1JR9A

Crystal structure of manganese superoxide dismutases from bacillus halodenitrificans
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
201
Chain Sequence
b'KFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNGALEGHEDLKNKSLNDLISNLDAVPENIRTAVRNNGGGHANHSLFWKLMSPNGGGKPTGEVADKINDKYGSFEKFQEEFAAAAAGRFGSGWAWLVVNNGEIEIMSTPIQDNPLMEGKKPILGLDVWEHAYYLKYQNKRPDYISAFWNVVNWDEVAAQYSQAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords manganese superoxide dismutase
publication title Three-dimensional structure of manganese superoxide dismutase from Bacillus halodenitrificans, a component of the so-called "green protein".
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 56
structure length 201
sequence length 201
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1jr9A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1jr9A02
2CDYA 2QKCA 1KKCA 1I08A 3K9SA 3MDSA 1JR9A 1Y67A 2CE4A 1SZXA 1XREA 1MA1A 4JYYA 3DC5A 3CEIA 1ZUQA 1EM1A 1MMMA 3AK3A 3AK2A 3DC6A 3EVKA 1N0NA 5AG2A 1WB8A 2ADQB 4JZ2A 2AW9A 1P7GA 4E4EA 4BR6A 1WB7A 1JA8A 1D5NA 1AVMA 3C3SA 1EN5A 3IC9A 4X9QA 1QNMA 1PL4A 1GN6A 1ZTEA 4JZGA 3BFRA 3RN4A 2QKAA 3OT7A 1LUWA 1GN2A 1XDCA 1MNGA 1VARA 3LSUA 4YIPA 1BSMA 1GN4A 2ADPA 1AR5A 1AP5A 5A9GA 1ZSPA 4F6EA 3TJTA 1MSDA 3C3TA 1GN3A 1AR4A 1I0HA 3QVNA 1XILA 1EN4A 2RCVA 1B06A 2P4KA 4FFKA 4YIOA 3AK1A 3KKYA 1ZLZA 4GUNA 1IX9A 2GDSA 1VEWA 1BS3A 1EN6A 1LUVA 1BT8A 1IDSA 4C7UA 1XUQA 1IXBA 1AP6A 1PM9A 1N0JA
chains in the Genus database with same CATH superfamily
1KKCA 3RBZA 5B5EZ 1K5QA 1QR8A 2IH3C 3MDSA 3ZN0A 2ODMA 3ZEDA 4ICGA 2YI8A 2QSAA 4X20B 4JI7O 4UV9A 1AI7A 5L3GA 5LGUA 5LMUO 2YIBD 2QA4V 5E79Z 3BY6A 5LMUB 2X6AA 4X62B 2WAMA 4WFHA 3RYFA 5D5QA 3ZBHA 1H8HG 1NVPB 1IXMA 4O4HB 4UCTA 1JMKC 2ZM6O 3G67A 1YTFD 2ZE8A 1IZ3A 1FXHA 3VQVA 3ETGA 2P7TC 2ZM6B 3C3SA 3ZHUA 2VS0A 1R1BA 4YHHO 5LYJB 3SYCA 4TV8A 3A8TA 3CCQV 4YHHB 5KX5A 2LO1A 3N2KB 4CBCA 1YJWV 2EILC 3J81N 3BRCA 4X1KA 4O4IB 2CTPA 1M56B 5HFLA 4LFAB 3A0BZ 5JWPA 3ASOC 2Q7GA 1QLEC 4ZOLA 2EIJB 5GTIZ 4LF6O 4WFBV 2F4VO 5IJ0B 3MHHC 1S5HC 1R6TA 3M8AA 4LF6B 1M57B 3LDDA 2A7WA 3UQ8A 2F4VB 4DV4O 2NLJC 1JFFA 1NTMH 4JTAB 1BMFG 3CCSV 1QLNA 3MHSC 4CH3A 2EIKC 4P9OA 3JALA 1V54B 4DV7O 2H3OA 4I9QA 2GUZA 3WG7B 4DV7B 3K58A 1D5AA 1Q5OA 1N34O 5FL7G 4UCSA 1YJNV 4JI2O 3K9SA 3P3NA 3R66A 1N34B 3STZC 4JI2B 1M93A 4GX1A 3E8FA 3J80N 4R6ZA 3G80A 4GCZA 2Q68A 5L3DA 2O57A 1R3KC 1YXBA 1K34A 4MTOA 5GONA 1JPXA 3S3XA 3Q4HB 5CA1A 1P7GA 4E4EA 4MTXA 4DK0A 4O4LB 4YJ2A 2R9RB 1K3EA 4X9QA 2XASA 3K0DA 4I55A 4DV5B 1YJ9V 2NNUA 2JGUA 1HNZB 3H1HH 1JQ0A 1GM8A 4IIJB 4H44B 2KKWA 5FPRA 2IH1C 4R7CA 1VF6A 1KU9A 4NTXA 2R70A 3KG2A 4OX9O 2XAJA 5JVDB 4OX9B 3SYOA 4F6EA 1Q6IA 4X89A 3CRRA 4UVAA 3ABLB 2X6CA 1SQXH 4PD4F 2Z0AA 4U3JA 4MS2A 1GMGA 3ABMC 3JAWA 1VQ9V 2YIAA 1DF5A 1H2KA 3APQA 3CRMA 5EIBD 1OZ0A 4TV9A 2QWOB 2QJ1A 5EZYB 4PV1B 3VQWA 3CCUV 4WBNB 4DR1O 2E74B 1L8DA 4NR1A 4CS2A 1VF6C 1IBMO 4DR1B 2E5LO 3RYCB 1IBMB 1VQ6V 4NXNO 5KHKA 1I08A 2E5LB 4UXNA 3KCXA 3ZMZA 4NXNB 5J2UB 3ZMSA 2VRZA 3AEIA 1AJPA 4LFBB 2JDIG 3CCLV 2L6LA 1N8RW 2XOKG 1BGYH 3JD0A 3NXSA 4X1YA 2JRIA 3AK3A 5H6RA 5AG2A 1WB8A 1MG1A 4FLUA 1BHAA 4ZBMA 4BIOA 3HKEA 2PI4A 2Q69A 1PL0A 1HP8A 1U97A 1V55B 4ASUG 4HAMA 4K0KO 4GZRB 2H94A 3OMNB 4LWSB 1I7FA 1Y76B 1KUQA 3UCSC 4CZZA 2C2AA 3I56V 3OGIB 2IJHA 4EB6A 1H2GA 4NYKA 3RYHA 1AJQA 2UXNA 3OR6C 4LFCO 1IBLO 3AG2C 2JEXA 2EIMB 4FM0A 4JYBA 4AI8A 4BW9A 1IBLB 2K9PA 1RFYA 5JVDA 1DTOA 1TA8A 1MSDA 4UVBA 5LA6A 1OCZC 2OYQA 4B3TB 3FD9A 2HP8A 1B06A 4PJ0Z 3T1HB 3E22B 3N27A 2E3CA 2IJIA 3OFNG 1QCEA 5EBMC 5IJ9A 3QNEA 1GAXA 3CCEV 1M4UA 4JYCA 1GKFA 4U3FH 3OMIB 2M7WA 3SPGA 4TOIA 1K8AW 1NTKH 2IU0A 3H1IH 1TUEB 3TXQA 5F2VO 5L3BA 3EHBB 4DRXB 3UM7A 3G71V 2QM8A 2LGQA 4DR3O 3E8BA 1OCCB 4B3MO 3JARA 2HHHO 2QR4A 1VQOV 3HKBA 4DR3B 4JI6O 2HHHB 4Q6GA 3H9VA 4X1IA 1FXVA 3VQXA 3B40A 4LF8O 1S72V 3DC5A 4LF8B 4LF5O 1MMMA 4UB8Z 4MW3A 4MTFA 1NKDA 1QR9A 3DC6A 3SGIA 3EVKA 1M90W 2VWJA 4DYLA 4I4TA 3U10A 2NN4A 2Q73A 2JGDB 2LW7A 3SYQA 3G6BA 4UUJC 3HKDB 3QF7A 2YXYA 3IC9A 4FLZA 5IYBO 3L75H 4DW0A 5KHIA 4WFEA 1I5YA 3ZRWA 3CJHA 3K9AA 3AG1C 1PNLA 4MVZA 4IT5A 3OE7G 4AILC 4B3RO 3IJ4A 4Z1VA 3LSUA 4B3RB 2XAGA 5CN0A 1OV9A 2BTQB 3T1CA 3E35A 1KD1W 4DV0O 4HBNA 3APOA 1GN3A 4GX2A 4BW5A 4PA7A 2KSDA 1PNKA 4DV0B 1H2SB 3G4SV 3ABUA 3OMAB 5C93A 1NBMG 1ENVA 4JTCB 2JJ2G 3GB7C 1SC5B 2ZIOA 3AK1A 1V55C 4I0XA 3SYPA 3EXAA 2VQFO 5LOVA 1WNSA 2HEPA 3QO7A 3L74H 4TQDA 3BVOA 2VQFB 1LUVA 5IYZB 3SPCA 3F7YC 5J9PC 2Y48A 4C7UA 1NZ6A 1Z5WA 3OR7C 1WPBA 1XNQO 1WA8B 1W0JG 1VF5B 1Y66A 4FVMA 2X7RB 4AHCA 4H37A 3B8NA 3JYCA 1SZXA 4LH7A 3OTOO 3SJAC 4JI4O 2PF4E 1PV0A 4JI4B 1BHBA 1KP2A 2AZ0A 5L3FA 2P5OA 4JASA 3D8CA 1JA8A 3WB0A 2V1DA 2WSSG 2X0LA 1P84F 3O65A 3CXCU 3CP1A 5B3SB 1ZX3A 1I94B 1H8EG 2QM4A 3OUFA 4ZHQA 3B09A 3AG3B 3ASOB 2R9IA 3QTCA 2XUMA 1TGOA 1QLEB 4BIUA 2PY5A 3RYFB 3T2MA 3ABTA 3CXHF 2MK3A 1WPXA 1WP8A 5FPOA 4I50A 1XBLA 3SYAA 4TUYA 1I5XA 4DR4B 3BCCH 2EIKB 3ICXA 4TV8B 3TJTA 5KX5B 1AR4A 4DUZO 4X1KB 2Q7EA 1PD3A 3B2EE 1BCCH 3RYIA 1HDJA 3ZRXA 1EN4A 4DUZB 3E2EA 2OIGA 1IX9A 3FB7C 3K3WA 2JVDA 4ZOLB 4GYCB 5GTHZ 1NR7A 1VQ7V 3JASA 3I55V 2AXTZ 1WJZA 4Z2WA 1K92A 1PM9A 1N0JA 1JFFB 2ITCC 4PDVA 3E83A 1SRYA 3RWRD 4WFGA 5JQGA 1E79G 2WWWA 1VQPV 2ZE6A 5KA5A 3JALB 1H2LA 2W6JG 4FZ0A 2GUZB 1SESA 1ZAUA 3EFFK 2B9ZA 4LCUC 3ZIAG 4UCVA 1ZWIC 2AW9A 3NR7A 4CH6A 4UVCA 4IHJA 1S77D 2W0XA 5LP6B 1Q43A 3CRAA 4PA6A 4JPRA 2FKXA 1EBOA 4NVPA 4FK5C 1PL4A 3K5LA 4X62O 1MZFA 3CCRV 1OHHG 1S0VA 5GONB 1NI8A 1R73A 2CGNA 2WLJA 4DW1A 5CA1B 2JS3A 2XNDG 3H1JH 4N23A 2QWNB 1XDCA 3ABMB 4FZ1A 1T5EA 3QO5A 3CD6V 2EJRA 1GN4A 4YJ2B 2PYLA 5BMVA 1SKVA 2Q0AA 4I55B 1NT2B 2PI5A 3QG5A 3M7MX 4E2LA 3JCUZ 4J9YB 3RVZA 2OT5A 3D36A 4FLTA 1BQ0A 2RCVA 4AQYO 4LFAO 4FFKA 4AQYB 5B3SC 2EINC 2P4VA 2DYRC 1NS1A 2Q8VA 3AG3C 5FNVA 1WAZA 1M9NA 3RFRA 3UKMA 3AG7A 2VWKA 2ETNA 3E89A 2HVKC 4U3JB 4J9ZB 2JS5A 3JAWB 2LFRA 1CEZA 2WA4A 2R9AA 2IJKA 4TV9B 3QO8A 2LP7A 4GT1A 3CCVV 4MVSA 5LXTA 3D36C 3CEIA 1ZUQA 3SJQC 5B1OA 4B7EA 3BABA 1K73W 1LNQA 5DN6G 3W7WA 3RVYA 2WLKA 2EZPA 2AHYA 5J2TA 5JJJB 1GM7A 4ZIBA 3K59A 3OM3B 5LP6A 2XAHA 4KP4A 3AG2B 3K04A 4X1YB 1NQTA 1IURA 2QM7A 4DR7O 1SA0A 3BFRA 3JSLA 3K0GA 3JSNA 1OCZB 4DR7B 2YEVA 1SZTA 3HKEB 2CTWA 4YIPA 1YITV 2FB5A 2KG7A 4F6RA 4DV5O 5LMNO 1HNZO 4LR3A 1AP5A 2UXBO 3H1KH 1G8MA 5LMNB 5IYCO 4TQFA 2WLIA 3IGAC 5IE9A 2UXBB 4O4JA 2FL4A 1Q6UA 3RT3C 4KXRA 1QVFU 1FAFA 2YICA 1FPOA 4EB6B 3RYHB 3CB2A 1SQFA 5LP6C 3UO3A 2YDEA 1JJOA 3ZRSA 1NH2B 2Q4PA 1F4NA 5D5PA 4RO2A 5LA6B 2UUAO 5DECA 2HR3A 2UUAB 1S5LZ 3H01A 4OPHA 1S5JA 4H33A 4XDJA 2V7QG 1Z2GA 2G38A 2PYJA 5IJ9B 1OCRC 4JYYA 1RP3B 4J7JA 4ZKIA 5B66Z 3A0RA 4DUYB 2DQ0A 1SS3A 3JARB 4DK1A 2ADQB 1RSOA 3HKBB 4JI0O 3AG1B 4LFBO 4X1IB 4JI0B 3ZMTA 2CUGA 4JI1O 1VQ4V 1G1XB 4H13B 2UXXA 2UXCO 4U7NA 1GRJA 4JI1B 2K1EA 2UXCB 3IC7A 4MVUA 5H2FZ 1DGSA 1LR1A 1SQVH 4I4TB 2F43G 2ZE5A 2MW2B 3L73H 1NU1H 5B1AB 4X8AA 5H6QA 5HFMA 1WP7A 5B1BC 3K79A 1ZSPA 3SJCC 1VQNV 2CH7A 2RQ6A 2JIZG 4DR6O 2UUBB 4QPKA 2PGGA 3P30A 3D3IA 3JCZA 4RWUA 4DR6B 3SPHA 1AI6A 3CJHB 3RW0A 3ZRWB 3ZHSA 4LF4B 1KYOF 4L87A 4N21A 2JEUA 1XL4A 1Q7YW 1Q3EA 1O9GA 3THOA 1SETA 2DN9A 2QDOA 2OWOA 4B3TO 1VQ8V 5KHGA 1PPJH 4B08A 3SDLA 4A5UB 3SPJA 2N04A 2PZSA 3T1HO 4X88A 4I0XB 1B3QA 1Q86W 3HB3B 4FJCC 5KMGA 5LOVB 2UXDB 2IBZH 2A3QA 2CE4A 5IWAO 1TUBA 3TXSA 4ZI7A 3G6EV 1MA1A 3SPIA 5IWAB 3DSQA 1SQPH 3M99B 3OAAG 2XTAA 1NVPD 1N0NA 2F1MA 3FFQA 4CC6A 3CRQA 3LSQA 4RUEA 4JZ2A 4H0LB 4QNHB 3LSSA 4HYOA 4DR2O 1F4MA 1VQKV 1Y74A 1PKXA 4DR2B 2DJVA 5K1PA 1ZTEA 1E1RG 3K5OA 4W4LA 1Q82W 2QKAA 4DR5B 2LFSA 4NKGB 5EBLC 2UUCB 4MVMA 3CC2V 1Y4MA 1MSWD 3E8GA 3PN1A 3N2GA 2ATKC 1Q8IA 4ZHQB 1UPGA 3K5NA 1Y6XA 2Q67A 2D2CB 3CHXA 5H5NA 4OXSA 4O2BA 2VQEO 4YIOA 2BOCC 2VQEB 2GBOA 3AG4B 2DYSB 4I50B 4JGSA 3A2FA 4TUYB 1R3JC 1R6KA 1H5WA 2EULA 5L3CA 2QWRB 2WLNA 1YCIA 1WLEA 4D7SA 4X65O 4FLWA 5BZBA 1DK1A 2N05A 3RYIB 1BL8A 4X65B 1PP9H 2A0LA 2WLLA 4F4LA 2FYUH 5B1AC 4J7ZA 1P49A 2RNBA 3BPZA 4WFFA 3FAVA 1FFXA 3CCMV 2HVJC 2LW1A 5JCOA 3PJSK 4IL6Z 4QGPA 4RAIA 3JASB 2Q7HA 4CS4A 3CC4V 4Q20A 2DOSA 2YIBA 1M5IA 4TSFG 3OTFA 4PI0A 2ZCEA 2ZE7A 2ZD9A 2WLMA 5IDJA 2ZKOA 2BCCH 5JQGB 2ZINA 4RUFA 1XMQB 4IYIA 1AVMA 2B1GA 2CGOA 2HJFC 1HNWO 3CRCA 4O2AA 4PDLA 2DMXA 1CP9A 1HNWB 1N36O 1XNRO 2ZXWB 4FLVA 3W7XA 3JAKA 1N36B 2XT9A 1XNRB 3RN4A 4JI8O 4LF7B 1BE3H 3JATA 5JJEB 4BIZA 5BXZA 1G6UA 3K06A 4JI8B 4IHJB 1MNGA 1NH2D 4J42A 2IM9A 5KHJA 2HKOA 1KC8W 1KKDA 2ADPA 3ETDA 1I94O 2Z3YA 5A9GA 4OGQB 5CA0A 2Y4TA 1P7BA 2EINB 2B5UA 2IW5A 3JD2A 2DYRB 4L8JA 3DXRA 1QU7A 1G4YB 3QVNA 3ZJZA 3CS5A 4PDRA 1QHTA 2IJJA 1L0NH 4GUNA 2ZT9B 1HWYA 1UJWB 2GDSA 5BMVB 4RQFA 4YXWG 1NTZH 4DR4O 4P30A 3U11A 2OTJV 2DW4A 3X2QC 1URFA 2BSKA 3L9DA 1M1KW 4IYHA 4FM2A 5K1XA 3ZN1A 2Y0IA 3JD4A 3W7TA 5FNVB 2EX3A 5GW7A 5L3EA 4JYAB 2OCCC 5JH7A 4UCRA 4JAAA 1B6QA 1EM1A 5EC1C 1YIJV 3AK2A 2Q9LA 2Q6AA 2XAQA 4MVQA 4K35A 4LC1A 3AG4C 2DYSC 4DV3B 3VBBA 2GTAA 4BR6A 1WB7A 5CA3A 5LBQA 2QGNA 1AI4A 3LDEA 1EN5A 2D3OW 5LXTB 5CB4A 1CPYA 4KUMA 4LBEC 3ETEA 1TVKA 4XDLA 1EZJA 4PA3A 2X6BA 1MOFA 3OEEG 1VF7A 2E76B 5J2TB 1GN2A 4XDKA 2WA3A 2KQXA 4QIWF 1YSCA 1XHZA 3W7SA 2ZDIA 2EZOA 4FFBA 3ZHVA 3OW2U 4KL1A 5EYPA 3ZMUA 5IY5B 1SA0B 3UO2A 2YSUB 4MVOA 4HNAA 3E8HA 2XHBA 2DWDC 3T4ZA 2EBOA 2YEVB 3CC7V 3KKYA 1RM1B 4LNUA 1ZLZA 2KG7B 3ML0A 4F6RB 3L70H 1ZL8A 2YI9A 3UT5A 1U96A 3ETQA 1W0KG 4JI7B 1OCOC 2P90A 2ZXWC 2WLIB 4O4JB 4K3AA 1OCRB 3ZS8C 1UFIA 3ZHTA 5A2QN 3LNMB 2QWQB 3S3WA 2ZDIC 4CS3A 1JR9A 1TAEA 4YJ3A 2WLHA 1GH6A 5C8YA 4R8CA 1MABG 3L72H 3C90A 4XBFA 2YXHA 4NB5A 3T4DA 2ZNIA 5EIBC 2FMLA 1HW7A 1D5NA 2ITDC 4UCOA 3P3PA 3D3QA 5LL6Y 4MW8A 2XAFA 2F23A 4GX5A 2AHZA 4TT3G 1FXKA 4FIPC 3RGBA 5CBGA 5KUMA 5B1BB 1GO3F 1COWG 1GN6A 5KUKA 1FYJA 5CBHA 2Y69B 2ZNJA 2OTLV 3HKCA 1RPOA 1RSOB 4DV4B 1X4TA 1KMIZ 4J7KA 3R65A 3CE2A 3P32A 4WF9V 5LHGA 2CTQA 1IVSA 5DM6V 1THZA 4QPJA 3ZHRA 3LNNA 3ASNC 5IYDO 5ITZA 1F7YA 4PELA 4YY3O 2RDCA 3OUSA 2BE3A 4MT8A 1YF2A 2DQ3A 1YDXA 4YY3B 1E1QG 4PA9A 3I5DA 1FXKC 4X20A 4RQEA 4DV1O 5KAFZ 4JAUA 1IJGA 4CH5A 2RMKB 3FB5C 2RJZA 3DTUB 2IU3A 2CH7B 1K9MW 4DV1B 5KAIZ 3DGEA 3GWKC 4WFAV 1JCHA 1XUQA 3VQYA 1YVWA 3K03A 2L35A 4QE9A 2QKCA 3HR0A 4O4HA 5E1AC 2EJ7A 4PDMA 4BWAA 1BQZA 1VMGA 2ZR2A 2LJ2A 2PUSA 1X59A 1VQ5V 3K08A 5IY5C 5LYJA 4GKKO 1KP3A 3SR2C 3N2KA 4GKKB 3GWOA 4OPAA 5FLXN 1YHQV 2PTMA 4O4IA 1RM1C 3F5WC 1N33O 5BY1A 3J7AU 3BA8A 2H8PC 1FKAO 5KMGB 1B04A 1VIBA 1N33B 5DEDA 1TUBB 1L1FA 1W59A 4UCUA 4ZI7B 2YIDA 3ZRVA 5LGTA 1XEQA 4CH4A 5KA6A 3H1LH 3L71H 5IJ0A 4DUYO 2QTSA 1AI5A 4MVRA 3KDRA 2ILMA 3JD3A 1AB3A 1LUWA 2NR5A 1KECA 3BAAA 3SJBC 1VARA 4TWKA 1K5SA 1SQGA 1KBHA 4KFMA 1CXZB 1VQMV 2F93B 3F7VC 1Y74B 3LDCA 2BOBC 2QEXV 4DV2O 2FTKA 1O9HA 3MD0A 4FLXA 2R72A 3C3TA 4DV2B 1K4DC 1M56C 3O9OA 2ZIMA 2LQTA 5KHHA 2DWEC 2GHYA 1OJHA 2P4KA 3ZCCA 1YZBA 3ZX6A 2EIJC 2A79B 4I7ZB 3N2GB 2E75B 1XL6A 3KCYA 2UUBO 2N74A 1M57C 1BT8A 4B7KA 3FYEB 2Y69C 2KB1A 3U0ZA 2W6IG 4LF4O 3ABKB 1K33A 1Q81W 4O2BB 3TK1A 4K8ZA 4JF3A 2GTSA 2P22C 4JI3O 3F5TA 3Q4HA 3BEHA 1IBKO 1F23A 4JI3B 5EC2C 4X66O 3WB2A 1V54C 4W4KA 2RN9A 1IBKB 2UU9O 4O4LA 4X66B 3WG7C 1XHXA 2F66C 2P67A 2UU9B 4K0KB 2BTOA 1KB9F 3FB6C 3CX5F 1S3JA 4IIJA 2WLLB 4DO2A 1P4RA 2YUAA 1XI1A 2UXDO 1EFRG 2OCHA 4GKJO 2P06A 3FAVB 1FFXB 2ARHA 2CK3G 2WPDG 1D2DA 1SQBH 4LFCB 4GKJB 3FX7A 1AILA 4DXWA 1EZVH 3LUTB 1QBZA 1HNXO 4UB6Z 3B77A 3STLC 3W7UA 1HNXB 1GM9A 1JVMA 4U7OA 1YTFB 3B4SA 2YXLA 1AR5A 4O2AB 1GTOA 1R6NA 4LH6A 3E86A 2DE0X 5LHIA 5EZYA 1FS0G 4QJFB 4WBNA 3JAKB 4DR5O 1PNMA 1VQLV 3X2QB 1XILA 3JATB 3RYCA 4R50A 1K97A 4FMTA 2UUCO 4B3MB 1FJGO 2B1IA 1VEWA 5J2UA 4B3SO 2CAZC 1Q6HA 4JI6B 1QQCA 1K7DA 1FJGB 1N32O 5CA0B 1BS3A 1EN6A 3ABLC 4B3SB 3TCUA 2AGAA 4EKWA 1N32B 3DXRB 1BZKA 4EFEA 1ROPA 1IXBA 2OCCB 4KHPO 4LF5B 4MSWC 2Z5UA 1AP6A 4JV5O 3IFXA 1L0LH 3B8MA 3TETA 1ORQC 2CDYA 4KHPB 4JTDB 1JJ2U 4JV5B 5EBWC 5LHHA 1Y67A 4UV8A 2HFEC 4NXMO 1FFTB 1Q90D 2QKSA 2LGWA 4NXMB 4BAYA 4LWSA 1Y76A 3WU2Z 2BSKB 2YS8A 3BHPA 5LGNA 3KZIZ 1DLBA 5IT9N 1S76D 1JX9A 3BA9A 4EFBA 1SF9A 4QE7A 5JJNB 4EEQA 1QNMA 5JH7B 1R3LC 5BR8O 3OD4A 3ABKC 4JZGA 5BR8B 1AROP 1NJIW 1XQ8A 3OGCC 1VP7A 4JAVA 1SQQH 5EK0A 3OT7A 2HG5C 3FKSG 1J95A 4FPPA 2Y0PA 1XMQO 3E22A 4GLXA 1BSMA 3OEHG 1AJNA 2GSMB 2GV9A 2A9HA 4LP8A 5CB4B 1V9PA 3MAQA 4I9WA 3CWBH 1TVKB 1OCOB 4PA4A 5TISZ 4LF7O 3CPWU 4X64O 3WFVA 3WB1A 4DRXA 4Z1MG 1AR1B 4P9PA 1XNQB 2EIMC 4X64B 1H2MA 5JCOC 2Q0OC 2ZR3A 1N4CA 4IGGA 3CMEV 2M6YA 4FFBB 5EYPB 3OTOB 2Q5ZA 1FD9A 4FLYA 4HNAB 2YC0A 4G28B 2W0FC 4GX0A 1K4CC 4G27B 2EILB 2QWPB 1US6A 2JGDA 4K8XA 4LNUB 3CYOA 1DF4A 4HZ3A 1ZL8B 3UT5B 2QE7G 1MZEA 1XREA 3HKDA 4J11A 1R3IC 2HJDA 1Z5VA 3FYIB 4P2ZA 3ZMVA 3GVMA 1RPRA 1OCCC 5KLVH 1YI2V 2AZ2A 2QTOA 3A0HZ 5H9CA 4D6TH 1FOUA 5CMUA 4J80A 4DV6O 1GK9A 4YJ3B 4CC5A 1KQSU 5CBFA 4NTYA 4PI2A 4I5SA 4UFZA 1H38A 5C8YB 4DV6B 4JYAO 1QVGU 2BTQA 4J41A 2CTRA 2JK5C 2A06H 1SERA 1NR1A 3IAYA 1JOYA 4DV3O 4JI5O 2ZQMA 3ASNB 1WN7A 4JI5B 2Y4UA 3CSXA 3T1YO 4NTWA 3T1YB 3JD1A 3HPLC 1FXKB 5IYZA 4LF9O 5B1NA 4FM1A 4MTGA 3TGUH 2JJ1G 1I0HA 3JAMN 4LF9B 1XOUA 1J5EO 3HKCB 2HLDG 1WA8A 2P6JA 4PHZA 1HR0O 1W2BU 1J5EB 1JNBA 1YEWA 4ABMA 1HR0B 2F95B 4G2KA 3CMAV 3FB8C 1A32A 1XMOO 3VOUA 4WCEV 1F51A 1H2NA 1IDSA 3CCJV 3K5MA 1XMOB 4J10A 3ZHQA 5ITZB 4D7TA 2V4DA 3K57A 2OIEA
chains in the Genus database with same CATH topology
2CDYA 2QKCA 1KKCA 1I08A 3K9SA 3MDSA 1JR9A 1Y67A 2CE4A 1SZXA 1XREA 1MA1A 4JYYA 3DC5A 3CEIA 1ZUQA 1EM1A 1MMMA 3AK3A 3AK2A 3DC6A 3EVKA 1N0NA 5AG2A 1WB8A 2ADQB 4JZ2A 2AW9A 1P7GA 4E4EA 4BR6A 1WB7A 1JA8A 1D5NA 1AVMA 3C3SA 1EN5A 3IC9A 4X9QA 1QNMA 1PL4A 1GN6A 1ZTEA 4JZGA 3BFRA 3RN4A 2QKAA 3OT7A 3KDRA 1LUWA 1GN2A 1XDCA 1MNGA 1VARA 3LSUA 4YIPA 1BSMA 1GN4A 2ADPA 1AR5A 1AP5A 5A9GA 1ZSPA 4F6EA 3TJTA 1MSDA 3C3TA 1GN3A 1AR4A 1I0HA 3QVNA 1XILA 1EN4A 2RCVA 1B06A 2P4KA 4FFKA 4YIOA 3AK1A 3KKYA 1ZLZA 4GUNA 1IX9A 2GDSA 1VEWA 1BS3A 1EN6A 1LUVA 1BT8A 1IDSA 4C7UA 1XUQA 1IXBA 1AP6A 1PM9A 1N0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CDY A;  2QKC A;  1KKC A;  1I08 A;  3K9S A;  3MDS A;  1JR9 A;  1Y67 A;  2CE4 A;  1SZX A;  1XRE A;  1MA1 A;  4JYY A;  3DC5 A;  3CEI A;  1ZUQ A;  1EM1 A;  1MMM A;  3AK3 A;  3AK2 A;  3DC6 A;  3EVK A;  1N0N A;  5AG2 A;  1WB8 A;  2ADQ B;  4JZ2 A;  2AW9 A;  1P7G A;  4E4E A;  4BR6 A;  1WB7 A;  1JA8 A;  1D5N A;  1AVM A;  3C3S A;  1EN5 A;  3IC9 A;  4X9Q A;  1QNM A;  1PL4 A;  1GN6 A;  1ZTE A;  4JZG A;  3BFR A;  3RN4 A;  2QKA A;  3OT7 A;  1LUW A;  1GN2 A;  1XDC A;  1MNG A;  1VAR A;  3LSU A;  4YIP A;  1BSM A;  1GN4 A;  2ADP A;  1AR5 A;  1AP5 A;  5A9G A;  1ZSP A;  4F6E A;  3TJT A;  1MSD A;  3C3T A;  1GN3 A;  1AR4 A;  1I0H A;  3QVN A;  1XIL A;  1EN4 A;  2RCV A;  1B06 A;  2P4K A;  4FFK A;  4YIO A;  3AK1 A;  3KKY A;  1ZLZ A;  4GUN A;  1IX9 A;  2GDS A;  1VEW A;  1BS3 A;  1EN6 A;  1LUV A;  1BT8 A;  1IDS A;  4C7U A;  1XUQ A;  1IXB A;  1AP6 A;  1PM9 A;  1N0J A; 
#chains in the Genus database with same CATH topology
 1KKC A;  3RBZ A;  5B5E Z;  1K5Q A;  1QR8 A;  2IH3 C;  3MDS A;  3ZN0 A;  2ODM A;  3ZED A;  4ICG A;  2YI8 A;  2QSA A;  4X20 B;  4JI7 O;  4UV9 A;  1AI7 A;  5L3G A;  5LGU A;  5LMU O;  2YIB D;  2QA4 V;  5E79 Z;  3BY6 A;  5LMU B;  2X6A A;  4X62 B;  2WAM A;  4WFH A;  3RYF A;  5D5Q A;  3ZBH A;  1H8H G;  1NVP B;  1IXM A;  4O4H B;  4UCT A;  1JMK C;  2ZM6 O;  3G67 A;  1YTF D;  2ZE8 A;  1IZ3 A;  1FXH A;  3VQV A;  3ETG A;  2P7T C;  2ZM6 B;  3C3S A;  3ZHU A;  2VS0 A;  1R1B A;  4YHH O;  5LYJ B;  3SYC A;  4TV8 A;  3A8T A;  3CCQ V;  4YHH B;  5KX5 A;  2LO1 A;  3N2K B;  4CBC A;  1YJW V;  2EIL C;  3J81 N;  3BRC A;  4X1K A;  4O4I B;  2CTP A;  1M56 B;  5HFL A;  4LFA B;  3A0B Z;  5JWP A;  3ASO C;  2Q7G A;  1QLE C;  4ZOL A;  2EIJ B;  5GTI Z;  4LF6 O;  4WFB V;  2F4V O;  5IJ0 B;  3MHH C;  1S5H C;  1R6T A;  3M8A A;  4LF6 B;  1M57 B;  3LDD A;  2A7W A;  3UQ8 A;  2F4V B;  4DV4 O;  2NLJ C;  1JFF A;  1NTM H;  4JTA B;  1BMF G;  3CCS V;  1QLN A;  3MHS C;  4CH3 A;  2EIK C;  4P9O A;  3JAL A;  1V54 B;  4DV7 O;  2H3O A;  4I9Q A;  2GUZ A;  3WG7 B;  4DV7 B;  3K58 A;  1D5A A;  1Q5O A;  1N34 O;  5FL7 G;  4UCS A;  1YJN V;  4JI2 O;  3K9S A;  3P3N A;  3R66 A;  1N34 B;  3STZ C;  4JI2 B;  1M93 A;  4GX1 A;  3E8F A;  3J80 N;  4R6Z A;  3G80 A;  4GCZ A;  2Q68 A;  5L3D A;  2O57 A;  1R3K C;  1YXB A;  1K34 A;  4MTO A;  5GON A;  1JPX A;  3S3X A;  3Q4H B;  5CA1 A;  1P7G A;  4E4E A;  4MTX A;  4DK0 A;  4O4L B;  4YJ2 A;  2R9R B;  1K3E A;  4X9Q A;  2XAS A;  3K0D A;  4I55 A;  4DV5 B;  1YJ9 V;  2NNU A;  2JGU A;  1HNZ B;  3H1H H;  1JQ0 A;  1GM8 A;  4IIJ B;  4H44 B;  2KKW A;  5FPR A;  2IH1 C;  4R7C A;  1VF6 A;  1KU9 A;  4NTX A;  2R70 A;  3KG2 A;  4OX9 O;  2XAJ A;  5JVD B;  4OX9 B;  3SYO A;  4F6E A;  1Q6I A;  4X89 A;  3CRR A;  4UVA A;  3ABL B;  2X6C A;  1SQX H;  4PD4 F;  2Z0A A;  4U3J A;  4MS2 A;  1GMG A;  3ABM C;  3JAW A;  1VQ9 V;  2YIA A;  1DF5 A;  1H2K A;  3APQ A;  3CRM A;  5EIB D;  1OZ0 A;  4TV9 A;  2QWO B;  2QJ1 A;  5EZY B;  4PV1 B;  3VQW A;  3CCU V;  4WBN B;  4DR1 O;  2E74 B;  1L8D A;  4NR1 A;  4CS2 A;  1VF6 C;  1IBM O;  4DR1 B;  2E5L O;  3RYC B;  1IBM B;  1VQ6 V;  4NXN O;  5KHK A;  1I08 A;  2E5L B;  4UXN A;  3KCX A;  3ZMZ A;  4NXN B;  5J2U B;  3ZMS A;  2VRZ A;  3AEI A;  1AJP A;  4LFB B;  2JDI G;  3CCL V;  2L6L A;  1N8R W;  2XOK G;  1BGY H;  3JD0 A;  3NXS A;  4X1Y A;  2JRI A;  3AK3 A;  5H6R A;  5AG2 A;  1WB8 A;  1MG1 A;  4FLU A;  1BHA A;  4ZBM A;  4BIO A;  3HKE A;  2PI4 A;  2Q69 A;  1PL0 A;  1HP8 A;  1U97 A;  1V55 B;  4ASU G;  4HAM A;  4K0K O;  4GZR B;  2H94 A;  3OMN B;  4LWS B;  1I7F A;  1Y76 B;  1KUQ A;  3UCS C;  4CZZ A;  2C2A A;  3I56 V;  3OGI B;  2IJH A;  4EB6 A;  1H2G A;  4NYK A;  3RYH A;  1AJQ A;  2UXN A;  3OR6 C;  4LFC O;  1IBL O;  3AG2 C;  2JEX A;  2EIM B;  4FM0 A;  4JYB A;  4AI8 A;  4BW9 A;  1IBL B;  2K9P A;  1RFY A;  5JVD A;  1DTO A;  1TA8 A;  1MSD A;  4UVB A;  5LA6 A;  1OCZ C;  2OYQ A;  4B3T B;  3FD9 A;  2HP8 A;  1B06 A;  4PJ0 Z;  3T1H B;  3E22 B;  3N27 A;  2E3C A;  2IJI A;  3OFN G;  1QCE A;  5EBM C;  5IJ9 A;  3QNE A;  1GAX A;  3CCE V;  1M4U A;  4JYC A;  1GKF A;  4U3F H;  3OMI B;  2M7W A;  3SPG A;  4TOI A;  1K8A W;  1NTK H;  2IU0 A;  3H1I H;  1TUE B;  3TXQ A;  5F2V O;  5L3B A;  3EHB B;  4DRX B;  3UM7 A;  3G71 V;  2QM8 A;  2LGQ A;  4DR3 O;  3E8B A;  1OCC B;  4B3M O;  3JAR A;  2HHH O;  2QR4 A;  1VQO V;  3HKB A;  4DR3 B;  4JI6 O;  2HHH B;  4Q6G A;  3H9V A;  4X1I A;  1FXV A;  3VQX A;  3B40 A;  4LF8 O;  1S72 V;  3DC5 A;  4LF8 B;  4LF5 O;  1MMM A;  4UB8 Z;  4MW3 A;  4MTF A;  1NKD A;  1QR9 A;  3DC6 A;  3SGI A;  3EVK A;  1M90 W;  2VWJ A;  4DYL A;  4I4T A;  3U10 A;  2NN4 A;  2Q73 A;  2JGD B;  2LW7 A;  3SYQ A;  3G6B A;  4UUJ C;  3HKD B;  3QF7 A;  2YXY A;  3IC9 A;  4FLZ A;  5IYB O;  3L75 H;  4DW0 A;  5KHI A;  4WFE A;  1I5Y A;  3ZRW A;  3CJH A;  3K9A A;  3AG1 C;  1PNL A;  4MVZ A;  4IT5 A;  3OE7 G;  4AIL C;  4B3R O;  3IJ4 A;  4Z1V A;  3LSU A;  4B3R B;  2XAG A;  5CN0 A;  1OV9 A;  2BTQ B;  3T1C A;  3E35 A;  1KD1 W;  4DV0 O;  4HBN A;  3APO A;  1GN3 A;  4GX2 A;  4BW5 A;  4PA7 A;  2KSD A;  1PNK A;  4DV0 B;  1H2S B;  3G4S V;  3ABU A;  3OMA B;  5C93 A;  1NBM G;  1ENV A;  4JTC B;  2JJ2 G;  3GB7 C;  1SC5 B;  2ZIO A;  3AK1 A;  1V55 C;  4I0X A;  3SYP A;  3EXA A;  2VQF O;  5LOV A;  1WNS A;  2HEP A;  3QO7 A;  3L74 H;  4TQD A;  3BVO A;  2VQF B;  1LUV A;  5IYZ B;  3SPC A;  3F7Y C;  5J9P C;  2Y48 A;  4C7U A;  1NZ6 A;  1Z5W A;  3OR7 C;  1WPB A;  1XNQ O;  1WA8 B;  1W0J G;  1VF5 B;  1Y66 A;  4FVM A;  2X7R B;  4AHC A;  4H37 A;  3B8N A;  3JYC A;  1SZX A;  4LH7 A;  3OTO O;  3SJA C;  4JI4 O;  2PF4 E;  1PV0 A;  4JI4 B;  1BHB A;  1KP2 A;  2AZ0 A;  5L3F A;  2P5O A;  4JAS A;  3D8C A;  1JA8 A;  3WB0 A;  2V1D A;  2WSS G;  2X0L A;  1P84 F;  3O65 A;  3CXC U;  3CP1 A;  5B3S B;  1ZX3 A;  1I94 B;  1H8E G;  2QM4 A;  3OUF A;  4ZHQ A;  3B09 A;  3AG3 B;  3ASO B;  2R9I A;  3QTC A;  2XUM A;  1TGO A;  1QLE B;  4BIU A;  2PY5 A;  3RYF B;  3T2M A;  3ABT A;  3CXH F;  2MK3 A;  1WPX A;  1WP8 A;  5FPO A;  4I50 A;  1XBL A;  3SYA A;  4TUY A;  1I5X A;  4DR4 B;  3BCC H;  2EIK B;  3ICX A;  4TV8 B;  3TJT A;  5KX5 B;  1AR4 A;  4DUZ O;  4X1K B;  2Q7E A;  1PD3 A;  3B2E E;  1BCC H;  3RYI A;  1HDJ A;  3ZRX A;  1EN4 A;  4DUZ B;  3E2E A;  2OIG A;  1IX9 A;  3FB7 C;  3K3W A;  2JVD A;  4ZOL B;  4GYC B;  5GTH Z;  1NR7 A;  1VQ7 V;  3JAS A;  3I55 V;  2AXT Z;  1WJZ A;  4Z2W A;  1K92 A;  1PM9 A;  1N0J A;  1JFF B;  2ITC C;  4PDV A;  3E83 A;  1SRY A;  3RWR D;  4WFG A;  5JQG A;  1E79 G;  2WWW A;  1VQP V;  2ZE6 A;  5KA5 A;  3JAL B;  1H2L A;  2W6J G;  4FZ0 A;  2GUZ B;  1SES A;  1ZAU A;  3EFF K;  2B9Z A;  4LCU C;  3ZIA G;  4UCV A;  1ZWI C;  2AW9 A;  3NR7 A;  4CH6 A;  4UVC A;  4IHJ A;  1S77 D;  2W0X A;  5LP6 B;  1Q43 A;  3CRA A;  4PA6 A;  4JPR A;  2FKX A;  1EBO A;  4NVP A;  4FK5 C;  1PL4 A;  3K5L A;  4X62 O;  1MZF A;  3CCR V;  1OHH G;  1S0V A;  5GON B;  1NI8 A;  1R73 A;  2CGN A;  2WLJ A;  4DW1 A;  5CA1 B;  2JS3 A;  2XND G;  3H1J H;  4N23 A;  2QWN B;  1XDC A;  3ABM B;  4FZ1 A;  1T5E A;  3QO5 A;  3CD6 V;  2EJR A;  1GN4 A;  4YJ2 B;  2PYL A;  5BMV A;  1SKV A;  2Q0A A;  4I55 B;  1NT2 B;  2PI5 A;  3QG5 A;  3M7M X;  4E2L A;  3JCU Z;  4J9Y B;  3RVZ A;  2OT5 A;  3D36 A;  4FLT A;  1BQ0 A;  2RCV A;  4AQY O;  4LFA O;  4FFK A;  4AQY B;  5B3S C;  2EIN C;  2P4V A;  2DYR C;  1NS1 A;  2Q8V A;  3AG3 C;  5FNV A;  1WAZ A;  1M9N A;  3RFR A;  3UKM A;  3AG7 A;  2VWK A;  2ETN A;  3E89 A;  2HVK C;  4U3J B;  4J9Z B;  2JS5 A;  3JAW B;  2LFR A;  1CEZ A;  2WA4 A;  2R9A A;  2IJK A;  4TV9 B;  3QO8 A;  2LP7 A;  4GT1 A;  3CCV V;  4MVS A;  5LXT A;  3D36 C;  3CEI A;  1ZUQ A;  3SJQ C;  5B1O A;  4B7E A;  3BAB A;  1K73 W;  1LNQ A;  5DN6 G;  3W7W A;  3RVY A;  2WLK A;  2EZP A;  2AHY A;  5J2T A;  5JJJ B;  1GM7 A;  4ZIB A;  3K59 A;  3OM3 B;  5LP6 A;  2XAH A;  4KP4 A;  3AG2 B;  3K04 A;  4X1Y B;  1NQT A;  1IUR A;  2QM7 A;  4DR7 O;  1SA0 A;  3BFR A;  3JSL A;  3K0G A;  3JSN A;  1OCZ B;  4DR7 B;  2YEV A;  1SZT A;  3HKE B;  2CTW A;  4YIP A;  1YIT V;  2FB5 A;  2KG7 A;  4F6R A;  4DV5 O;  5LMN O;  1HNZ O;  4LR3 A;  1AP5 A;  2UXB O;  3H1K H;  1G8M A;  5LMN B;  5IYC O;  4TQF A;  2WLI A;  3IGA C;  5IE9 A;  2UXB B;  4O4J A;  2FL4 A;  1Q6U A;  3RT3 C;  4KXR A;  1QVF U;  1FAF A;  2YIC A;  1FPO A;  4EB6 B;  3RYH B;  3CB2 A;  1SQF A;  5LP6 C;  3UO3 A;  2YDE A;  1JJO A;  3ZRS A;  1NH2 B;  2Q4P A;  1F4N A;  5D5P A;  4RO2 A;  5LA6 B;  2UUA O;  5DEC A;  2HR3 A;  2UUA B;  1S5L Z;  3H01 A;  4OPH A;  1S5J A;  4H33 A;  4XDJ A;  2V7Q G;  1Z2G A;  2G38 A;  2PYJ A;  5IJ9 B;  1OCR C;  4JYY A;  1RP3 B;  4J7J A;  4ZKI A;  5B66 Z;  3A0R A;  4DUY B;  2DQ0 A;  1SS3 A;  3JAR B;  4DK1 A;  2ADQ B;  1RSO A;  3HKB B;  4JI0 O;  3AG1 B;  4LFB O;  4X1I B;  4JI0 B;  3ZMT A;  2CUG A;  4JI1 O;  1VQ4 V;  1G1X B;  4H13 B;  2UXX A;  2UXC O;  4U7N A;  1GRJ A;  4JI1 B;  2K1E A;  2UXC B;  3IC7 A;  4MVU A;  5H2F Z;  1DGS A;  1LR1 A;  1SQV H;  4I4T B;  2F43 G;  2ZE5 A;  2MW2 B;  3L73 H;  1NU1 H;  5B1A B;  4X8A A;  5H6Q A;  5HFM A;  1WP7 A;  5B1B C;  3K79 A;  1ZSP A;  3SJC C;  1VQN V;  2CH7 A;  2RQ6 A;  2JIZ G;  4DR6 O;  2UUB B;  4QPK A;  2PGG A;  3P30 A;  3D3I A;  3JCZ A;  4RWU A;  4DR6 B;  3SPH A;  1AI6 A;  3CJH B;  3RW0 A;  3ZRW B;  3ZHS A;  4LF4 B;  1KYO F;  4L87 A;  4N21 A;  2JEU A;  1XL4 A;  1Q7Y W;  1Q3E A;  1O9G A;  3THO A;  1SET A;  2DN9 A;  2QDO A;  2OWO A;  4B3T O;  1VQ8 V;  5KHG A;  1PPJ H;  4B08 A;  3SDL A;  4A5U B;  3SPJ A;  2N04 A;  2PZS A;  3T1H O;  4X88 A;  4I0X B;  1B3Q A;  1Q86 W;  3HB3 B;  4FJC C;  5KMG A;  5LOV B;  2UXD B;  2IBZ H;  2A3Q A;  2CE4 A;  5IWA O;  1TUB A;  3TXS A;  4ZI7 A;  3G6E V;  1MA1 A;  3SPI A;  5IWA B;  3DSQ A;  1SQP H;  3M99 B;  3OAA G;  2XTA A;  1NVP D;  1N0N A;  2F1M A;  3FFQ A;  4CC6 A;  3CRQ A;  3LSQ A;  4RUE A;  4JZ2 A;  4H0L B;  4QNH B;  3LSS A;  4HYO A;  4DR2 O;  1F4M A;  1VQK V;  1Y74 A;  1PKX A;  4DR2 B;  2DJV A;  5K1P A;  1ZTE A;  1E1R G;  3K5O A;  4W4L A;  1Q82 W;  2QKA A;  4DR5 B;  2LFS A;  4NKG B;  5EBL C;  2UUC B;  4MVM A;  3CC2 V;  1Y4M A;  1MSW D;  3E8G A;  3PN1 A;  3N2G A;  2ATK C;  1Q8I A;  4ZHQ B;  1UPG A;  3K5N A;  1Y6X A;  2Q67 A;  2D2C B;  3CHX A;  5H5N A;  4OXS A;  4O2B A;  2VQE O;  4YIO A;  2BOC C;  2VQE B;  2GBO A;  3AG4 B;  2DYS B;  4I50 B;  4JGS A;  3A2F A;  4TUY B;  1R3J C;  1R6K A;  1H5W A;  2EUL A;  5L3C A;  2QWR B;  2WLN A;  1YCI A;  1WLE A;  4D7S A;  4X65 O;  4FLW A;  5BZB A;  1DK1 A;  2N05 A;  3RYI B;  1BL8 A;  4X65 B;  1PP9 H;  2A0L A;  2WLL A;  4F4L A;  2FYU H;  5B1A C;  4J7Z A;  1P49 A;  2RNB A;  3BPZ A;  4WFF A;  3FAV A;  1FFX A;  3CCM V;  2HVJ C;  2LW1 A;  5JCO A;  3PJS K;  4IL6 Z;  4QGP A;  4RAI A;  3JAS B;  2Q7H A;  4CS4 A;  3CC4 V;  4Q20 A;  2DOS A;  2YIB A;  1M5I A;  4TSF G;  3OTF A;  4PI0 A;  2ZCE A;  2ZE7 A;  2ZD9 A;  2WLM A;  5IDJ A;  2ZKO A;  2BCC H;  5JQG B;  2ZIN A;  4RUF A;  1XMQ B;  4IYI A;  1AVM A;  2B1G A;  2CGO A;  2HJF C;  1HNW O;  3CRC A;  4O2A A;  4PDL A;  2DMX A;  1CP9 A;  1HNW B;  1N36 O;  1XNR O;  2ZXW B;  4FLV A;  3W7X A;  3JAK A;  1N36 B;  2XT9 A;  1XNR B;  3RN4 A;  4JI8 O;  4LF7 B;  1BE3 H;  3JAT A;  5JJE B;  4BIZ A;  5BXZ A;  1G6U A;  3K06 A;  4JI8 B;  4IHJ B;  1MNG A;  1NH2 D;  4J42 A;  2IM9 A;  5KHJ A;  2HKO A;  1KC8 W;  1KKD A;  2ADP A;  3ETD A;  1I94 O;  2Z3Y A;  5A9G A;  4OGQ B;  5CA0 A;  2Y4T A;  1P7B A;  2EIN B;  2B5U A;  2IW5 A;  3JD2 A;  2DYR B;  4L8J A;  3DXR A;  1QU7 A;  1G4Y B;  3QVN A;  3ZJZ A;  3CS5 A;  4PDR A;  1QHT A;  2IJJ A;  1L0N H;  4GUN A;  2ZT9 B;  1HWY A;  1UJW B;  2GDS A;  5BMV B;  4RQF A;  4YXW G;  1NTZ H;  4DR4 O;  4P30 A;  3U11 A;  2OTJ V;  2DW4 A;  3X2Q C;  1URF A;  2BSK A;  3L9D A;  1M1K W;  4IYH A;  4FM2 A;  5K1X A;  3ZN1 A;  2Y0I A;  3JD4 A;  3W7T A;  5FNV B;  2EX3 A;  5GW7 A;  5L3E A;  4JYA B;  2OCC C;  5JH7 A;  4UCR A;  4JAA A;  1B6Q A;  1EM1 A;  5EC1 C;  1YIJ V;  3AK2 A;  2Q9L A;  2Q6A A;  2XAQ A;  4MVQ A;  4K35 A;  4LC1 A;  3AG4 C;  2DYS C;  4DV3 B;  3VBB A;  2GTA A;  4BR6 A;  1WB7 A;  5CA3 A;  5LBQ A;  2QGN A;  1AI4 A;  3LDE A;  1EN5 A;  2D3O W;  5LXT B;  5CB4 A;  1CPY A;  4KUM A;  4LBE C;  3ETE A;  1TVK A;  4XDL A;  1EZJ A;  4PA3 A;  2X6B A;  1MOF A;  3OEE G;  1VF7 A;  2E76 B;  5J2T B;  1GN2 A;  4XDK A;  2WA3 A;  2KQX A;  4QIW F;  1YSC A;  1XHZ A;  3W7S A;  2ZDI A;  2EZO A;  4FFB A;  3ZHV A;  3OW2 U;  4KL1 A;  5EYP A;  3ZMU A;  5IY5 B;  1SA0 B;  3UO2 A;  2YSU B;  4MVO A;  4HNA A;  3E8H A;  2XHB A;  2DWD C;  3T4Z A;  2EBO A;  2YEV B;  3CC7 V;  3KKY A;  1RM1 B;  4LNU A;  1ZLZ A;  2KG7 B;  3ML0 A;  4F6R B;  3L70 H;  1ZL8 A;  2YI9 A;  3UT5 A;  1U96 A;  3ETQ A;  1W0K G;  4JI7 B;  1OCO C;  2P90 A;  2ZXW C;  2WLI B;  4O4J B;  4K3A A;  1OCR B;  3ZS8 C;  1UFI A;  3ZHT A;  5A2Q N;  3LNM B;  2QWQ B;  3S3W A;  2ZDI C;  4CS3 A;  1JR9 A;  1TAE A;  4YJ3 A;  2WLH A;  1GH6 A;  5C8Y A;  4R8C A;  1MAB G;  3L72 H;  3C90 A;  4XBF A;  2YXH A;  4NB5 A;  3T4D A;  2ZNI A;  5EIB C;  2FML A;  1HW7 A;  1D5N A;  2ITD C;  4UCO A;  3P3P A;  3D3Q A;  5LL6 Y;  4MW8 A;  2XAF A;  2F23 A;  4GX5 A;  2AHZ A;  4TT3 G;  1FXK A;  4FIP C;  3RGB A;  5CBG A;  5KUM A;  5B1B B;  1GO3 F;  1COW G;  1GN6 A;  5KUK A;  1FYJ A;  5CBH A;  2Y69 B;  2ZNJ A;  2OTL V;  3HKC A;  1RPO A;  1RSO B;  4DV4 B;  1X4T A;  1KMI Z;  4J7K A;  3R65 A;  3CE2 A;  3P32 A;  4WF9 V;  5LHG A;  2CTQ A;  1IVS A;  5DM6 V;  1THZ A;  4QPJ A;  3ZHR A;  3LNN A;  3ASN C;  5IYD O;  5ITZ A;  1F7Y A;  4PEL A;  4YY3 O;  2RDC A;  3OUS A;  2BE3 A;  4MT8 A;  1YF2 A;  2DQ3 A;  1YDX A;  4YY3 B;  1E1Q G;  4PA9 A;  3I5D A;  1FXK C;  4X20 A;  4RQE A;  4DV1 O;  5KAF Z;  4JAU A;  1IJG A;  4CH5 A;  2RMK B;  3FB5 C;  2RJZ A;  3DTU B;  2IU3 A;  2CH7 B;  1K9M W;  4DV1 B;  5KAI Z;  3DGE A;  3GWK C;  4WFA V;  1JCH A;  1XUQ A;  3VQY A;  1YVW A;  3K03 A;  2L35 A;  4QE9 A;  2QKC A;  3HR0 A;  4O4H A;  5E1A C;  2EJ7 A;  4PDM A;  4BWA A;  1BQZ A;  1VMG A;  2ZR2 A;  2LJ2 A;  2PUS A;  1X59 A;  1VQ5 V;  3K08 A;  5IY5 C;  5LYJ A;  4GKK O;  1KP3 A;  3SR2 C;  3N2K A;  4GKK B;  3GWO A;  4OPA A;  5FLX N;  1YHQ V;  2PTM A;  4O4I A;  1RM1 C;  3F5W C;  1N33 O;  5BY1 A;  3J7A U;  3BA8 A;  2H8P C;  1FKA O;  5KMG B;  1B04 A;  1VIB A;  1N33 B;  5DED A;  1TUB B;  1L1F A;  1W59 A;  4UCU A;  4ZI7 B;  2YID A;  3ZRV A;  5LGT A;  1XEQ A;  4CH4 A;  5KA6 A;  3H1L H;  3L71 H;  5IJ0 A;  4DUY O;  2QTS A;  1AI5 A;  4MVR A;  3KDR A;  2ILM A;  3JD3 A;  1AB3 A;  1LUW A;  2NR5 A;  1KEC A;  3BAA A;  3SJB C;  1VAR A;  4TWK A;  1K5S A;  1SQG A;  1KBH A;  4KFM A;  1CXZ B;  1VQM V;  2F93 B;  3F7V C;  1Y74 B;  3LDC A;  2BOB C;  2QEX V;  4DV2 O;  2FTK A;  1O9H A;  3MD0 A;  4FLX A;  2R72 A;  3C3T A;  4DV2 B;  1K4D C;  1M56 C;  3O9O A;  2ZIM A;  2LQT A;  5KHH A;  2DWE C;  2GHY A;  1OJH A;  2P4K A;  3ZCC A;  1YZB A;  3ZX6 A;  2EIJ C;  2A79 B;  4I7Z B;  3N2G B;  2E75 B;  1XL6 A;  3KCY A;  2UUB O;  2N74 A;  1M57 C;  1BT8 A;  4B7K A;  3FYE B;  2Y69 C;  2KB1 A;  3U0Z A;  2W6I G;  4LF4 O;  3ABK B;  1K33 A;  1Q81 W;  4O2B B;  3TK1 A;  4K8Z A;  4JF3 A;  2GTS A;  2P22 C;  4JI3 O;  3F5T A;  3Q4H A;  3BEH A;  1IBK O;  1F23 A;  4JI3 B;  5EC2 C;  4X66 O;  3WB2 A;  1V54 C;  4W4K A;  2RN9 A;  1IBK B;  2UU9 O;  4O4L A;  4X66 B;  3WG7 C;  1XHX A;  2F66 C;  2P67 A;  2UU9 B;  4K0K B;  2BTO A;  1KB9 F;  3FB6 C;  3CX5 F;  1S3J A;  4IIJ A;  2WLL B;  4DO2 A;  1P4R A;  2YUA A;  1XI1 A;  2UXD O;  1EFR G;  2OCH A;  4GKJ O;  2P06 A;  3FAV B;  1FFX B;  2ARH A;  2CK3 G;  2WPD G;  1D2D A;  1SQB H;  4LFC B;  4GKJ B;  3FX7 A;  1AIL A;  4DXW A;  1EZV H;  3LUT B;  1QBZ A;  1HNX O;  4UB6 Z;  3B77 A;  3STL C;  3W7U A;  1HNX B;  1GM9 A;  1JVM A;  4U7O A;  1YTF B;  3B4S A;  2YXL A;  1AR5 A;  4O2A B;  1GTO A;  1R6N A;  4LH6 A;  3E86 A;  2DE0 X;  5LHI A;  5EZY A;  1FS0 G;  4QJF B;  4WBN A;  3JAK B;  4DR5 O;  1PNM A;  1VQL V;  3X2Q B;  1XIL A;  3JAT B;  3RYC A;  4R50 A;  1K97 A;  4FMT A;  2UUC O;  4B3M B;  1FJG O;  2B1I A;  1VEW A;  5J2U A;  4B3S O;  2CAZ C;  1Q6H A;  4JI6 B;  1QQC A;  1K7D A;  1FJG B;  1N32 O;  5CA0 B;  1BS3 A;  1EN6 A;  3ABL C;  4B3S B;  3TCU A;  2AGA A;  4EKW A;  1N32 B;  3DXR B;  1BZK A;  4EFE A;  1ROP A;  1IXB A;  2OCC B;  4KHP O;  4LF5 B;  4MSW C;  2Z5U A;  1AP6 A;  4JV5 O;  3IFX A;  1L0L H;  3B8M A;  3TET A;  1ORQ C;  2CDY A;  4KHP B;  4JTD B;  1JJ2 U;  4JV5 B;  5EBW C;  5LHH A;  1Y67 A;  4UV8 A;  2HFE C;  4NXM O;  1FFT B;  1Q90 D;  2QKS A;  2LGW A;  4NXM B;  4BAY A;  4LWS A;  1Y76 A;  3WU2 Z;  2BSK B;  2YS8 A;  3BHP A;  5LGN A;  3KZI Z;  1DLB A;  5IT9 N;  1S76 D;  1JX9 A;  3BA9 A;  4EFB A;  1SF9 A;  4QE7 A;  5JJN B;  4EEQ A;  1QNM A;  5JH7 B;  1R3L C;  5BR8 O;  3OD4 A;  3ABK C;  4JZG A;  5BR8 B;  1ARO P;  1NJI W;  1XQ8 A;  3OGC C;  1VP7 A;  4JAV A;  1SQQ H;  5EK0 A;  3OT7 A;  2HG5 C;  3FKS G;  1J95 A;  4FPP A;  2Y0P A;  1XMQ O;  3E22 A;  4GLX A;  1BSM A;  3OEH G;  1AJN A;  2GSM B;  2GV9 A;  2A9H A;  4LP8 A;  5CB4 B;  1V9P A;  3MAQ A;  4I9W A;  3CWB H;  1TVK B;  1OCO B;  4PA4 A;  5TIS Z;  4LF7 O;  3CPW U;  4X64 O;  3WFV A;  3WB1 A;  4DRX A;  4Z1M G;  1AR1 B;  4P9P A;  1XNQ B;  2EIM C;  4X64 B;  1H2M A;  5JCO C;  2Q0O C;  2ZR3 A;  1N4C A;  4IGG A;  3CME V;  2M6Y A;  4FFB B;  5EYP B;  3OTO B;  2Q5Z A;  1FD9 A;  4FLY A;  4HNA B;  2YC0 A;  4G28 B;  2W0F C;  4GX0 A;  1K4C C;  4G27 B;  2EIL B;  2QWP B;  1US6 A;  2JGD A;  4K8X A;  4LNU B;  3CYO A;  1DF4 A;  4HZ3 A;  1ZL8 B;  3UT5 B;  2QE7 G;  1MZE A;  1XRE A;  3HKD A;  4J11 A;  1R3I C;  2HJD A;  1Z5V A;  3FYI B;  4P2Z A;  3ZMV A;  3GVM A;  1RPR A;  1OCC C;  5KLV H;  1YI2 V;  2AZ2 A;  2QTO A;  3A0H Z;  5H9C A;  4D6T H;  1FOU A;  5CMU A;  4J80 A;  4DV6 O;  1GK9 A;  4YJ3 B;  4CC5 A;  1KQS U;  5CBF A;  4NTY A;  4PI2 A;  4I5S A;  4UFZ A;  1H38 A;  5C8Y B;  4DV6 B;  4JYA O;  1QVG U;  2BTQ A;  4J41 A;  2CTR A;  2JK5 C;  2A06 H;  1SER A;  1NR1 A;  3IAY A;  1JOY A;  4DV3 O;  4JI5 O;  2ZQM A;  3ASN B;  1WN7 A;  4JI5 B;  2Y4U A;  3CSX A;  3T1Y O;  4NTW A;  3T1Y B;  3JD1 A;  3HPL C;  1FXK B;  5IYZ A;  4LF9 O;  5B1N A;  4FM1 A;  4MTG A;  3TGU H;  2JJ1 G;  1I0H A;  3JAM N;  4LF9 B;  1XOU A;  1J5E O;  3HKC B;  2HLD G;  1WA8 A;  2P6J A;  4PHZ A;  1HR0 O;  1W2B U;  1J5E B;  1JNB A;  1YEW A;  4ABM A;  1HR0 B;  2F95 B;  4G2K A;  3CMA V;  3FB8 C;  1A32 A;  1XMO O;  3VOU A;  4WCE V;  1F51 A;  1H2N A;  1IDS A;  3CCJ V;  3K5M A;  1XMO B;  4J10 A;  3ZHQ A;  5ITZ B;  4D7T A;  2V4D A;  3K57 A;  2OIE A; 
#chains in the Genus database with same CATH homology
 2CDY A;  2QKC A;  1KKC A;  1I08 A;  3K9S A;  3MDS A;  1JR9 A;  1Y67 A;  2CE4 A;  1SZX A;  1XRE A;  1MA1 A;  4JYY A;  3DC5 A;  3CEI A;  1ZUQ A;  1EM1 A;  1MMM A;  3AK3 A;  3AK2 A;  3DC6 A;  3EVK A;  1N0N A;  5AG2 A;  1WB8 A;  2ADQ B;  4JZ2 A;  2AW9 A;  1P7G A;  4E4E A;  4BR6 A;  1WB7 A;  1JA8 A;  1D5N A;  1AVM A;  3C3S A;  1EN5 A;  3IC9 A;  4X9Q A;  1QNM A;  1PL4 A;  1GN6 A;  1ZTE A;  4JZG A;  3BFR A;  3RN4 A;  2QKA A;  3OT7 A;  3KDR A;  1LUW A;  1GN2 A;  1XDC A;  1MNG A;  1VAR A;  3LSU A;  4YIP A;  1BSM A;  1GN4 A;  2ADP A;  1AR5 A;  1AP5 A;  5A9G A;  1ZSP A;  4F6E A;  3TJT A;  1MSD A;  3C3T A;  1GN3 A;  1AR4 A;  1I0H A;  3QVN A;  1XIL A;  1EN4 A;  2RCV A;  1B06 A;  2P4K A;  4FFK A;  4YIO A;  3AK1 A;  3KKY A;  1ZLZ A;  4GUN A;  1IX9 A;  2GDS A;  1VEW A;  1BS3 A;  1EN6 A;  1LUV A;  1BT8 A;  1IDS A;  4C7U A;  1XUQ A;  1IXB A;  1AP6 A;  1PM9 A;  1N0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...