKA 4O2AA 1ZWIC 4DYLA 1SC5B 3A0HZ 3ZCCA 4X1KA 1VQOV 3CMAV 5KUKA 1SESA 3ZN1A 2EX3A 3IGAC 3KKYA 4YJ3B 4J80A 4DV6O 3S3XA 1BQZA 4QNHB 4JYAB 2PF4E 3BCCH 1K97A 2Q8VA 1QCEA 1XBLA 2EIKC 5LBQA 1VQ7V 1SERA 3S3WA 2HG5C 5B66Z 3G67A 4DR2B 2Y4TA 4TQFA 4P9PA 4K8XA 4DW1A 3JAKA 3K5NA 2WLMA 2GSMB 1PNMA 2EZOA 3DC6A 3TGUH 1I5YA 5EBLC 1NVPD 2UUCB 3EXAA 3FKSG 3H1KH 1Q6UA 1Y67A 4YJ2B 4H37A 4X62B 3ZMSA 4TOIA 3JCUZ 3AG3B 1WPXA 3ML0A 4O4JA 1JNBA 4LF6O 4MTXA 2QM8A 1CPYA 3J81N 1HNWB 2LW7A 3FAVA 5IYZA 1W59A 2KB1A 5H6RA 4GUNA 1B06A 5L3FA 1E79G 1GMGA 3AG2B 3BA9A 3HPLC 5LYJA 5DN6G 4K3AA 1HW7A 3RYCA 3I5DA 2W6IG 2JGDA 3D36C 3MDSA 3THOA 2Q9LA 1S72V 4JI1B 1OCCB 3BVOA 3WB0A 2EIJB 5EBWC 1GN3A 1ORQC 2P4VA 2CUGA 1NR1A 1BHAA 1AP6A 4NKGB 1DLBA 1IBLO 5GTHZ 3CC7V 1S0VA 2YIDA 1EM1A 4DR1B 3A8TA 3CCLV 4FZ0A 3I56V 4IHJB 1B04A 3SYOA 1AI5A 2YIBD 2P5OA 3JYCA 2P67A 2ZNIA 5LA6A 4DO2A 1Q43A 4BIOA 2IJIA 5LMNB 5JCOA 2JIZG 2PTMA 3H1LH 4JI5B 1ZSPA 3L72H 1XMOB 1YSCA 3M8AA 1VQMV 2QKAA 3T1CA 3GWKC 1ZL8B 2ZNJA 1GM7A 4YJ2A 3OD4A 4JI2O 5J9PC 1AB3A 1CP9A 5BR8B 4DR3O 2R70A 2DYRB 1NS1A 2L35A 2LQTA 1QVFU 2P22C 4LCUC 3FB6C 4RO2A 1P7GA 2B5UA 2JEUA 4JI8O 1AI6A 2IJKA 3CCEV 4MVUA 4DK0A 2JS5A 1XL6A 4PV1B 1FXVA 1PPJH 3HKCB 1LUVA 4R50A 5C93A 4WF9V 1F7YA 4WFBV 2YXLA 1JVMA 4UB6Z 3SPGA 1Y74A 1L8DA 4LFBB 1S5JA 4JAAA 2E5LB 3L73H 3UCSC 5C8YA 1K5SA 4W4KA 5GW7A 2JVDA 1XDCA 2M6YA 2V1DA 4B3TO 2HFEC 4O2BA 3D8CA 1AROP 4G2KA 4UVCA 2UUBB 2LFRA 3K04A 4ZIBA 2X6BA 2AW9A 2KSDA 1K73W 2LW1A 3E2EA 1SKVA 2VWKA 2ZE7A 4I55B 2HP8A 1AJPA 4MSWC 4IHJA 2ODMA 3GB7C 4JYAO 3OMNB 2P06A 1SS3A 4PA4A 4PI0A 5B1NA 1FKAO 3K59A 1DF5A 2WSSG 1Y76B 1H2GA 4PDRA 2ZE6A 4E4EA 3W7SA 1HWYA 1M56C 4IYHA 3K08A 4FFBB 1MMMA 4LF8O 2LGQA 4XDLA 1K4CC 3JATA 2AGAA 3F7VC 3PJSK 3E35A 4CH6A 2LGWA 1SF9A 1AR1B 4QIWF 3BHPA 3H1HH 4B3MO 1ZL8A 1BS3A 5B3SB 2NNUA 2UUAO 1XNRO 1SQFA 1MOFA 1X4TA 1Q8IA 1HNXO 4GKJB 1OCOC 4X62O 3ABKB 4J42A 4MW8A 3TETA 4NXNO 5JQGB 2Q6AA 1N36B 2Q68A 3BAAA 1I5XA 1QLEB 1US6A 2EIMB 4EEQA 1B3QA 5KUMA 1YEWA 3N2GB 2AZ0A 1VF6C 2IH3C 2N04A 2QE7G 1EN4A 4DV3B 3LDEA 5BY1A 3DTUB 1SA0B 3SJBC 3B09A 2PI4A 4DV0B 1JX9A 1VQ4V 1ENVA 5HFLA 3K9AA 2IU3A 2W6JG 1R6KA 4UCVA 1RM1B 4K8ZA 2XNDG 4LBEC 3OFNG 1Q6HA 1SQXH 4H13B 4YXWG 1YI2V 2ZCEA 5J2UB 4PA6A 4DR6B 3CRAA 3OE7G 4TUYB 1XQ8A 2F66C 4B7EA 2YDEA 4I55A 4DR1O 1EN6A 4X1IB 4JYBA 1GH6A 2ZIOA 5LMUB 1E1RG 2YI8A 5H9CA 2YC0A 1Y76A 3CWBH 1P84F 1JR9A 4PDVA 2PGGA 1VQ8V 4JI5O 5CBHA 1FXKC 1R3IC 4FFBA 3ZX6A 5J2TB 1XMOO 5IYBO 2R9AA 1PP9H 5IYCO 1Q81W 4LH7A 3ZMTA 1JJOA 3CCVV 3OR7C 5IYDO 1Q82W 3C3SA 3D3QA 4QGPA 1BQ0A 5DEDA 5JVDB 1WP7A 4JYYA 1NR7A 2AHYA 2CK3G 4DV6B 1IBMO 1EBOA 3L70H 2GHYA 5D5PA 5JQGA 2YEVB 2BTQB 5L3CA 5JH7B 1BT8A 3DXRB 1G4YB 2DJVA 4GT1A 1UJWB 4LWSB 3N2GA 3CCUV 3AG1B 3RWRD 2CTQA 3DGEA 3APQA 5IY5B 1SA0A 2XAGA 1AILA 1VQ6V 3ZRWB 1K33A 4DW0A 1F51A 1XMQO 2DW4A 4F6RB 4JF3A 4WFAV 1KP2A 4LFBO 2HEPA 2LJ2A 5EYPB 5E1AC 4C7UA 4LF6B 3JSLA 1M57C 2FTKA 3ZRSA 5BMVA 5D5QA 3STLC 1W2BU 1I94O 1QU7A 4QPJA 2ZKOA 4TUYA 4GZRB 1MZEA 1R3JC 5E79Z 3K5MA 1Z5VA 4B7KA 1Q3EA 1SQVH 2ZR3A 4X1IA 1EZVH 4U3JB 1N32O 2CGNA 3ZMZA 1HDJA 1SQBH 4GYCB 4JI4O 2EJ7A 4IL6Z 1NI8A 4UCTA 2ZXWC 4Z2WA 1M4UA 4RQEA 1K92A 2ITCC 1URFA 5J2TA 4HYOA 1YHQV 3JSNA 1BSMA 2XTAA 3G6BA 4U7NA 5LHIA 2QKCA 3E89A 1PL0A 3GVMA 2GTSA 3CEIA 4HBNA 1G1XB 2IJJA 1MZFA 4N21A 2ZE5A 2YEVA 1N36O 3UKMA 5B5EZ 5KHGA 5KHJA 5JH7A 3DXRA 1R6TA 3OTOB 4D7SA 3OAAG 2YXYA 4LWSA 1P7BA 2GDSA 3FFQA 2VWJA 1NH2B 1VEWA 4KHPB 1SETA 3B4SA 1H8HG 1R1BA 3ICXA 4J11A 5CBFA 1FS0G 2Q7EA 5LXTB 3ZRWA 4AILC 4FLTA 4FLXA 4DV0O 4F6RA 1V54B 5B1AC 3K79A 2JS3A 4JI2B 1U97A 3ZHTA 5EYPA 1VF7A 5CA3A 2R9IA 1NTKH 4BW9A 2ETNA 3APOA 2CAZC 3ETGA 3KG2A 4JTDB 1ZAUA 4BW5A 1XI1A 4PD4F 4DR6O 2OTJV 1GO3F 4JI8B 2CTPA 3BFRA 2GUZB 1WN7A 1S77D 2B1GA 4DUZO 3CSXA 4GKKB 3F5WC 4U3JA 4WFEA 4B3RB 1Q90D 5LMUO 1XNQB 2AZ2A 4J9ZB 1XHZA 1E1QG 3HKEB 2WA4A 1KD1W 3CC2V 4IYIA 2H8PC 1H2SB 4KP4A 3ZHQA 2BCCH 2KG7A 2BTOA 3TXQA 2ZD9A 3OMAB 2QM4A 3HKDB 3KDRA 4X88A 5BZBA 4B3TB 3CRMA 4MS2A 1JCHA 2W0XA 2OIGA 2UXNA 4LFAB 5JWPA 1I08A 3BY6A 2QM7A 4FPPA 5B1BC 5FNVB 4AI8A 1JJ2U 4CH5A 4RUFA 4MT8A 3I55V 1IJGA 3ASNB 4ZOLB 5A9GA 3LDDA 4HNAB 4WBNB 2RJZA 3AG7A 3KCXA 1YDXA 1NBMG 2MW2B 3WG7C 3B8NA
chains in the Genus database with same CATH topology
2GDSA 3EVKA 1SZXA 2ADPA 1N0JA 4FFKA 4BR6A 1VEWA 1GN4A 1KKCA 3K9SA 1JA8A 1P7GA 4YIOA 4GUNA 1B06A 1EN4A 2ADQB 1EN5A 1AP5A 1LUVA 1VARA 3TJTA 3MDSA 1MNGA 4C7UA 3QVNA 4JZ2A 1QNMA 1GN3A 1XDCA 3RN4A 3BFRA 1AP6A 2CDYA 1XUQA 4F6EA 3AK2A 1IDSA 1AR5A 3IC9A 1XILA 2AW9A 3AK3A 1IXBA 1EM1A 1EN6A 2CE4A 3AK1A 1MSDA 1LUWA 3C3TA 3KKYA 2P4KA 3OT7A 1IX9A 1JR9A 1ZTEA 1AR4A 4E4EA 3KDRA 1GN2A 1ZSPA 5AG2A 1BSMA 1MMMA 4YIPA 1I08A 3LSUA 3DC6A 3DC5A 2QKCA 2QKAA 2RCVA 1PM9A 3CEIA 1BS3A 1I0HA 1GN6A 1D5NA 1ZLZA 3C3SA 1MA1A 5A9GA 1Y67A 4JYYA 4X9QA 1WB8A 1N0NA 1PL4A 4JZGA 1XREA 1WB7A 1ZUQA 1BT8A 1AVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDS A;  3EVK A;  1SZX A;  2ADP A;  1N0J A;  4FFK A;  4BR6 A;  1VEW A;  1GN4 A;  1KKC A;  3K9S A;  1JA8 A;  1P7G A;  4YIO A;  4GUN A;  1B06 A;  1EN4 A;  2ADQ B;  1EN5 A;  1AP5 A;  1LUV A;  1VAR A;  3TJT A;  3MDS A;  1MNG A;  4C7U A;  3QVN A;  4JZ2 A;  1QNM A;  1GN3 A;  1XDC A;  3RN4 A;  3BFR A;  1AP6 A;  2CDY A;  1XUQ A;  4F6E A;  3AK2 A;  1IDS A;  1AR5 A;  3IC9 A;  1XIL A;  2AW9 A;  3AK3 A;  1IXB A;  1EM1 A;  1EN6 A;  2CE4 A;  3AK1 A;  1MSD A;  1LUW A;  3C3T A;  3KKY A;  2P4K A;  3OT7 A;  1IX9 A;  1JR9 A;  1ZTE A;  1AR4 A;  4E4E A;  1GN2 A;  1ZSP A;  5AG2 A;  1BSM A;  1MMM A;  4YIP A;  1I08 A;  3LSU A;  3DC6 A;  3DC5 A;  2QKC A;  2QKA A;  2RCV A;  1PM9 A;  3CEI A;  1BS3 A;  1I0H A;  1GN6 A;  1D5N A;  1ZLZ A;  3C3S A;  1MA1 A;  5A9G A;  1Y67 A;  4JYY A;  4X9Q A;  1WB8 A;  1N0N A;  1PL4 A;  4JZG A;  1XRE A;  1WB7 A;  1ZUQ A;  1BT8 A;  1AVM A; 
#chains in the Genus database with same CATH topology
 3EVK A;  2FB5 A;  1N0J A;  3RVZ A;  4LF8 B;  4BIU A;  1BCC H;  1JQ0 A;  1K4D C;  2Q0O C;  2QKS A;  5FPR A;  3VQY A;  2XAH A;  2XAS A;  2EIL C;  5LXT A;  3E86 A;  4B3M B;  2HJF C;  2DOS A;  1M56 B;  3X2Q C;  2UUA B;  1XNR B;  2E75 B;  2QWR B;  3ASO C;  3E83 A;  5EC1 C;  1KMI Z;  3AEI A;  1HNX B;  3ZIA G;  2YIA A;  1VAR A;  4NXN B;  1OCR C;  4PEL A;  1V55 C;  1AI4 A;  1M90 W;  1COW G;  1FJG O;  3T1H B;  1ROP A;  5LGU A;  2GUZ A;  4ZBM A;  4Z1V A;  2F1M A;  3AK2 A;  3PN1 A;  1D2D A;  3IC9 A;  4HAM A;  3JAM N;  4WFF A;  1XIL A;  2IW5 A;  1WAZ A;  1SQG A;  3W7T A;  2C2A A;  1QLN A;  1NTM H;  3LDC A;  1YXB A;  3HKE A;  2WLL B;  1DTO A;  3JAS B;  2GV9 A;  3P3N A;  3HKB B;  3OEH G;  2XAQ A;  2YXH A;  3IAY A;  3HKD A;  1ZTE A;  4QE7 A;  4J9Y B;  4LC1 A;  1NTZ H;  4P2Z A;  2HKO A;  4YJ3 A;  3BRC A;  3RVY A;  3ZJZ A;  3L74 H;  4ZOL A;  4YHH O;  1I0H A;  1GN6 A;  2Y69 B;  5FPO A;  1BE3 H;  4HNA A;  4WBN A;  1RFY A;  2Y4U A;  4X9Q A;  3K57 A;  4F4L A;  3OTO O;  2DMX A;  3FB8 C;  5H6Q A;  4ABM A;  2W0F C;  1GTO A;  2ZIN A;  3W7X A;  2WAM A;  4KHP O;  2H3O A;  3AG4 B;  4FMT A;  2QEX V;  3DSQ A;  4FLW A;  4LF4 O;  1VIB A;  3G71 V;  4XDJ A;  3SYP A;  3ZRV A;  1GAX A;  2XT9 A;  1IBM B;  4OXS A;  2R9R B;  3JD0 A;  4YY3 O;  1Q86 W;  1H2N A;  1QHT A;  2NLJ C;  5H5N A;  2EIN B;  3ETD A;  1OZ0 A;  2P6J A;  4NXM O;  4R6Z A;  4JZ2 A;  2EUL A;  4PA9 A;  4H44 B;  1F4N A;  4DR4 O;  4P30 A;  3QO5 A;  4UCO A;  1K8A W;  3SJC C;  1RSO B;  4GKK O;  4JPR A;  1IDS A;  4LF5 B;  4P9O A;  4B3R O;  3ABL B;  3LUT B;  1XNQ O;  1IXB A;  4UV9 A;  1RPR A;  2JJ2 G;  4AQY O;  1U96 A;  1VQL V;  1XMQ B;  1YTF B;  1Q5O A;  1MG1 A;  3JAS A;  1YVW A;  3RYI B;  1O9G A;  3HKB A;  2P4K A;  3CRC A;  5K1P A;  2YUA A;  4LH6 A;  3UT5 B;  5KA5 A;  1AJN A;  4GCZ A;  2UXD O;  5L3E A;  4LFA O;  1I94 B;  1BL8 A;  3OW2 U;  1H38 A;  4JI6 O;  1TAE A;  1M57 B;  1OV9 A;  4KXR A;  3LSU A;  5LP6 B;  3EFF K;  5KHI A;  2RCV A;  4JV5 O;  3TCU A;  1N32 B;  3P30 A;  3T2M A;  4JI4 B;  1WB8 A;  2WPD G;  2ATK C;  3A0R A;  3JD1 A;  1ZUQ A;  4R7C A;  4OX9 O;  1AVM A;  2O57 A;  1KQS U;  3SYC A;  2QJ1 A;  5JCO C;  1N34 O;  3FB5 C;  3LSS A;  2D3O W;  2M7W A;  5FLX N;  2IJH A;  5F2V O;  1XEQ A;  4DV1 O;  1L0L H;  3OMI B;  2N05 A;  2XHB A;  4J41 A;  2IM9 A;  3CS5 A;  2X0L A;  2ZE8 A;  4CBC A;  1NKD A;  3E8H A;  3W7U A;  2RN9 A;  3B77 A;  3K06 A;  2IBZ H;  1J95 A;  3AG3 C;  1IXM A;  4D6T H;  1SQP H;  3Q4H B;  2LP7 A;  3CCM V;  4FLZ A;  4PHZ A;  3RGB A;  3T1H O;  2X6A A;  1R6N A;  1K34 A;  2QWN B;  2UXC O;  4PA7 A;  1H2K A;  3AG2 C;  3HKC A;  4NTY A;  4KUM A;  2A0L A;  2OCH A;  3SDL A;  2UU9 O;  5CB4 B;  3VQV A;  2Y0P A;  1MSD A;  1WLE A;  3RYI A;  3K03 A;  2Q7G A;  1OCC C;  2XOK G;  2E3C A;  3UT5 A;  4CS4 A;  2EIJ C;  3ABM B;  1F4M A;  5TIS Z;  3MD0 A;  1OCZ B;  3CHX A;  4LNU B;  2PYL A;  2GTA A;  4H33 A;  4H0L B;  3CPW U;  2A9H A;  3N2K B;  5AG2 A;  5LP6 A;  4DUZ B;  2B1I A;  3DC5 A;  1I7F A;  4UB8 Z;  1FFT B;  4ZHQ B;  1QBZ A;  1QVG U;  1PM9 A;  4FLV A;  2X6C A;  2ZDI C;  3BA8 A;  4RUE A;  4B3S B;  1GM8 A;  4NTX A;  3E8G A;  2EZP A;  1EFR G;  2YS8 A;  4JI7 O;  1PKX A;  1LR1 A;  1N0N A;  1PL4 A;  1VMG A;  1XRE A;  5IJ9 B;  4RQF A;  4CZZ A;  1HP8 A;  1WB7 A;  4ZKI A;  2PI5 A;  1LNQ A;  1PV0 A;  4CS3 A;  2NR5 A;  2ILM A;  5KMG B;  1XL4 A;  2GBO A;  1KKC A;  3K9S A;  1HR0 B;  4FM2 A;  3ZS8 C;  4I4T B;  3A0B Z;  1AP5 A;  4MTO A;  3HB3 B;  5LHH A;  2CGO A;  3Q4H A;  2HLD G;  2DYR C;  1KP3 A;  1IZ3 A;  1ZX3 A;  3U0Z A;  5GON B;  3QO8 A;  4A5U B;  1O9H A;  3RYH B;  2RDC A;  1MAB G;  1W0J G;  4CH4 A;  4N23 A;  3U11 A;  2EIK B;  3OM3 B;  2QWQ B;  4J7J A;  3C90 A;  2VQF B;  4LF5 O;  2CDY A;  4Z1M G;  4X1Y B;  4O4L B;  4LP8 A;  5IJ0 B;  2L6L A;  3R66 A;  4KL1 A;  5LL6 Y;  2EIL B;  2Y48 A;  4CH3 A;  2CH7 B;  3KZI Z;  3A2F A;  4LNU A;  1FJG B;  1YIT V;  1K9M W;  5J2U A;  2QA4 V;  1WJZ A;  3N2K A;  4IT5 A;  4NYK A;  2DYS C;  4ZHQ A;  3QF7 A;  2G38 A;  4J7Z A;  4RWU A;  1PD3 A;  4J7K A;  4PA3 A;  1UPG A;  3CYO A;  3KCY A;  4Q20 A;  4G28 B;  1MA1 A;  5IJ9 A;  3BEH A;  3OR6 C;  4BWA A;  5B1O A;  5LGN A;  4CC5 A;  2VQE O;  1YZB A;  1WA8 B;  2XAF A;  3SJQ C;  5KMG A;  1IUR A;  2QWO B;  1RPO A;  4GLX A;  1R3L C;  4I4T A;  4YIO A;  1FD9 A;  5JVD A;  5EC2 C;  1B6Q A;  1H5W A;  2RMK B;  5LGT A;  5B3S C;  4YHH B;  4I0X B;  2BTQ A;  3CRR A;  1WPB A;  2Q4P A;  3ABK C;  4JGS A;  4CC6 A;  5EIB D;  2BSK B;  3H1I H;  1QLE C;  5GON A;  4X1K B;  2EIM C;  1KBH A;  3RYH A;  4JAV A;  4JTA B;  3ZED A;  2LO1 A;  4DV2 O;  5L3G A;  4EKW A;  4X1Y A;  4O4L A;  5IJ0 A;  1TUB B;  4LF4 B;  3CJH B;  4WCE V;  5KHH A;  2CTW A;  3CXH F;  3AK3 A;  3VOU A;  3K58 A;  2BE3 A;  1PNK A;  4HZ3 A;  4IIJ B;  3UQ8 A;  4YY3 B;  3OUF A;  4L87 A;  2CH7 A;  2A79 B;  3OGC C;  4GX0 A;  3OT7 A;  1Y66 A;  1RM1 C;  3ZHR A;  4UCR A;  2DWD C;  3QG5 A;  4DV5 O;  4I9Q A;  4NXM B;  4DV7 O;  2VS0 A;  3VBB A;  4DR4 B;  3OEE G;  3BAB A;  1GRJ A;  3CE2 A;  3FYE B;  1M9N A;  3GWO A;  2OTL V;  4I5S A;  3T4Z A;  2WLJ A;  4AQY B;  3B2E E;  2QGN A;  4B3S O;  1WNS A;  2DN9 A;  4IGG A;  5EK0 A;  2F93 B;  4LF9 O;  1YJ9 V;  4NTW A;  4JZG A;  2ZT9 B;  4R8C A;  3SPJ A;  1NJI W;  3D36 A;  3R65 A;  2ARH A;  2UXD B;  1DF4 A;  2ZM6 B;  2CTR A;  1SZX A;  1HR0 O;  3RW0 A;  4JI6 B;  1MSW D;  1H2M A;  4TV8 B;  1N33 O;  1K5Q A;  1YF2 A;  4JV5 B;  4I0X A;  3CRQ A;  4BAY A;  1J5E O;  3NR7 A;  3B8M A;  2HHH B;  2WLK A;  4FK5 C;  4U7O A;  2K9P A;  1R3K C;  3VQW A;  3H01 A;  3MHH C;  2H94 A;  5CBG A;  2BSK A;  4FZ1 A;  3CCR V;  4OX9 B;  5IWA O;  1Y6X A;  3T4D A;  1N34 B;  3O9O A;  4ZI7 B;  4JI3 O;  2UXX A;  3AG1 C;  2VQF O;  5KHK A;  1Z5W A;  4DV1 B;  3ABU A;  1YIJ V;  5LA6 B;  1TUB A;  5IY5 C;  3CJH A;  1KYO F;  3ZRX A;  4TV9 B;  5JJN B;  3NXS A;  3SPI A;  3ZMV A;  4IIJ A;  4MVR A;  3EHB B;  2CE4 A;  3AK1 A;  1LUW A;  5FL7 G;  4UXN A;  3ZHV A;  4B08 A;  1OCO B;  2OIE A;  1KC8 W;  1BZK A;  1XHX A;  1SZT A;  5CMU A;  1KB9 F;  1AR4 A;  2RQ6 A;  2EBO A;  2UXC B;  2QDO A;  4K35 A;  1JMK C;  3FB7 C;  4QE9 A;  4XBF A;  3MHS C;  4RAI A;  2UU9 B;  1AI7 A;  4FIP C;  1YCI A;  4O4H B;  1UFI A;  2UXB B;  5BXZ A;  2OCC C;  1BMF G;  3K0D A;  3CC4 V;  4X8A A;  2KQX A;  1CEZ A;  5FNV A;  1Y74 B;  1GN4 A;  2KKW A;  4TV8 A;  1KU9 A;  1N4C A;  2Z3Y A;  3RFR A;  5C8Y B;  4JAU A;  2OT5 A;  1FYJ A;  1FPO A;  4UVB A;  2JRI A;  1H2L A;  4O2B B;  1VQ9 V;  4JI7 B;  2QTS A;  3F7Y C;  3SPH A;  2B9Z A;  3T1Y O;  1NQT A;  4ZI7 A;  2HJD A;  3K5O A;  5LOV B;  3B40 A;  5A2Q N;  2OYQ A;  3VQX A;  1NZ6 A;  1FXK B;  3MAQ A;  4TV9 A;  2MK3 A;  3SR2 C;  2IH1 C;  2XAJ A;  1JFF B;  5KA6 A;  1PNL A;  3CXC U;  2A06 H;  1V54 C;  4DUY B;  3ZMU A;  1NH2 D;  4JI0 B;  4DV4 B;  1GKF A;  4I9W A;  3JAT B;  4DR5 B;  3C3T A;  1JOY A;  1IX9 A;  3SYA A;  3M7M X;  4I50 B;  4J10 A;  5EZY B;  4LF7 B;  3HR0 A;  1FFX B;  3ZHU A;  3L9D A;  5KAI Z;  1EZJ A;  2AHZ A;  1VF6 A;  1M1K W;  4TWK A;  4UCU A;  4JYC A;  4DR7 O;  2WLL A;  4TSF G;  4X64 O;  4MVS A;  3JD3 A;  4AHC A;  4O4H A;  3F5T A;  1K3E A;  3L71 H;  1VQP V;  4ICG A;  1NT2 B;  2D2C B;  4PDL A;  1N8R W;  2HVK C;  1FXH A;  3BPZ A;  2ZM6 O;  2NN4 A;  2JK5 C;  2JDI G;  3H1J H;  4X66 O;  1M93 A;  2WWW A;  3CX5 F;  4BR6 A;  1KUQ A;  3OUS A;  3CD6 V;  5LHG A;  2ZQM A;  1P49 A;  2F43 G;  5DM6 V;  1KEC A;  2HHH O;  3ASN C;  4WFH A;  3SYQ A;  3UO2 A;  2DYS B;  3RT3 C;  4NB5 A;  4K0K B;  3ABT A;  2QWP B;  3SPC A;  3UM7 A;  3CCJ V;  3P32 A;  1VP7 A;  2PY5 A;  2F4V B;  2VQE B;  2F23 A;  1S5L Z;  2ZDI A;  4JTC B;  1IBK B;  5LOV A;  5L3D A;  3ETQ A;  1OJH A;  2E74 B;  4O4I B;  3QVN A;  2ZXW B;  1DGS A;  1YJW V;  1FXK A;  3TXS A;  4XDK A;  2QTO A;  4DR2 O;  2P7T C;  4QJF B;  3RN4 A;  1JFF A;  1XUQ A;  1AJQ A;  4OGQ B;  5EBM C;  2F95 B;  3H9V A;  1S5H C;  1VQK V;  1S3J A;  3IC7 A;  5IE9 A;  2UUC O;  1F23 A;  3E8F A;  5L3B A;  4I50 A;  2WLN A;  2A3Q A;  5EZY A;  1FFX A;  1QR9 A;  4UFZ A;  3LNN A;  1RSO A;  4PJ0 Z;  5HFM A;  1HNZ B;  4DV2 B;  3ETE A;  3UO3 A;  4MVM A;  4TQD A;  4UCS A;  1HNW O;  5CA0 B;  3E22 B;  4FLU A;  3SJA C;  4BIZ A;  1S76 D;  2DWE C;  2UXB O;  2LFS A;  4GX5 A;  1Q7Y W;  2AXT Z;  5B1A B;  2WLI B;  4UVA A;  3JAW B;  4DV5 B;  1P4R A;  4DV7 B;  1OHH G;  2EJR A;  2FML A;  4LFC B;  4QPK A;  4JI1 O;  3K3W A;  4FLY A;  1NU1 H;  4EFE A;  1JA8 A;  5BMV B;  4PI2 A;  3E8B A;  5IDJ A;  4DRX B;  4W4L A;  2ADQ B;  2ZIM A;  1H8E G;  2Q7H A;  2Y69 C;  2DE0 X;  4ASU G;  2BOB C;  4LR3 A;  4NVP A;  1EN5 A;  4LF9 B;  1TUE B;  2N74 A;  5CA1 B;  3CCS V;  4L8J A;  4O4I A;  2IU0 A;  1BGY H;  1X59 A;  2E76 B;  1QNM A;  3STZ C;  1T5E A;  3JCZ A;  1SRY A;  2P90 A;  3AG4 C;  5LMN O;  3G4S V;  3RYF B;  1N33 B;  4X65 B;  2V4D A;  3FX7 A;  4DUY O;  4JI0 O;  1AR5 A;  4DV4 O;  1J5E B;  2VRZ A;  1FAF A;  4MVQ A;  3WU2 Z;  1L0N H;  5B1B B;  2JGU A;  3QO7 A;  4DR5 O;  1TA8 A;  3M99 B;  2YIC A;  1BHB A;  4DK1 A;  3CME V;  2QSA A;  2EIN C;  3P3P A;  5IWA B;  4LF7 O;  3TK1 A;  1TGO A;  4JI3 B;  4I7Z B;  4FM1 A;  1NVP B;  2PYJ A;  5BR8 O;  4MTG A;  1CXZ B;  2XUM A;  3IJ4 A;  4JAS A;  4WFG A;  3WG7 B;  2HR3 A;  3LSQ A;  1GN2 A;  5CA0 A;  3IFX A;  5CB4 A;  3ABL C;  1M5I A;  4EB6 B;  3E22 A;  3WB2 A;  3CB2 A;  5ITZ B;  3ZN0 A;  1Z2G A;  2A7W A;  1YJN V;  1K7D A;  3W7W A;  2K1E A;  3J80 N;  1D5N A;  1V9P A;  1ZLZ A;  4MVO A;  1SQQ H;  2Z0A A;  3X2Q B;  2WLI A;  2X7R B;  3ZHS A;  5KX5 B;  3ASO B;  1G6U A;  3JAW A;  4TT3 G;  1QR8 A;  5K1X A;  4E2L A;  1KKD A;  1OCR B;  1D5A A;  1YTF D;  3J7A U;  3JAL B;  1V55 B;  5H2F Z;  4GX2 A;  2E5L O;  2ADP A;  4FFK A;  4FJC C;  3K5L A;  2R72 A;  2YSU B;  5LP6 C;  5JJJ B;  2FKX A;  4OPH A;  4DRX A;  2UUB O;  2ZR2 A;  1VQ5 V;  2Q73 A;  2Q69 A;  2RNB A;  4K0K O;  5CA1 A;  2F4V O;  3OGI B;  3RBZ A;  3CP1 A;  2YI9 A;  3N27 A;  4X20 B;  3TJT A;  1IBK O;  5GTI Z;  4Q6G A;  1RP3 B;  1MNG A;  4DXW A;  4MW3 A;  1WP8 A;  4D7T A;  2Q0A A;  3JAR B;  4CS2 A;  4X89 A;  5EIB C;  1GK9 A;  2OCC B;  4U3F H;  3RYF A;  2FL4 A;  2KG7 B;  3OTF A;  3QTC A;  1A32 A;  4F6E A;  2ITD C;  3D3I A;  1IBL B;  1TVK B;  4O2A B;  3FD9 A;  5DEC A;  3WB1 A;  3QNE A;  3T1Y B;  2QR4 A;  4UV8 A;  5KAF Z;  4GKJ O;  1Y4M A;  2FYU H;  1THZ A;  3FYI B;  4GX1 A;  4KFM A;  1HNZ O;  3CCQ V;  3SGI A;  4EB6 A;  1FOU A;  4YIP A;  3JAK B;  2PUS A;  3K0G A;  5ITZ A;  1VQN V;  2V7Q G;  1GM9 A;  5KLV H;  4DV3 O;  4MTF A;  1L1F A;  2JEX A;  5KX5 A;  1G8M A;  3ZBH A;  1Q6I A;  3G80 A;  3ABM C;  4LFC O;  2WLH A;  3G6E V;  1JPX A;  3LNM B;  1QQC A;  1W0K G;  4FVM A;  2OWO A;  1OCZ C;  5CN0 A;  3JAL A;  2PZS A;  1XOU A;  2BOC C;  4O4J B;  4DR3 B;  5JJE B;  2Q5Z A;  4EFB A;  2WA3 A;  3FAV B;  5IYZ B;  4DR7 B;  4X64 B;  4FM0 A;  3U10 A;  3O65 A;  2JJ1 G;  1DK1 A;  1WA8 A;  2Y0I A;  1VF5 B;  4X20 A;  4NR1 A;  5LYJ B;  5IT9 N;  3RYC B;  2Z5U A;  3L75 H;  4MVZ A;  2JGD B;  4PDM A;  4X66 B;  2HVJ C;  1R73 A;  3JAR A;  4OPA A;  1IVS A;  4X65 O;  4UUJ C;  3WFV A;  2Q67 A;  2YIB A;  3JD4 A;  3JD2 A;  2DQ3 A;  4G27 B;  2DQ0 A;  1TVK A;  4O2A A;  1ZWI C;  4DYL A;  1SC5 B;  3A0H Z;  3ZCC A;  4X1K A;  1VQO V;  3CMA V;  5KUK A;  1SES A;  3ZN1 A;  2EX3 A;  3IGA C;  3KKY A;  4YJ3 B;  4J80 A;  4DV6 O;  3S3X A;  1BQZ A;  4QNH B;  4JYA B;  2PF4 E;  3BCC H;  1K97 A;  2Q8V A;  1QCE A;  1XBL A;  2EIK C;  5LBQ A;  1VQ7 V;  1SER A;  3S3W A;  2HG5 C;  5B66 Z;  3G67 A;  4DR2 B;  2Y4T A;  4TQF A;  4P9P A;  4K8X A;  4DW1 A;  3JAK A;  3K5N A;  2WLM A;  2GSM B;  1PNM A;  2EZO A;  3DC6 A;  3TGU H;  1I5Y A;  5EBL C;  1NVP D;  2UUC B;  3EXA A;  3FKS G;  3H1K H;  1Q6U A;  1Y67 A;  4YJ2 B;  4H37 A;  4X62 B;  3ZMS A;  4TOI A;  3JCU Z;  3AG3 B;  1WPX A;  3ML0 A;  4O4J A;  1JNB A;  4LF6 O;  4MTX A;  2QM8 A;  1CPY A;  3J81 N;  1HNW B;  2LW7 A;  3FAV A;  5IYZ A;  1W59 A;  2KB1 A;  5H6R A;  4GUN A;  1B06 A;  5L3F A;  1E79 G;  1GMG A;  3AG2 B;  3BA9 A;  3HPL C;  5LYJ A;  5DN6 G;  4K3A A;  1HW7 A;  3RYC A;  3I5D A;  2W6I G;  2JGD A;  3D36 C;  3MDS A;  3THO A;  2Q9L A;  1S72 V;  4JI1 B;  1OCC B;  3BVO A;  3WB0 A;  2EIJ B;  5EBW C;  1GN3 A;  1ORQ C;  2P4V A;  2CUG A;  1NR1 A;  1BHA A;  1AP6 A;  4NKG B;  1DLB A;  1IBL O;  5GTH Z;  3CC7 V;  1S0V A;  2YID A;  1EM1 A;  4DR1 B;  3A8T A;  3CCL V;  4FZ0 A;  3I56 V;  4IHJ B;  1B04 A;  3SYO A;  1AI5 A;  2YIB D;  2P5O A;  3JYC A;  2P67 A;  2ZNI A;  5LA6 A;  4DO2 A;  1Q43 A;  4BIO A;  2IJI A;  5LMN B;  5JCO A;  2JIZ G;  2PTM A;  3H1L H;  4JI5 B;  1ZSP A;  3L72 H;  1XMO B;  1YSC A;  3M8A A;  1VQM V;  2QKA A;  3T1C A;  3GWK C;  1ZL8 B;  2ZNJ A;  1GM7 A;  4YJ2 A;  3OD4 A;  4JI2 O;  5J9P C;  1AB3 A;  1CP9 A;  5BR8 B;  4DR3 O;  2R70 A;  2DYR B;  1NS1 A;  2L35 A;  2LQT A;  1QVF U;  2P22 C;  4LCU C;  3FB6 C;  4RO2 A;  1P7G A;  2B5U A;  2JEU A;  4JI8 O;  1AI6 A;  2IJK A;  3CCE V;  4MVU A;  4DK0 A;  2JS5 A;  1XL6 A;  4PV1 B;  1FXV A;  1PPJ H;  3HKC B;  1LUV A;  4R50 A;  5C93 A;  4WF9 V;  1F7Y A;  4WFB V;  2YXL A;  1JVM A;  4UB6 Z;  3SPG A;  1Y74 A;  1L8D A;  4LFB B;  1S5J A;  4JAA A;  2E5L B;  3L73 H;  3UCS C;  5C8Y A;  1K5S A;  4W4K A;  5GW7 A;  2JVD A;  1XDC A;  2M6Y A;  2V1D A;  4B3T O;  2HFE C;  4O2B A;  3D8C A;  1ARO P;  4G2K A;  4UVC A;  2UUB B;  2LFR A;  3K04 A;  4ZIB A;  2X6B A;  2AW9 A;  2KSD A;  1K73 W;  2LW1 A;  3E2E A;  1SKV A;  2VWK A;  2ZE7 A;  4I55 B;  2HP8 A;  1AJP A;  4MSW C;  4IHJ A;  2ODM A;  3GB7 C;  4JYA O;  3OMN B;  2P06 A;  1SS3 A;  4PA4 A;  4PI0 A;  5B1N A;  1FKA O;  3K59 A;  1DF5 A;  2WSS G;  1Y76 B;  1H2G A;  4PDR A;  2ZE6 A;  4E4E A;  3W7S A;  1HWY A;  1M56 C;  4IYH A;  3K08 A;  4FFB B;  1MMM A;  4LF8 O;  2LGQ A;  4XDL A;  1K4C C;  3JAT A;  2AGA A;  3F7V C;  3PJS K;  3E35 A;  4CH6 A;  2LGW A;  1SF9 A;  1AR1 B;  4QIW F;  3BHP A;  3H1H H;  4B3M O;  1ZL8 A;  1BS3 A;  5B3S B;  2NNU A;  2UUA O;  1XNR O;  1SQF A;  1MOF A;  1X4T A;  1Q8I A;  1HNX O;  4GKJ B;  1OCO C;  4X62 O;  3ABK B;  4J42 A;  4MW8 A;  3TET A;  4NXN O;  5JQG B;  2Q6A A;  1N36 B;  2Q68 A;  3BAA A;  1I5X A;  1QLE B;  1US6 A;  2EIM B;  4EEQ A;  1B3Q A;  5KUM A;  1YEW A;  3N2G B;  2AZ0 A;  1VF6 C;  2IH3 C;  2N04 A;  2QE7 G;  1EN4 A;  4DV3 B;  3LDE A;  5BY1 A;  3DTU B;  1SA0 B;  3SJB C;  3B09 A;  2PI4 A;  4DV0 B;  1JX9 A;  1VQ4 V;  1ENV A;  5HFL A;  3K9A A;  2IU3 A;  2W6J G;  1R6K A;  4UCV A;  1RM1 B;  4K8Z A;  2XND G;  4LBE C;  3OFN G;  1Q6H A;  1SQX H;  4H13 B;  4YXW G;  1YI2 V;  2ZCE A;  5J2U B;  4PA6 A;  4DR6 B;  3CRA A;  3OE7 G;  4TUY B;  1XQ8 A;  2F66 C;  4B7E A;  2YDE A;  4I55 A;  4DR1 O;  1EN6 A;  4X1I B;  4JYB A;  1GH6 A;  2ZIO A;  5LMU B;  1E1R G;  2YI8 A;  5H9C A;  2YC0 A;  1Y76 A;  3CWB H;  1P84 F;  1JR9 A;  4PDV A;  2PGG A;  1VQ8 V;  4JI5 O;  5CBH A;  1FXK C;  1R3I C;  4FFB A;  3ZX6 A;  5J2T B;  1XMO O;  5IYB O;  2R9A A;  1PP9 H;  5IYC O;  1Q81 W;  4LH7 A;  3ZMT A;  1JJO A;  3CCV V;  3OR7 C;  5IYD O;  1Q82 W;  3C3S A;  3D3Q A;  4QGP A;  1BQ0 A;  5DED A;  5JVD B;  1WP7 A;  4JYY A;  1NR7 A;  2AHY A;  2CK3 G;  4DV6 B;  1IBM O;  1EBO A;  3L70 H;  2GHY A;  5D5P A;  5JQG A;  2YEV B;  2BTQ B;  5L3C A;  5JH7 B;  1BT8 A;  3DXR B;  1G4Y B;  2DJV A;  4GT1 A;  1UJW B;  4LWS B;  3N2G A;  3CCU V;  3AG1 B;  3RWR D;  2CTQ A;  3DGE A;  3APQ A;  5IY5 B;  1SA0 A;  2XAG A;  1AIL A;  1VQ6 V;  3ZRW B;  1K33 A;  4DW0 A;  1F51 A;  1XMQ O;  2DW4 A;  4F6R B;  4JF3 A;  4WFA V;  1KP2 A;  4LFB O;  2HEP A;  2LJ2 A;  5EYP B;  5E1A C;  4C7U A;  4LF6 B;  3JSL A;  1M57 C;  2FTK A;  3ZRS A;  5BMV A;  5D5Q A;  3STL C;  1W2B U;  1I94 O;  1QU7 A;  4QPJ A;  2ZKO A;  4TUY A;  4GZR B;  1MZE A;  1R3J C;  5E79 Z;  3K5M A;  1Z5V A;  4B7K A;  1Q3E A;  1SQV H;  2ZR3 A;  4X1I A;  1EZV H;  4U3J B;  1N32 O;  2CGN A;  3ZMZ A;  1HDJ A;  1SQB H;  4GYC B;  4JI4 O;  2EJ7 A;  4IL6 Z;  1NI8 A;  4UCT A;  2ZXW C;  4Z2W A;  1M4U A;  4RQE A;  1K92 A;  2ITC C;  1URF A;  5J2T A;  4HYO A;  1YHQ V;  3JSN A;  1BSM A;  2XTA A;  3G6B A;  4U7N A;  5LHI A;  2QKC A;  3E89 A;  1PL0 A;  3GVM A;  2GTS A;  3CEI A;  4HBN A;  1G1X B;  2IJJ A;  1MZF A;  4N21 A;  2ZE5 A;  2YEV A;  1N36 O;  3UKM A;  5B5E Z;  5KHG A;  5KHJ A;  5JH7 A;  3DXR A;  1R6T A;  3OTO B;  4D7S A;  3OAA G;  2YXY A;  4LWS A;  1P7B A;  2GDS A;  3FFQ A;  2VWJ A;  1NH2 B;  1VEW A;  4KHP B;  1SET A;  3B4S A;  1H8H G;  1R1B A;  3ICX A;  4J11 A;  5CBF A;  1FS0 G;  2Q7E A;  5LXT B;  3ZRW A;  4AIL C;  4FLT A;  4FLX A;  4DV0 O;  4F6R A;  1V54 B;  5B1A C;  3K79 A;  2JS3 A;  4JI2 B;  1U97 A;  3ZHT A;  5EYP A;  1VF7 A;  5CA3 A;  2R9I A;  1NTK H;  4BW9 A;  2ETN A;  3APO A;  2CAZ C;  3ETG A;  3KG2 A;  4JTD B;  1ZAU A;  4BW5 A;  1XI1 A;  4PD4 F;  4DR6 O;  2OTJ V;  1GO3 F;  4JI8 B;  2CTP A;  3BFR A;  2GUZ B;  1WN7 A;  1S77 D;  2B1G A;  4DUZ O;  3CSX A;  4GKK B;  3F5W C;  4U3J A;  4WFE A;  4B3R B;  1Q90 D;  5LMU O;  1XNQ B;  2AZ2 A;  4J9Z B;  1XHZ A;  1E1Q G;  3HKE B;  2WA4 A;  1KD1 W;  3CC2 V;  4IYI A;  2H8P C;  1H2S B;  4KP4 A;  3ZHQ A;  2BCC H;  2KG7 A;  2BTO A;  3TXQ A;  2ZD9 A;  3OMA B;  2QM4 A;  3HKD B;  3KDR A;  4X88 A;  5BZB A;  4B3T B;  3CRM A;  4MS2 A;  1JCH A;  2W0X A;  2OIG A;  2UXN A;  4LFA B;  5JWP A;  1I08 A;  3BY6 A;  2QM7 A;  4FPP A;  5B1B C;  5FNV B;  4AI8 A;  1JJ2 U;  4CH5 A;  4RUF A;  4MT8 A;  3I55 V;  1IJG A;  3ASN B;  4ZOL B;  5A9G A;  3LDD A;  4HNA B;  4WBN B;  2RJZ A;  3AG7 A;  3KCX A;  1YDX A;  1NBM G;  2MW2 B;  3WG7 C;  3B8N A; 
#chains in the Genus database with same CATH homology
 2GDS A;  3EVK A;  1SZX A;  2ADP A;  1N0J A;  4FFK A;  4BR6 A;  1VEW A;  1GN4 A;  1KKC A;  3K9S A;  1JA8 A;  1P7G A;  4YIO A;  4GUN A;  1B06 A;  1EN4 A;  2ADQ B;  1EN5 A;  1AP5 A;  1LUV A;  1VAR A;  3TJT A;  3MDS A;  1MNG A;  4C7U A;  3QVN A;  4JZ2 A;  1QNM A;  1GN3 A;  1XDC A;  3RN4 A;  3BFR A;  1AP6 A;  2CDY A;  1XUQ A;  4F6E A;  3AK2 A;  1IDS A;  1AR5 A;  3IC9 A;  1XIL A;  2AW9 A;  3AK3 A;  1IXB A;  1EM1 A;  1EN6 A;  2CE4 A;  3AK1 A;  1MSD A;  1LUW A;  3C3T A;  3KKY A;  2P4K A;  3OT7 A;  1IX9 A;  1JR9 A;  1ZTE A;  1AR4 A;  4E4E A;  3KDR A;  1GN2 A;  1ZSP A;  5AG2 A;  1BSM A;  1MMM A;  4YIP A;  1I08 A;  3LSU A;  3DC6 A;  3DC5 A;  2QKC A;  2QKA A;  2RCV A;  1PM9 A;  3CEI A;  1BS3 A;  1I0H A;  1GN6 A;  1D5N A;  1ZLZ A;  3C3S A;  1MA1 A;  5A9G A;  1Y67 A;  4JYY A;  4X9Q A;  1WB8 A;  1N0N A;  1PL4 A;  4JZG A;  1XRE A;  1WB7 A;  1ZUQ A;  1BT8 A;  1AVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...