2MZ0A

Solution nmr structure of pdfl2.1 from arabidopsis thaliana
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
KDIDGRKPLLIGTCIEFPTEKCNKTCIESNFAGGKCVHIGQSLDFVCVCFPKYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin-like protein 32
publication title Solution NMR Structure of PDFL2.1 from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Antimicrobial protein
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2015-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2mz0A00
4AB0A 1T1TA 1NH5A 1GPTA 1VNBA 2LI7A 1SEGA 1LQIA 1C55A 1WT7A 1VNAA 1ZFUA 1PX9A 2LJMA 1T7BA 2NY8X 2LY6A 1I2VA 1GPSA 2N2RA 1CN2A 2LR3A 1C56A 1DQ7A 1B7DA 1I6FA 2LKBA 2ASCA 1T7AA 1JZAA 1ZVGA 1DJTA 2BRZA 2GL1A 2KPYA 1NRAA 2A7TA 2KGQA 3E7RL 1SN1A 1NRBA 4AEIA 2YBRC 4HE7A 1BK8A 4UJ0A 5CY0A 4KYPA 1ZUTA 2KBHA 1LQQA 1B3CA 1BMRA 2I61A 2N2QA 4V1DC 1KV0A 2ATBA 2LY5A 1LQHA 1ZYVA 1MYNA 1PTXA 2NY9X 2KBKA 1BCGA 1AHOA 4AAZA 2MZ0A 2B3CA 1I6GA 2KBJA 1L4VA 1JKZA 2LT8A 1AYJA 2E3FA 1CHZA 3E7UX 1P0AA 4CQKA 1N4NA 2M8BB 1TI5A 2KSKA 2LJ7A 2N66A 1ZVEA 1JXCA 1T0ZA 1ICAA 1ZYWA 2KYQA 2KJAA 2SN3A 1T7EA 1PE4A 1I2UA 2YC1C 1OZZA 2N69A 1NE5A 1P00A 4HHFA 1WWNA 1MR4A 1ZU3A 2E0HA 3PSMA 2B68A 1FH3A 1SNBA 2E3GA 2YEOA 5KK4A 1SN4A 1OMYA 1JZBA 1NPIA 1WMTA 1BRZA
chains in the Genus database with same CATH superfamily
3LDNA 4AB0A 1T1TA 2QWNA 2BUPA 1NH5A 1S3XA 3JXUA 3LDOA 5AQXA 1BUPA 1VNBA 1GPTA 2LI7A 1SEGA 3KP0A 5F2RA 2YIPA 3KC6A 1LQIA 1C55A 4H5NA 1WT7A 1VNAA 1ZFUA 3LDPA 1PX9A 2G2KA 2LJMA 1T7BA 3IUCA 5AQYA 5EXWA 2JDQD 2LY6A 2NY8X 3A8YA 3ATVA 2YIOA 3FZKA 3FZLA 5BPNA 1GPSA 2N2RA 1KAYA 2LR3A 1CN2A 5AQWA 4IO8A 5FPNA 1C56A 5AQLA 3FZMA 1DQ7A 1B7DA 1I6FA 2LKBA 2ASCA 2VY6A 3HSCA 5F0XA 4UAEF 2V7ZA 2MBKA 1T7AA 1XRSB 1JZAA 1KAXA 2QW9A 2QWMA 1UGLA 3D2EB 3L6QA 5AQGA 1ZVGA 1DJTA 5BN8A 3AY9A 2BRZA 2GL1A 3KHWA 1NGHA 3KOWA 2KPYA 1NRAA 2A7TA 1NGFA 2KGQA 3E7RL 3CQXA 4HWIA 1I2VA 5AQQA 1SN1A 1NRBA 3LDQA 5FPMA 4AEIA 5AQZA 2YBRC 4HE7A 1BK8A 4UJ0A 3GDQA 5AQMA 3D2FA 3FZFA 5CY0A 4KYPA 1ZUTA 2KBHA 1LQQA 2LN8A 3M3ZA 1B3CA 2D56A 5EVZA 5BN9A 1BMRA 1QQOA 2I61A 3I33A 4UAFE 2QWPA 3C7NA 4UADE 2QWRA 2N2QA 2YILA 5AQFA 1ATSA 4V1DC 1KV0A 5AQTA 1NGDA 5BPLA 5FPEA 2ATBA 1NGGA 2LY5A 5AQJA 1LQHA 1ZYVA 1MYNA 1BA1A 1PTXA 4H5RA 3GKUA 3R2VA 1HPMA 2NY9X 1NGCA 2GMOA 2KBKA 1BCGA 1AHOA 3ATUA 4AAZA 2MZ0A 1ATRA 2B3CA 5AQPA 2QWLA 5EY4A 3GL1A 2MN5A 3KOZA 4FL9A 1I6GA 3QFUA 2KBJA 1L4VA 5AQIA 1JKZA 1QQNA 2LT8A 1AYJA 1NGIA 1BA0A 1NGBA 2E3FA 1CHZA 3E7UX 2K35A 2E8AA 1P0AA 4CQKA 1N4NA 2M8BB 1TI5A 2KSKA 2LJ7A 2N66A 1ZVEA 5AQHA 5AQUA 3QFPA 3SF4D 1JXCA 1T0ZA 2KHOA 5AR0A 1ICAA 1ZYWA 1HX1A 1DKGD 2KYQA 2KJAA 5AQKA 2QWOA 2SN3A 3D2FB 3QI7A 4FSVA 4H5TA 2QWQA 4H5VA 3QMLA 1T7EA 1PE4A 2QXLA 1FH3A 1I2UA 1QQMA 3C7NB 2YC1C 1KAZA 1OZZA 2N69A 3KOXA 1NE5A 4KBOA 5AQOA 3LDLA 4H5WA 3FE1A 3L4IA 5FPDA 1P00A 4HHFA 5AQRA 1WWNA 3KP1A 5AQNA 3KVGA 3D2EA 3BK3C 5AQSA 1MR4A 5BPMA 3FZHA 1HJOA 1ZU3A 2E0HA 3L56A 1NGAA 2B68A 2E88A 1POIA 1SNBA 3PSMA 1YUWA 5EX5A 5F1XA 1NGEA 2E3GA 2YEOA 5KK4A 1SN4A 3CW4A 1OMYA 3KOYA 1K8BA 1NGJA 1JZBA 5AQVA 2E2FA 4GNIA 1NPIA 1WMTA 1BRZA
chains in the Genus database with same CATH topology
4AB0A 1T1TA 1NH5A 1GPTA 1VNBA 2LI7A 1SEGA 1LQIA 1C55A 1WT7A 1VNAA 1ZFUA 1PX9A 2LJMA 1T7BA 2NY8X 2LY6A 1I2VA 1GPSA 2N2RA 1CN2A 2LR3A 1C56A 1DQ7A 1B7DA 1I6FA 2LKBA 2ASCA 1T7AA 1JZAA 1ZVGA 1DJTA 2BRZA 2GL1A 2KPYA 1NRAA 2A7TA 2KGQA 3E7RL 1SN1A 1NRBA 4AEIA 2YBRC 4HE7A 1BK8A 4UJ0A 5CY0A 4KYPA 1ZUTA 2KBHA 1LQQA 1B3CA 1BMRA 2I61A 2N2QA 4V1DC 1KV0A 2ATBA 2LY5A 1LQHA 1ZYVA 1MYNA 1PTXA 2NY9X 2KBKA 1BCGA 1AHOA 4AAZA 2MZ0A 2B3CA 1I6GA 2KBJA 1L4VA 1JKZA 2LT8A 1AYJA 2E3FA 1CHZA 3E7UX 1P0AA 4CQKA 1N4NA 2M8BB 1TI5A 2KSKA 2LJ7A 2N66A 1ZVEA 1JXCA 1T0ZA 1ICAA 1ZYWA 2KYQA 2KJAA 2SN3A 1T7EA 1PE4A 1I2UA 2YC1C 1OZZA 2N69A 1NE5A 1P00A 4HHFA 1WWNA 1MR4A 1ZU3A 2E0HA 3PSMA 2B68A 1FH3A 1SNBA 2E3GA 2YEOA 5KK4A 1SN4A 1OMYA 1JZBA 1NPIA 1WMTA 1BRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AB0 A;  1T1T A;  1NH5 A;  1GPT A;  1VNB A;  2LI7 A;  1SEG A;  1LQI A;  1C55 A;  1WT7 A;  1VNA A;  1ZFU A;  1PX9 A;  2LJM A;  1T7B A;  2NY8 X;  2LY6 A;  1I2V A;  1GPS A;  2N2R A;  1CN2 A;  2LR3 A;  1C56 A;  1DQ7 A;  1B7D A;  1I6F A;  2LKB A;  2ASC A;  1T7A A;  1JZA A;  1ZVG A;  1DJT A;  2BRZ A;  2GL1 A;  2KPY A;  1NRA A;  2A7T A;  2KGQ A;  3E7R L;  1SN1 A;  1NRB A;  4AEI A;  2YBR C;  4HE7 A;  1BK8 A;  4UJ0 A;  5CY0 A;  4KYP A;  1ZUT A;  2KBH A;  1LQQ A;  1B3C A;  1BMR A;  2I61 A;  2N2Q A;  4V1D C;  1KV0 A;  2ATB A;  2LY5 A;  1LQH A;  1ZYV A;  1MYN A;  1PTX A;  2NY9 X;  2KBK A;  1BCG A;  1AHO A;  4AAZ A;  2MZ0 A;  2B3C A;  1I6G A;  2KBJ A;  1L4V A;  1JKZ A;  2LT8 A;  1AYJ A;  2E3F A;  1CHZ A;  3E7U X;  1P0A A;  4CQK A;  1N4N A;  2M8B B;  1TI5 A;  2KSK A;  2LJ7 A;  2N66 A;  1ZVE A;  1JXC A;  1T0Z A;  1ICA A;  1ZYW A;  2KYQ A;  2KJA A;  2SN3 A;  1T7E A;  1PE4 A;  1I2U A;  2YC1 C;  1OZZ A;  2N69 A;  1NE5 A;  1P00 A;  4HHF A;  1WWN A;  1MR4 A;  1ZU3 A;  2E0H A;  3PSM A;  2B68 A;  1FH3 A;  1SNB A;  2E3G A;  2YEO A;  5KK4 A;  1SN4 A;  1OMY A;  1JZB A;  1NPI A;  1WMT A;  1BRZ A; 
#chains in the Genus database with same CATH topology
 3LDN A;  4AB0 A;  1T1T A;  2QWN A;  2BUP A;  1NH5 A;  1S3X A;  3JXU A;  3LDO A;  5AQX A;  1BUP A;  1VNB A;  1GPT A;  2LI7 A;  1SEG A;  3KP0 A;  5F2R A;  2YIP A;  3KC6 A;  1LQI A;  1C55 A;  4H5N A;  1WT7 A;  1VNA A;  1ZFU A;  3LDP A;  1PX9 A;  2G2K A;  2LJM A;  1T7B A;  3IUC A;  5AQY A;  5EXW A;  2JDQ D;  2LY6 A;  2NY8 X;  3A8Y A;  3ATV A;  2YIO A;  3FZK A;  3FZL A;  5BPN A;  1GPS A;  2N2R A;  1KAY A;  2LR3 A;  1CN2 A;  5AQW A;  4IO8 A;  5FPN A;  1C56 A;  5AQL A;  3FZM A;  1DQ7 A;  1B7D A;  1I6F A;  2LKB A;  2ASC A;  2VY6 A;  3HSC A;  5F0X A;  4UAE F;  2V7Z A;  2MBK A;  1T7A A;  1XRS B;  1JZA A;  1KAX A;  2QW9 A;  2QWM A;  1UGL A;  3D2E B;  3L6Q A;  5AQG A;  1ZVG A;  1DJT A;  5BN8 A;  3AY9 A;  2BRZ A;  2GL1 A;  3KHW A;  1NGH A;  3KOW A;  2KPY A;  1NRA A;  2A7T A;  1NGF A;  2KGQ A;  3E7R L;  3CQX A;  4HWI A;  1I2V A;  5AQQ A;  1SN1 A;  1NRB A;  3LDQ A;  5FPM A;  4AEI A;  5AQZ A;  2YBR C;  4HE7 A;  1BK8 A;  4UJ0 A;  3GDQ A;  5AQM A;  3D2F A;  3FZF A;  5CY0 A;  4KYP A;  1ZUT A;  2KBH A;  1LQQ A;  2LN8 A;  3M3Z A;  1B3C A;  2D56 A;  5EVZ A;  5BN9 A;  1BMR A;  1QQO A;  2I61 A;  3I33 A;  4UAF E;  2QWP A;  3C7N A;  4UAD E;  2QWR A;  2N2Q A;  2YIL A;  5AQF A;  1ATS A;  4V1D C;  1KV0 A;  5AQT A;  1NGD A;  5BPL A;  5FPE A;  2ATB A;  1NGG A;  2LY5 A;  5AQJ A;  1LQH A;  1ZYV A;  1MYN A;  1BA1 A;  1PTX A;  4H5R A;  3GKU A;  3R2V A;  1HPM A;  2NY9 X;  1NGC A;  2GMO A;  2KBK A;  1BCG A;  1AHO A;  3ATU A;  4AAZ A;  2MZ0 A;  1ATR A;  2B3C A;  5AQP A;  2QWL A;  5EY4 A;  3GL1 A;  2MN5 A;  3KOZ A;  4FL9 A;  1I6G A;  3QFU A;  2KBJ A;  1L4V A;  5AQI A;  1JKZ A;  1QQN A;  2LT8 A;  1AYJ A;  1NGI A;  1BA0 A;  1NGB A;  2E3F A;  1CHZ A;  3E7U X;  2K35 A;  2E8A A;  1P0A A;  4CQK A;  1N4N A;  2M8B B;  1TI5 A;  2KSK A;  2LJ7 A;  2N66 A;  1ZVE A;  5AQH A;  5AQU A;  3QFP A;  3SF4 D;  1JXC A;  1T0Z A;  2KHO A;  5AR0 A;  1ICA A;  1ZYW A;  1HX1 A;  1DKG D;  2KYQ A;  2KJA A;  5AQK A;  2QWO A;  2SN3 A;  3D2F B;  3QI7 A;  4FSV A;  4H5T A;  2QWQ A;  4H5V A;  3QML A;  1T7E A;  1PE4 A;  2QXL A;  1FH3 A;  1I2U A;  1QQM A;  3C7N B;  2YC1 C;  1KAZ A;  1OZZ A;  2N69 A;  3KOX A;  1NE5 A;  4KBO A;  5AQO A;  3LDL A;  4H5W A;  3FE1 A;  3L4I A;  5FPD A;  1P00 A;  4HHF A;  5AQR A;  1WWN A;  3KP1 A;  5AQN A;  3KVG A;  3D2E A;  3BK3 C;  5AQS A;  1MR4 A;  5BPM A;  3FZH A;  1HJO A;  1ZU3 A;  2E0H A;  3L56 A;  1NGA A;  2B68 A;  2E88 A;  1POI A;  1SNB A;  3PSM A;  1YUW A;  5EX5 A;  5F1X A;  1NGE A;  2E3G A;  2YEO A;  5KK4 A;  1SN4 A;  3CW4 A;  1OMY A;  3KOY A;  1K8B A;  1NGJ A;  1JZB A;  5AQV A;  2E2F A;  4GNI A;  1NPI A;  1WMT A;  1BRZ A; 
#chains in the Genus database with same CATH homology
 4AB0 A;  1T1T A;  1NH5 A;  1GPT A;  1VNB A;  2LI7 A;  1SEG A;  1LQI A;  1C55 A;  1WT7 A;  1VNA A;  1ZFU A;  1PX9 A;  2LJM A;  1T7B A;  2NY8 X;  2LY6 A;  1I2V A;  1GPS A;  2N2R A;  1CN2 A;  2LR3 A;  1C56 A;  1DQ7 A;  1B7D A;  1I6F A;  2LKB A;  2ASC A;  1T7A A;  1JZA A;  1ZVG A;  1DJT A;  2BRZ A;  2GL1 A;  2KPY A;  1NRA A;  2A7T A;  2KGQ A;  3E7R L;  1SN1 A;  1NRB A;  4AEI A;  2YBR C;  4HE7 A;  1BK8 A;  4UJ0 A;  5CY0 A;  4KYP A;  1ZUT A;  2KBH A;  1LQQ A;  1B3C A;  1BMR A;  2I61 A;  2N2Q A;  4V1D C;  1KV0 A;  2ATB A;  2LY5 A;  1LQH A;  1ZYV A;  1MYN A;  1PTX A;  2NY9 X;  2KBK A;  1BCG A;  1AHO A;  4AAZ A;  2MZ0 A;  2B3C A;  1I6G A;  2KBJ A;  1L4V A;  1JKZ A;  2LT8 A;  1AYJ A;  2E3F A;  1CHZ A;  3E7U X;  1P0A A;  4CQK A;  1N4N A;  2M8B B;  1TI5 A;  2KSK A;  2LJ7 A;  2N66 A;  1ZVE A;  1JXC A;  1T0Z A;  1ICA A;  1ZYW A;  2KYQ A;  2KJA A;  2SN3 A;  1T7E A;  1PE4 A;  1I2U A;  2YC1 C;  1OZZ A;  2N69 A;  1NE5 A;  1P00 A;  4HHF A;  1WWN A;  1MR4 A;  1ZU3 A;  2E0H A;  3PSM A;  2B68 A;  1FH3 A;  1SNB A;  2E3G A;  2YEO A;  5KK4 A;  1SN4 A;  1OMY A;  1JZB A;  1NPI A;  1WMT A;  1BRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...