1AHOA

The ab initio structure determination and refinement of a scorpion protein toxin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
64
structure length
64
Chain Sequence
b'VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIN II
publication title Ab initio structure determination and refinement of a scorpion protein toxin.
pubmed doi rcsb
molecule tags Neurotoxin
total genus 17
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1997-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ahoA00
2KBJA 1LQHA 1JZAA 1PX9A 1GPTA 2SN3A 1NRAA 1KV0A 2LT8A 1JZBA 1P0AA 1DJTA 2LY5A 1C56A 2E0HA 2LI7A 1MR4A 1I6FA 2YEOA 1GPSA 1LQIA 1NE5A 2ASCA 2B3CA 1T7BA 1NH5A 1SEGA 2MZ0A 1I6GA 2E3GA 1VNBA 1N4NA 1ZYWA 4UJ0A 2E3FA 1JKZA 1I2UA 1JXCA 2KSKA 1AHOA 2N66A 1MYNA 1T1TA 4KYPA 1NPIA 2LR3A 2LJ7A 2N69A 2KPYA 3E7RL 1LQQA 1BK8A 1B3CA 2KGQA 1ZVEA 2LKBA 2B68A 1ZYVA 1CN2A 2N2RA 2NY9X 1T7AA 5KK4A 2YC1C 3E7UX 1DQ7A 1OMYA 2BRZA 4HHFA 1T0ZA 1ICAA 1TI5A 2NY8X 4V1DC 5CY0A 3PSMA 1WT7A 1L4VA 2KJAA 1ZU3A 2LY6A 4AAZA 2KBHA 1I2VA 2I61A 1PE4A 1ZUTA 2KYQA 2N2QA 1SNBA 1B7DA 4AB0A 1C55A 1AYJA 1BRZA 2A7TA 4AEIA 1WWNA 1ZFUA 4CQKA 2M8BB 2ATBA 1BCGA 2GL1A 1CHZA 1T7EA 1PTXA 1P00A 1FH3A 1NRBA 1OZZA 1WMTA 2KBKA 1VNAA 2LJMA 1SN1A 1BMRA 1SN4A 2YBRC 4HE7A 1ZVGA
chains in the Genus database with same CATH superfamily
3FZMA 2QWLA 4HWIA 2KBJA 1LQHA 1JZAA 2K35A 3ATUA 5EXWA 1PX9A 1GPTA 1HX1A 1NGJA 2SN3A 1NRAA 1KV0A 2LT8A 1JZBA 1P0AA 1DJTA 2VY6A 5AQYA 2LY5A 1C56A 2E0HA 2LI7A 2YIOA 4UAFE 5EX5A 1S3XA 2QWPA 5AR0A 5AQZA 3CW4A 4H5WA 1I6FA 1MR4A 2V7ZA 1QQOA 4KBOA 5AQLA 2YEOA 1GPSA 1LQIA 1NE5A 2ASCA 5AQFA 1KAXA 2B3CA 1T7BA 1KAYA 1NGGA 1NH5A 1SEGA 2MZ0A 3KC6A 2E3GA 3LDOA 1I6GA 2E8AA 1VNBA 1N4NA 1ZYWA 3IUCA 1UGLA 4UJ0A 2E3FA 2BUPA 3KOWA 3GDQA 1JKZA 3SF4D 1NGCA 2QWNA 3KOZA 1BA0A 1NGHA 5AQPA 3LDPA 3QFUA 1JXCA 1I2UA 3M3ZA 2KHOA 1NGDA 2KSKA 5AQMA 1AHOA 5BPMA 2N66A 1MYNA 1T1TA 4KYPA 3FZHA 5AQVA 4H5NA 1NPIA 2LR3A 2LJ7A 1ATRA 2N69A 2KPYA 3R2VA 3E7RL 3HSCA 3GL1A 2JDQD 1LQQA 1BK8A 1B3CA 2KGQA 5AQSA 1ZVEA 3BK3C 3FZLA 3QI7A 5AQWA 2LKBA 5AQUA 3L6QA 2MBKA 2B68A 3JXUA 1ZYVA 5BPNA 1NGFA 2G2KA 5F0XA 2QXLA 2E2FA 2YILA 4HE7A 1CN2A 2QWRA 5AQNA 2N2RA 5AQXA 2NY9X 3I33A 4H5RA 1DKGD 1T7AA 5F2RA 3KP0A 5KK4A 2YC1C 3E7UX 3KOXA 1DQ7A 1OMYA 2BRZA 1KAZA 3GKUA 4IO8A 4H5TA 4HHFA 3LDLA 1T0ZA 5FPMA 1ICAA 2LN8A 1TI5A 2NY8X 1QQNA 4V1DC 5AQOA 5AQTA 5CY0A 3PSMA 5AQRA 4UADE 1WT7A 3KP1A 1NGEA 1L4VA 3FE1A 2KJAA 1ZU3A 2LY6A 4FSVA 4AAZA 3LDNA 2KBHA 1I2VA 2I61A 3FZKA 1PE4A 3A8YA 3CQXA 1ZUTA 5EVZA 2KYQA 5FPEA 2D56A 5BN9A 3QFPA 1XRSB 2N2QA 3C7NA 1POIA 3KVGA 3KOYA 4UAEF 1SNBA 3ATVA 3C7NB 1B7DA 4H5VA 5AQHA 4AB0A 1C55A 5BN8A 1AYJA 1BRZA 1BUPA 5BPLA 1QQMA 2A7TA 3D2FA 1WWNA 4AEIA 1ZFUA 1NGAA 3KHWA 3D2FB 2MN5A 5AQGA 3AY9A 4GNIA 2GMOA 1NGIA 3D2EA 4CQKA 2M8BB 1ATSA 2ATBA 1BCGA 2GL1A 3L56A 1CHZA 4FL9A 2QWOA 5AQIA 3D2EB 5AQKA 1T7EA 3FZFA 1BA1A 1P00A 1PTXA 5FPNA 3QMLA 2QWMA 5AQJA 1NRBA 1FH3A 5AQQA 1HPMA 1HJOA 1OZZA 1YUWA 1WMTA 3LDQA 2KBKA 5EY4A 5F1XA 2YIPA 1K8BA 1VNAA 1NGBA 3L4IA 2LJMA 1SN1A 1BMRA 1SN4A 2YBRC 2QWQA 5FPDA 2QW9A 2E88A 1ZVGA
chains in the Genus database with same CATH topology
2KBJA 1LQHA 1JZAA 1PX9A 1GPTA 2SN3A 1NRAA 1KV0A 2LT8A 1JZBA 1P0AA 1DJTA 2LY5A 1C56A 2E0HA 2LI7A 1MR4A 1I6FA 2YEOA 1GPSA 1LQIA 1NE5A 2ASCA 2B3CA 1T7BA 1NH5A 1SEGA 2MZ0A 1I6GA 2E3GA 1VNBA 1N4NA 1ZYWA 4UJ0A 2E3FA 1JKZA 1I2UA 1JXCA 2KSKA 1AHOA 2N66A 1MYNA 1T1TA 4KYPA 1NPIA 2LR3A 2LJ7A 2N69A 2KPYA 3E7RL 1LQQA 1BK8A 1B3CA 2KGQA 1ZVEA 2LKBA 2B68A 1ZYVA 1CN2A 2N2RA 2NY9X 1T7AA 5KK4A 2YC1C 3E7UX 1DQ7A 1OMYA 2BRZA 4HHFA 1T0ZA 1ICAA 1TI5A 2NY8X 4V1DC 5CY0A 3PSMA 1WT7A 1L4VA 2KJAA 1ZU3A 2LY6A 4AAZA 2KBHA 1I2VA 2I61A 1PE4A 1ZUTA 2KYQA 2N2QA 1SNBA 1B7DA 4AB0A 1C55A 1AYJA 1BRZA 2A7TA 4AEIA 1WWNA 1ZFUA 4CQKA 2M8BB 2ATBA 1BCGA 2GL1A 1CHZA 1T7EA 1PTXA 1P00A 1FH3A 1NRBA 1OZZA 1WMTA 2KBKA 1VNAA 2LJMA 1SN1A 1BMRA 1SN4A 2YBRC 4HE7A 1ZVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBJ A;  1LQH A;  1JZA A;  1PX9 A;  1GPT A;  2SN3 A;  1NRA A;  1KV0 A;  2LT8 A;  1JZB A;  1P0A A;  1DJT A;  2LY5 A;  1C56 A;  2E0H A;  2LI7 A;  1MR4 A;  1I6F A;  2YEO A;  1GPS A;  1LQI A;  1NE5 A;  2ASC A;  2B3C A;  1T7B A;  1NH5 A;  1SEG A;  2MZ0 A;  1I6G A;  2E3G A;  1VNB A;  1N4N A;  1ZYW A;  4UJ0 A;  2E3F A;  1JKZ A;  1I2U A;  1JXC A;  2KSK A;  1AHO A;  2N66 A;  1MYN A;  1T1T A;  4KYP A;  1NPI A;  2LR3 A;  2LJ7 A;  2N69 A;  2KPY A;  3E7R L;  1LQQ A;  1BK8 A;  1B3C A;  2KGQ A;  1ZVE A;  2LKB A;  2B68 A;  1ZYV A;  1CN2 A;  2N2R A;  2NY9 X;  1T7A A;  5KK4 A;  2YC1 C;  3E7U X;  1DQ7 A;  1OMY A;  2BRZ A;  4HHF A;  1T0Z A;  1ICA A;  1TI5 A;  2NY8 X;  4V1D C;  5CY0 A;  3PSM A;  1WT7 A;  1L4V A;  2KJA A;  1ZU3 A;  2LY6 A;  4AAZ A;  2KBH A;  1I2V A;  2I61 A;  1PE4 A;  1ZUT A;  2KYQ A;  2N2Q A;  1SNB A;  1B7D A;  4AB0 A;  1C55 A;  1AYJ A;  1BRZ A;  2A7T A;  4AEI A;  1WWN A;  1ZFU A;  4CQK A;  2M8B B;  2ATB A;  1BCG A;  2GL1 A;  1CHZ A;  1T7E A;  1PTX A;  1P00 A;  1FH3 A;  1NRB A;  1OZZ A;  1WMT A;  2KBK A;  1VNA A;  2LJM A;  1SN1 A;  1BMR A;  1SN4 A;  2YBR C;  4HE7 A;  1ZVG A; 
#chains in the Genus database with same CATH topology
 3FZM A;  2QWL A;  4HWI A;  2KBJ A;  1LQH A;  1JZA A;  2K35 A;  3ATU A;  5EXW A;  1PX9 A;  1GPT A;  1HX1 A;  1NGJ A;  2SN3 A;  1NRA A;  1KV0 A;  2LT8 A;  1JZB A;  1P0A A;  1DJT A;  2VY6 A;  5AQY A;  2LY5 A;  1C56 A;  2E0H A;  2LI7 A;  2YIO A;  4UAF E;  5EX5 A;  1S3X A;  2QWP A;  5AR0 A;  5AQZ A;  3CW4 A;  4H5W A;  1I6F A;  1MR4 A;  2V7Z A;  1QQO A;  4KBO A;  5AQL A;  2YEO A;  1GPS A;  1LQI A;  1NE5 A;  2ASC A;  5AQF A;  1KAX A;  2B3C A;  1T7B A;  1KAY A;  1NGG A;  1NH5 A;  1SEG A;  2MZ0 A;  3KC6 A;  2E3G A;  3LDO A;  1I6G A;  2E8A A;  1VNB A;  1N4N A;  1ZYW A;  3IUC A;  1UGL A;  4UJ0 A;  2E3F A;  2BUP A;  3KOW A;  3GDQ A;  1JKZ A;  3SF4 D;  1NGC A;  2QWN A;  3KOZ A;  1BA0 A;  1NGH A;  5AQP A;  3LDP A;  3QFU A;  1JXC A;  1I2U A;  3M3Z A;  2KHO A;  1NGD A;  2KSK A;  5AQM A;  1AHO A;  5BPM A;  2N66 A;  1MYN A;  1T1T A;  4KYP A;  3FZH A;  5AQV A;  4H5N A;  1NPI A;  2LR3 A;  2LJ7 A;  1ATR A;  2N69 A;  2KPY A;  3R2V A;  3E7R L;  3HSC A;  3GL1 A;  2JDQ D;  1LQQ A;  1BK8 A;  1B3C A;  2KGQ A;  5AQS A;  1ZVE A;  3BK3 C;  3FZL A;  3QI7 A;  5AQW A;  2LKB A;  5AQU A;  3L6Q A;  2MBK A;  2B68 A;  3JXU A;  1ZYV A;  5BPN A;  1NGF A;  2G2K A;  5F0X A;  2QXL A;  2E2F A;  2YIL A;  4HE7 A;  1CN2 A;  2QWR A;  5AQN A;  2N2R A;  5AQX A;  2NY9 X;  3I33 A;  4H5R A;  1DKG D;  1T7A A;  5F2R A;  3KP0 A;  5KK4 A;  2YC1 C;  3E7U X;  3KOX A;  1DQ7 A;  1OMY A;  2BRZ A;  1KAZ A;  3GKU A;  4IO8 A;  4H5T A;  4HHF A;  3LDL A;  1T0Z A;  5FPM A;  1ICA A;  2LN8 A;  1TI5 A;  2NY8 X;  1QQN A;  4V1D C;  5AQO A;  5AQT A;  5CY0 A;  3PSM A;  5AQR A;  4UAD E;  1WT7 A;  3KP1 A;  1NGE A;  1L4V A;  3FE1 A;  2KJA A;  1ZU3 A;  2LY6 A;  4FSV A;  4AAZ A;  3LDN A;  2KBH A;  1I2V A;  2I61 A;  3FZK A;  1PE4 A;  3A8Y A;  3CQX A;  1ZUT A;  5EVZ A;  2KYQ A;  5FPE A;  2D56 A;  5BN9 A;  3QFP A;  1XRS B;  2N2Q A;  3C7N A;  1POI A;  3KVG A;  3KOY A;  4UAE F;  1SNB A;  3ATV A;  3C7N B;  1B7D A;  4H5V A;  5AQH A;  4AB0 A;  1C55 A;  5BN8 A;  1AYJ A;  1BRZ A;  1BUP A;  5BPL A;  1QQM A;  2A7T A;  3D2F A;  1WWN A;  4AEI A;  1ZFU A;  1NGA A;  3KHW A;  3D2F B;  2MN5 A;  5AQG A;  3AY9 A;  4GNI A;  2GMO A;  1NGI A;  3D2E A;  4CQK A;  2M8B B;  1ATS A;  2ATB A;  1BCG A;  2GL1 A;  3L56 A;  1CHZ A;  4FL9 A;  2QWO A;  5AQI A;  3D2E B;  5AQK A;  1T7E A;  3FZF A;  1BA1 A;  1P00 A;  1PTX A;  5FPN A;  3QML A;  2QWM A;  5AQJ A;  1NRB A;  1FH3 A;  5AQQ A;  1HPM A;  1HJO A;  1OZZ A;  1YUW A;  1WMT A;  3LDQ A;  2KBK A;  5EY4 A;  5F1X A;  2YIP A;  1K8B A;  1VNA A;  1NGB A;  3L4I A;  2LJM A;  1SN1 A;  1BMR A;  1SN4 A;  2YBR C;  2QWQ A;  5FPD A;  2QW9 A;  2E88 A;  1ZVG A; 
#chains in the Genus database with same CATH homology
 2KBJ A;  1LQH A;  1JZA A;  1PX9 A;  1GPT A;  2SN3 A;  1NRA A;  1KV0 A;  2LT8 A;  1JZB A;  1P0A A;  1DJT A;  2LY5 A;  1C56 A;  2E0H A;  2LI7 A;  1MR4 A;  1I6F A;  2YEO A;  1GPS A;  1LQI A;  1NE5 A;  2ASC A;  2B3C A;  1T7B A;  1NH5 A;  1SEG A;  2MZ0 A;  1I6G A;  2E3G A;  1VNB A;  1N4N A;  1ZYW A;  4UJ0 A;  2E3F A;  1JKZ A;  1I2U A;  1JXC A;  2KSK A;  1AHO A;  2N66 A;  1MYN A;  1T1T A;  4KYP A;  1NPI A;  2LR3 A;  2LJ7 A;  2N69 A;  2KPY A;  3E7R L;  1LQQ A;  1BK8 A;  1B3C A;  2KGQ A;  1ZVE A;  2LKB A;  2B68 A;  1ZYV A;  1CN2 A;  2N2R A;  2NY9 X;  1T7A A;  5KK4 A;  2YC1 C;  3E7U X;  1DQ7 A;  1OMY A;  2BRZ A;  4HHF A;  1T0Z A;  1ICA A;  1TI5 A;  2NY8 X;  4V1D C;  5CY0 A;  3PSM A;  1WT7 A;  1L4V A;  2KJA A;  1ZU3 A;  2LY6 A;  4AAZ A;  2KBH A;  1I2V A;  2I61 A;  1PE4 A;  1ZUT A;  2KYQ A;  2N2Q A;  1SNB A;  1B7D A;  4AB0 A;  1C55 A;  1AYJ A;  1BRZ A;  2A7T A;  4AEI A;  1WWN A;  1ZFU A;  4CQK A;  2M8B B;  2ATB A;  1BCG A;  2GL1 A;  1CHZ A;  1T7E A;  1PTX A;  1P00 A;  1FH3 A;  1NRB A;  1OZZ A;  1WMT A;  2KBK A;  1VNA A;  2LJM A;  1SN1 A;  1BMR A;  1SN4 A;  2YBR C;  4HE7 A;  1ZVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...