1AHOA

The ab initio structure determination and refinement of a scorpion protein toxin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
64
structure length
64
Chain Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIN II
publication title Ab initio structure determination and refinement of a scorpion protein toxin.
pubmed doi rcsb
molecule tags Neurotoxin
total genus 17
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1997-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ahoA00
2KBJA 1BRZA 2N69A 2LJ7A 2B68A 1L4VA 1JZAA 1AHOA 2M8BB 1I6GA 1GPSA 2YBRC 2I61A 4AAZA 1NH5A 2ATBA 2YC1C 1SN1A 2LI7A 2B3CA 5CY0A 1PTXA 1KV0A 1T7AA 1VNBA 2KBHA 4CQKA 1ZYWA 4HE7A 2LR3A 1T1TA 1CHZA 2N2QA 2E3GA 1DJTA 2E3FA 5KK4A 3PSMA 1B7DA 4AB0A 1WMTA 2KJAA 2MZ0A 1TI5A 4UJ0A 2E0HA 1CN2A 1LQQA 3E7RL 1ZVGA 2LT8A 1T7BA 2GL1A 4AEIA 1PX9A 1SEGA 1JZBA 2NY9X 4V1DC 1VNAA 1WWNA 1ZU3A 1NE5A 2KPYA 2ASCA 1NRBA 1P00A 1BK8A 1I6FA 1MR4A 2N66A 2NY8X 2KYQA 1WT7A 1T0ZA 2LY5A 1ICAA 2A7TA 2KSKA 1P0AA 1OMYA 1MYNA 1T7EA 1ZFUA 1C55A 1BMRA 1C56A 2KGQA 1BCGA 1I2VA 4HHFA 2YEOA 1NPIA 2LJMA 1ZYVA 1I2UA 2LKBA 1LQIA 1NRAA 1SN4A 1GPTA 1JXCA 1AYJA 2KBKA 1ZVEA 1B3CA 1LQHA 1OZZA 4KYPA 1PE4A 1FH3A 1SNBA 1DQ7A 1ZUTA 2N2RA 3E7UX 1N4NA 2SN3A 1JKZA 2LY6A 2BRZA
chains in the Genus database with same CATH superfamily
2KBJA 3A8YA 1BRZA 2N69A 1NGDA 2B68A 2LJ7A 3GL1A 1JZAA 4IO8A 5AQXA 1L4VA 1AHOA 2G2KA 4FSVA 3ATUA 2M8BB 5AQFA 1I6GA 1GPSA 2YBRC 2I61A 4AAZA 1NH5A 5BN9A 2ATBA 3KOYA 1POIA 2YC1C 4UAFE 5EXWA 1NGEA 1SN1A 3M3ZA 1NGCA 2LI7A 4H5TA 5FPEA 2B3CA 4HWIA 5CY0A 1YUWA 4KBOA 5AR0A 1PTXA 1S3XA 3FZLA 2QW9A 5BN8A 1KAZA 1KV0A 1T7AA 1VNBA 3R2VA 2KBHA 2QWMA 4CQKA 5AQSA 5EX5A 5FPNA 1ZYWA 5FPDA 1K8BA 2VY6A 3ATVA 3LDPA 1NGBA 2LR3A 2QWLA 3KP1A 1T1TA 1CHZA 3QFPA 2KHOA 4GNIA 4HE7A 5AQLA 2N2QA 3GKUA 2E3GA 5AQTA 4H5NA 1DJTA 2E3FA 3D2FB 5BPMA 5KK4A 1NGHA 1KAYA 1B7DA 3PSMA 5F2RA 4AB0A 4H5RA 5F1XA 3GDQA 1BA0A 1WMTA 2KJAA 2MZ0A 2YILA 1DKGD 1TI5A 3FE1A 3KOXA 2V7ZA 5AQHA 5AQRA 2E0HA 5AQZA 4UJ0A 1CN2A 3FZFA 1QQOA 3D2FA 1LQQA 3KHWA 3E7RL 5AQUA 1HPMA 3L56A 1ZVGA 2LT8A 1T7BA 2QWOA 5AQNA 5FPMA 2GL1A 3I33A 5F0XA 3KOWA 4AEIA 1PX9A 1SEGA 3D2EA 3BK3C 1BUPA 3LDOA 1HX1A 1KAXA 3CQXA 1JZBA 1UGLA 2NY9X 1HJOA 4V1DC 2E2FA 1VNAA 1WWNA 1ZU3A 5AQQA 5EVZA 1NE5A 3LDQA 2K35A 2KPYA 3SF4D 1ATRA 3HSCA 1NGAA 5AQPA 2ASCA 3KVGA 1NRBA 4FL9A 1P00A 3FZHA 5AQMA 2YIPA 1BK8A 1I6FA 3FZMA 2JDQD 3QI7A 1MR4A 2N66A 2NY8X 2D56A 2KYQA 3JXUA 5AQIA 1WT7A 3D2EB 2QWPA 1T0ZA 2LY5A 3IUCA 3AY9A 3KOZA 1ICAA 2A7TA 2KSKA 1P0AA 5EY4A 1NGIA 3KC6A 4UADE 1OMYA 1MYNA 2BUPA 1T7EA 1NGGA 1ZFUA 1C55A 2MN5A 4H5VA 1BMRA 2GMOA 2BRZA 5BPLA 2QWRA 5AQGA 2KGQA 1NGFA 3CW4A 1BCGA 1I2VA 2MBKA 2QWQA 1NPIA 2YEOA 2LJMA 4H5WA 3C7NB 1ZYVA 4HHFA 1I2UA 2LKBA 3QFUA 5AQWA 1LQIA 5AQKA 3QMLA 2E8AA 3L6QA 3LDNA 1NRAA 5AQYA 1SN4A 1GPTA 1JXCA 1BA1A 1AYJA 2E88A 3LDLA 2KBKA 3L4IA 3FZKA 5AQVA 1NGJA 1ZVEA 3C7NA 2QXLA 1B3CA 1LQHA 1QQMA 5AQOA 1XRSB 1OZZA 4KYPA 4UAEF 1PE4A 1FH3A 5AQJA 2YIOA 3KP0A 1SNBA 1QQNA 1ZUTA 1DQ7A 2LN8A 2N2RA 3E7UX 1N4NA 5BPNA 2QWNA 1ATSA 2SN3A 1JKZA 2LY6A 1C56A
chains in the Genus database with same CATH topology
2KBJA 1BRZA 2N69A 2LJ7A 2B68A 1L4VA 1JZAA 1AHOA 2M8BB 1I6GA 1GPSA 2YBRC 2I61A 4AAZA 1NH5A 2ATBA 2YC1C 1SN1A 2LI7A 2B3CA 5CY0A 1PTXA 1KV0A 1T7AA 1VNBA 2KBHA 4CQKA 1ZYWA 4HE7A 2LR3A 1T1TA 1CHZA 2N2QA 2E3GA 1DJTA 2E3FA 5KK4A 3PSMA 1B7DA 4AB0A 1WMTA 2KJAA 2MZ0A 1TI5A 4UJ0A 2E0HA 1CN2A 1LQQA 3E7RL 1ZVGA 2LT8A 1T7BA 2GL1A 4AEIA 1PX9A 1SEGA 1JZBA 2NY9X 4V1DC 1VNAA 1WWNA 1ZU3A 1NE5A 2KPYA 2ASCA 1NRBA 1P00A 1BK8A 1I6FA 1MR4A 2N66A 2NY8X 2KYQA 1WT7A 1T0ZA 2LY5A 1ICAA 2A7TA 2KSKA 1P0AA 1OMYA 1MYNA 1T7EA 1ZFUA 1C55A 1BMRA 1C56A 2KGQA 1BCGA 1I2VA 4HHFA 2YEOA 1NPIA 2LJMA 1ZYVA 1I2UA 2LKBA 1LQIA 1NRAA 1SN4A 1GPTA 1JXCA 1AYJA 2KBKA 1ZVEA 1B3CA 1LQHA 1OZZA 4KYPA 1PE4A 1FH3A 1SNBA 1DQ7A 1ZUTA 2N2RA 3E7UX 1N4NA 2SN3A 1JKZA 2LY6A 2BRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBJ A;  1BRZ A;  2N69 A;  2LJ7 A;  2B68 A;  1L4V A;  1JZA A;  1AHO A;  2M8B B;  1I6G A;  1GPS A;  2YBR C;  2I61 A;  4AAZ A;  1NH5 A;  2ATB A;  2YC1 C;  1SN1 A;  2LI7 A;  2B3C A;  5CY0 A;  1PTX A;  1KV0 A;  1T7A A;  1VNB A;  2KBH A;  4CQK A;  1ZYW A;  4HE7 A;  2LR3 A;  1T1T A;  1CHZ A;  2N2Q A;  2E3G A;  1DJT A;  2E3F A;  5KK4 A;  3PSM A;  1B7D A;  4AB0 A;  1WMT A;  2KJA A;  2MZ0 A;  1TI5 A;  4UJ0 A;  2E0H A;  1CN2 A;  1LQQ A;  3E7R L;  1ZVG A;  2LT8 A;  1T7B A;  2GL1 A;  4AEI A;  1PX9 A;  1SEG A;  1JZB A;  2NY9 X;  4V1D C;  1VNA A;  1WWN A;  1ZU3 A;  1NE5 A;  2KPY A;  2ASC A;  1NRB A;  1P00 A;  1BK8 A;  1I6F A;  1MR4 A;  2N66 A;  2NY8 X;  2KYQ A;  1WT7 A;  1T0Z A;  2LY5 A;  1ICA A;  2A7T A;  2KSK A;  1P0A A;  1OMY A;  1MYN A;  1T7E A;  1ZFU A;  1C55 A;  1BMR A;  1C56 A;  2KGQ A;  1BCG A;  1I2V A;  4HHF A;  2YEO A;  1NPI A;  2LJM A;  1ZYV A;  1I2U A;  2LKB A;  1LQI A;  1NRA A;  1SN4 A;  1GPT A;  1JXC A;  1AYJ A;  2KBK A;  1ZVE A;  1B3C A;  1LQH A;  1OZZ A;  4KYP A;  1PE4 A;  1FH3 A;  1SNB A;  1DQ7 A;  1ZUT A;  2N2R A;  3E7U X;  1N4N A;  2SN3 A;  1JKZ A;  2LY6 A;  2BRZ A; 
#chains in the Genus database with same CATH topology
 2KBJ A;  3A8Y A;  1BRZ A;  2N69 A;  1NGD A;  2B68 A;  2LJ7 A;  3GL1 A;  1JZA A;  4IO8 A;  5AQX A;  1L4V A;  1AHO A;  2G2K A;  4FSV A;  3ATU A;  2M8B B;  5AQF A;  1I6G A;  1GPS A;  2YBR C;  2I61 A;  4AAZ A;  1NH5 A;  5BN9 A;  2ATB A;  3KOY A;  1POI A;  2YC1 C;  4UAF E;  5EXW A;  1NGE A;  1SN1 A;  3M3Z A;  1NGC A;  2LI7 A;  4H5T A;  5FPE A;  2B3C A;  4HWI A;  5CY0 A;  1YUW A;  4KBO A;  5AR0 A;  1PTX A;  1S3X A;  3FZL A;  2QW9 A;  5BN8 A;  1KAZ A;  1KV0 A;  1T7A A;  1VNB A;  3R2V A;  2KBH A;  2QWM A;  4CQK A;  5AQS A;  5EX5 A;  5FPN A;  1ZYW A;  5FPD A;  1K8B A;  2VY6 A;  3ATV A;  3LDP A;  1NGB A;  2LR3 A;  2QWL A;  3KP1 A;  1T1T A;  1CHZ A;  3QFP A;  2KHO A;  4GNI A;  4HE7 A;  5AQL A;  2N2Q A;  3GKU A;  2E3G A;  5AQT A;  4H5N A;  1DJT A;  2E3F A;  3D2F B;  5BPM A;  5KK4 A;  1NGH A;  1KAY A;  1B7D A;  3PSM A;  5F2R A;  4AB0 A;  4H5R A;  5F1X A;  3GDQ A;  1BA0 A;  1WMT A;  2KJA A;  2MZ0 A;  2YIL A;  1DKG D;  1TI5 A;  3FE1 A;  3KOX A;  2V7Z A;  5AQH A;  5AQR A;  2E0H A;  5AQZ A;  4UJ0 A;  1CN2 A;  3FZF A;  1QQO A;  3D2F A;  1LQQ A;  3KHW A;  3E7R L;  5AQU A;  1HPM A;  3L56 A;  1ZVG A;  2LT8 A;  1T7B A;  2QWO A;  5AQN A;  5FPM A;  2GL1 A;  3I33 A;  5F0X A;  3KOW A;  4AEI A;  1PX9 A;  1SEG A;  3D2E A;  3BK3 C;  1BUP A;  3LDO A;  1HX1 A;  1KAX A;  3CQX A;  1JZB A;  1UGL A;  2NY9 X;  1HJO A;  4V1D C;  2E2F A;  1VNA A;  1WWN A;  1ZU3 A;  5AQQ A;  5EVZ A;  1NE5 A;  3LDQ A;  2K35 A;  2KPY A;  3SF4 D;  1ATR A;  3HSC A;  1NGA A;  5AQP A;  2ASC A;  3KVG A;  1NRB A;  4FL9 A;  1P00 A;  3FZH A;  5AQM A;  2YIP A;  1BK8 A;  1I6F A;  3FZM A;  2JDQ D;  3QI7 A;  1MR4 A;  2N66 A;  2NY8 X;  2D56 A;  2KYQ A;  3JXU A;  5AQI A;  1WT7 A;  3D2E B;  2QWP A;  1T0Z A;  2LY5 A;  3IUC A;  3AY9 A;  3KOZ A;  1ICA A;  2A7T A;  2KSK A;  1P0A A;  5EY4 A;  1NGI A;  3KC6 A;  4UAD E;  1OMY A;  1MYN A;  2BUP A;  1T7E A;  1NGG A;  1ZFU A;  1C55 A;  2MN5 A;  4H5V A;  1BMR A;  2GMO A;  2BRZ A;  5BPL A;  2QWR A;  5AQG A;  2KGQ A;  1NGF A;  3CW4 A;  1BCG A;  1I2V A;  2MBK A;  2QWQ A;  1NPI A;  2YEO A;  2LJM A;  4H5W A;  3C7N B;  1ZYV A;  4HHF A;  1I2U A;  2LKB A;  3QFU A;  5AQW A;  1LQI A;  5AQK A;  3QML A;  2E8A A;  3L6Q A;  3LDN A;  1NRA A;  5AQY A;  1SN4 A;  1GPT A;  1JXC A;  1BA1 A;  1AYJ A;  2E88 A;  3LDL A;  2KBK A;  3L4I A;  3FZK A;  5AQV A;  1NGJ A;  1ZVE A;  3C7N A;  2QXL A;  1B3C A;  1LQH A;  1QQM A;  5AQO A;  1XRS B;  1OZZ A;  4KYP A;  4UAE F;  1PE4 A;  1FH3 A;  5AQJ A;  2YIO A;  3KP0 A;  1SNB A;  1QQN A;  1ZUT A;  1DQ7 A;  2LN8 A;  2N2R A;  3E7U X;  1N4N A;  5BPN A;  2QWN A;  1ATS A;  2SN3 A;  1JKZ A;  2LY6 A;  1C56 A; 
#chains in the Genus database with same CATH homology
 2KBJ A;  1BRZ A;  2N69 A;  2LJ7 A;  2B68 A;  1L4V A;  1JZA A;  1AHO A;  2M8B B;  1I6G A;  1GPS A;  2YBR C;  2I61 A;  4AAZ A;  1NH5 A;  2ATB A;  2YC1 C;  1SN1 A;  2LI7 A;  2B3C A;  5CY0 A;  1PTX A;  1KV0 A;  1T7A A;  1VNB A;  2KBH A;  4CQK A;  1ZYW A;  4HE7 A;  2LR3 A;  1T1T A;  1CHZ A;  2N2Q A;  2E3G A;  1DJT A;  2E3F A;  5KK4 A;  3PSM A;  1B7D A;  4AB0 A;  1WMT A;  2KJA A;  2MZ0 A;  1TI5 A;  4UJ0 A;  2E0H A;  1CN2 A;  1LQQ A;  3E7R L;  1ZVG A;  2LT8 A;  1T7B A;  2GL1 A;  4AEI A;  1PX9 A;  1SEG A;  1JZB A;  2NY9 X;  4V1D C;  1VNA A;  1WWN A;  1ZU3 A;  1NE5 A;  2KPY A;  2ASC A;  1NRB A;  1P00 A;  1BK8 A;  1I6F A;  1MR4 A;  2N66 A;  2NY8 X;  2KYQ A;  1WT7 A;  1T0Z A;  2LY5 A;  1ICA A;  2A7T A;  2KSK A;  1P0A A;  1OMY A;  1MYN A;  1T7E A;  1ZFU A;  1C55 A;  1BMR A;  1C56 A;  2KGQ A;  1BCG A;  1I2V A;  4HHF A;  2YEO A;  1NPI A;  2LJM A;  1ZYV A;  1I2U A;  2LKB A;  1LQI A;  1NRA A;  1SN4 A;  1GPT A;  1JXC A;  1AYJ A;  2KBK A;  1ZVE A;  1B3C A;  1LQH A;  1OZZ A;  4KYP A;  1PE4 A;  1FH3 A;  1SNB A;  1DQ7 A;  1ZUT A;  2N2R A;  3E7U X;  1N4N A;  2SN3 A;  1JKZ A;  2LY6 A;  2BRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...