2MZ0A

Solution nmr structure of pdfl2.1 from arabidopsis thaliana
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
b'KDIDGRKPLLIGTCIEFPTEKCNKTCIESNFAGGKCVHIGQSLDFVCVCFPKYYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin-like protein 32
publication title Solution NMR Structure of PDFL2.1 from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Antimicrobial protein
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2015-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2mz0A00
1MYNA 2KGQA 1DJTA 1MR4A 1I2VA 2NY8X 1GPSA 1C55A 2KYQA 1GPTA 1ZFUA 2LR3A 1VNBA 1WMTA 1L4VA 1PE4A 1PX9A 4AB0A 3E7UX 1TI5A 2KBJA 1T7EA 2LY5A 1BK8A 2ASCA 1BMRA 1I2UA 1JZBA 2B3CA 2I61A 1CN2A 2LT8A 2SN3A 2E3GA 1BRZA 2KPYA 1WT7A 2N2QA 2KBKA 1N4NA 1VNAA 2N66A 1I6GA 1I6FA 1AHOA 1NPIA 2E0HA 2E3FA 1OZZA 2YEOA 1DQ7A 2KBHA 1JKZA 1JXCA 4AAZA 1AYJA 1ZU3A 1P00A 4HHFA 1ICAA 2LI7A 1ZVGA 5CY0A 4UJ0A 1B7DA 2LJMA 1SN1A 2M8BB 1NE5A 2N69A 2NY9X 1NRBA 1JZAA 1ZUTA 1T0ZA 1KV0A 1ZYWA 1NRAA 1T7BA 1C56A 1FH3A 2YC1C 2N2RA 2MZ0A 1ZVEA 2LKBA 1LQHA 2LY6A 1ZYVA 2BRZA 3PSMA 1T1TA 2A7TA 1CHZA 4V1DC 1P0AA 1B3CA 1BCGA 1LQQA 2YBRC 4CQKA 2B68A 5KK4A 1PTXA 1T7AA 4HE7A 1LQIA 1WWNA 1OMYA 1SEGA 1SN4A 2KJAA 4KYPA 4AEIA 3E7RL 2LJ7A 1NH5A 2GL1A 2KSKA 1SNBA 2ATBA
chains in the Genus database with same CATH superfamily
2QWNA 1MYNA 1QQOA 1XRSB 2KGQA 1DJTA 1HJOA 1MR4A 2NY8X 3GL1A 5BN8A 5F1XA 1I2VA 1GPSA 1C55A 2KYQA 5AQLA 1GPTA 1ZFUA 2E8AA 2LR3A 4UAEF 4HWIA 2E2FA 1VNBA 1NGHA 1WMTA 3FZLA 5F2RA 3KHWA 3LDLA 1L4VA 1PE4A 2MN5A 3HSCA 2K35A 1PX9A 4FSVA 5FPNA 1NGFA 2D56A 4UAFE 4AB0A 5F0XA 3E7UX 1TI5A 3KOYA 2KBJA 1T7EA 1ATRA 2LY5A 5AQZA 1BK8A 1YUWA 1QQMA 2ASCA 5AQXA 5BPMA 2KHOA 1BMRA 1JZBA 1I2UA 2B3CA 1KAXA 3C7NA 2I61A 5FPMA 1CN2A 1HX1A 2LT8A 1NGBA 1KAZA 3KC6A 2JDQD 5BN9A 1NGDA 2SN3A 5AQRA 2E3GA 3LDOA 2QWQA 3D2FB 1BRZA 3ATUA 2KPYA 1WT7A 2N2QA 2KBKA 1N4NA 1VNAA 2N66A 2QWLA 1I6FA 2YILA 1AHOA 2QXLA 3FZFA 1NPIA 1I6GA 3FZHA 1NGIA 5AQWA 2E0HA 2YIOA 2E3FA 2E88A 2V7ZA 3LDNA 3QFPA 1OZZA 1NGJA 1UGLA 2YEOA 1DQ7A 2QWOA 2KBHA 1HPMA 2LN8A 3CW4A 4H5WA 1JKZA 1JXCA 5FPDA 3L56A 5AQNA 4AAZA 1AYJA 1K8BA 3KOZA 5AQUA 1ZU3A 3I33A 4H5VA 1P00A 5AQYA 5AQTA 5AQPA 3FE1A 4HHFA 1BA1A 1ICAA 4H5RA 2LI7A 3M3ZA 1ZVGA 5AQQA 5CY0A 5EVZA 5EX5A 4UJ0A 5EXWA 2MBKA 2VY6A 1B7DA 4H5NA 3QFUA 1DKGD 1SN1A 1BA0A 2LJMA 3ATVA 3BK3C 5AQSA 4KBOA 1NGAA 1NE5A 2M8BB 2N69A 2NY9X 1NRBA 3CQXA 3D2FA 1JZAA 3QI7A 1ZUTA 5AQFA 1T0ZA 1KV0A 1ZYWA 3D2EB 1NRAA 1T7BA 1BUPA 1C56A 3FZKA 3KVGA 2BUPA 2QWMA 5AQJA 1FH3A 3KOWA 2G2KA 2N2RA 2YC1C 3L4IA 2MZ0A 1ZVEA 2QWRA 3FZMA 3KP1A 3LDPA 3R2VA 2LKBA 3LDQA 4FL9A 3KOXA 1LQHA 2LY6A 1ZYVA 2BRZA 3GKUA 1NGCA 3QMLA 3PSMA 1T1TA 4IO8A 2A7TA 1CHZA 1NGEA 5AQMA 5AQOA 4UADE 4V1DC 1P0AA 1B3CA 3GDQA 5BPNA 1BCGA 1LQQA 2YBRC 1KAYA 1QQNA 4CQKA 5AR0A 5EY4A 3C7NB 2B68A 1NGGA 3KP0A 5KK4A 1POIA 1PTXA 5AQGA 2YIPA 3L6QA 2QWPA 1T7AA 2QW9A 5AQIA 3SF4D 5BPLA 4HE7A 1LQIA 3IUCA 1S3XA 1WWNA 3JXUA 4GNIA 1OMYA 1SEGA 1SN4A 2KJAA 3D2EA 4KYPA 3A8YA 2GMOA 3E7RL 5AQVA 4AEIA 5AQKA 2LJ7A 1NH5A 4H5TA 2GL1A 2KSKA 1SNBA 5AQHA 1ATSA 5FPEA 2ATBA 3AY9A
chains in the Genus database with same CATH topology
1MYNA 2KGQA 1DJTA 1MR4A 1I2VA 2NY8X 1GPSA 1C55A 2KYQA 1GPTA 1ZFUA 2LR3A 1VNBA 1WMTA 1L4VA 1PE4A 1PX9A 4AB0A 3E7UX 1TI5A 2KBJA 1T7EA 2LY5A 1BK8A 2ASCA 1BMRA 1I2UA 1JZBA 2B3CA 2I61A 1CN2A 2LT8A 2SN3A 2E3GA 1BRZA 2KPYA 1WT7A 2N2QA 2KBKA 1N4NA 1VNAA 2N66A 1I6GA 1I6FA 1AHOA 1NPIA 2E0HA 2E3FA 1OZZA 2YEOA 1DQ7A 2KBHA 1JKZA 1JXCA 4AAZA 1AYJA 1ZU3A 1P00A 4HHFA 1ICAA 2LI7A 1ZVGA 5CY0A 4UJ0A 1B7DA 2LJMA 1SN1A 2M8BB 1NE5A 2N69A 2NY9X 1NRBA 1JZAA 1ZUTA 1T0ZA 1KV0A 1ZYWA 1NRAA 1T7BA 1C56A 1FH3A 2YC1C 2N2RA 2MZ0A 1ZVEA 2LKBA 1LQHA 2LY6A 1ZYVA 2BRZA 3PSMA 1T1TA 2A7TA 1CHZA 4V1DC 1P0AA 1B3CA 1BCGA 1LQQA 2YBRC 4CQKA 2B68A 5KK4A 1PTXA 1T7AA 4HE7A 1LQIA 1WWNA 1OMYA 1SEGA 1SN4A 2KJAA 4KYPA 4AEIA 3E7RL 2LJ7A 1NH5A 2GL1A 2KSKA 1SNBA 2ATBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MYN A;  2KGQ A;  1DJT A;  1MR4 A;  1I2V A;  2NY8 X;  1GPS A;  1C55 A;  2KYQ A;  1GPT A;  1ZFU A;  2LR3 A;  1VNB A;  1WMT A;  1L4V A;  1PE4 A;  1PX9 A;  4AB0 A;  3E7U X;  1TI5 A;  2KBJ A;  1T7E A;  2LY5 A;  1BK8 A;  2ASC A;  1BMR A;  1I2U A;  1JZB A;  2B3C A;  2I61 A;  1CN2 A;  2LT8 A;  2SN3 A;  2E3G A;  1BRZ A;  2KPY A;  1WT7 A;  2N2Q A;  2KBK A;  1N4N A;  1VNA A;  2N66 A;  1I6G A;  1I6F A;  1AHO A;  1NPI A;  2E0H A;  2E3F A;  1OZZ A;  2YEO A;  1DQ7 A;  2KBH A;  1JKZ A;  1JXC A;  4AAZ A;  1AYJ A;  1ZU3 A;  1P00 A;  4HHF A;  1ICA A;  2LI7 A;  1ZVG A;  5CY0 A;  4UJ0 A;  1B7D A;  2LJM A;  1SN1 A;  2M8B B;  1NE5 A;  2N69 A;  2NY9 X;  1NRB A;  1JZA A;  1ZUT A;  1T0Z A;  1KV0 A;  1ZYW A;  1NRA A;  1T7B A;  1C56 A;  1FH3 A;  2YC1 C;  2N2R A;  2MZ0 A;  1ZVE A;  2LKB A;  1LQH A;  2LY6 A;  1ZYV A;  2BRZ A;  3PSM A;  1T1T A;  2A7T A;  1CHZ A;  4V1D C;  1P0A A;  1B3C A;  1BCG A;  1LQQ A;  2YBR C;  4CQK A;  2B68 A;  5KK4 A;  1PTX A;  1T7A A;  4HE7 A;  1LQI A;  1WWN A;  1OMY A;  1SEG A;  1SN4 A;  2KJA A;  4KYP A;  4AEI A;  3E7R L;  2LJ7 A;  1NH5 A;  2GL1 A;  2KSK A;  1SNB A;  2ATB A; 
#chains in the Genus database with same CATH topology
 2QWN A;  1MYN A;  1QQO A;  1XRS B;  2KGQ A;  1DJT A;  1HJO A;  1MR4 A;  2NY8 X;  3GL1 A;  5BN8 A;  5F1X A;  1I2V A;  1GPS A;  1C55 A;  2KYQ A;  5AQL A;  1GPT A;  1ZFU A;  2E8A A;  2LR3 A;  4UAE F;  4HWI A;  2E2F A;  1VNB A;  1NGH A;  1WMT A;  3FZL A;  5F2R A;  3KHW A;  3LDL A;  1L4V A;  1PE4 A;  2MN5 A;  3HSC A;  2K35 A;  1PX9 A;  4FSV A;  5FPN A;  1NGF A;  2D56 A;  4UAF E;  4AB0 A;  5F0X A;  3E7U X;  1TI5 A;  3KOY A;  2KBJ A;  1T7E A;  1ATR A;  2LY5 A;  5AQZ A;  1BK8 A;  1YUW A;  1QQM A;  2ASC A;  5AQX A;  5BPM A;  2KHO A;  1BMR A;  1JZB A;  1I2U A;  2B3C A;  1KAX A;  3C7N A;  2I61 A;  5FPM A;  1CN2 A;  1HX1 A;  2LT8 A;  1NGB A;  1KAZ A;  3KC6 A;  2JDQ D;  5BN9 A;  1NGD A;  2SN3 A;  5AQR A;  2E3G A;  3LDO A;  2QWQ A;  3D2F B;  1BRZ A;  3ATU A;  2KPY A;  1WT7 A;  2N2Q A;  2KBK A;  1N4N A;  1VNA A;  2N66 A;  2QWL A;  1I6F A;  2YIL A;  1AHO A;  2QXL A;  3FZF A;  1NPI A;  1I6G A;  3FZH A;  1NGI A;  5AQW A;  2E0H A;  2YIO A;  2E3F A;  2E88 A;  2V7Z A;  3LDN A;  3QFP A;  1OZZ A;  1NGJ A;  1UGL A;  2YEO A;  1DQ7 A;  2QWO A;  2KBH A;  1HPM A;  2LN8 A;  3CW4 A;  4H5W A;  1JKZ A;  1JXC A;  5FPD A;  3L56 A;  5AQN A;  4AAZ A;  1AYJ A;  1K8B A;  3KOZ A;  5AQU A;  1ZU3 A;  3I33 A;  4H5V A;  1P00 A;  5AQY A;  5AQT A;  5AQP A;  3FE1 A;  4HHF A;  1BA1 A;  1ICA A;  4H5R A;  2LI7 A;  3M3Z A;  1ZVG A;  5AQQ A;  5CY0 A;  5EVZ A;  5EX5 A;  4UJ0 A;  5EXW A;  2MBK A;  2VY6 A;  1B7D A;  4H5N A;  3QFU A;  1DKG D;  1SN1 A;  1BA0 A;  2LJM A;  3ATV A;  3BK3 C;  5AQS A;  4KBO A;  1NGA A;  1NE5 A;  2M8B B;  2N69 A;  2NY9 X;  1NRB A;  3CQX A;  3D2F A;  1JZA A;  3QI7 A;  1ZUT A;  5AQF A;  1T0Z A;  1KV0 A;  1ZYW A;  3D2E B;  1NRA A;  1T7B A;  1BUP A;  1C56 A;  3FZK A;  3KVG A;  2BUP A;  2QWM A;  5AQJ A;  1FH3 A;  3KOW A;  2G2K A;  2N2R A;  2YC1 C;  3L4I A;  2MZ0 A;  1ZVE A;  2QWR A;  3FZM A;  3KP1 A;  3LDP A;  3R2V A;  2LKB A;  3LDQ A;  4FL9 A;  3KOX A;  1LQH A;  2LY6 A;  1ZYV A;  2BRZ A;  3GKU A;  1NGC A;  3QML A;  3PSM A;  1T1T A;  4IO8 A;  2A7T A;  1CHZ A;  1NGE A;  5AQM A;  5AQO A;  4UAD E;  4V1D C;  1P0A A;  1B3C A;  3GDQ A;  5BPN A;  1BCG A;  1LQQ A;  2YBR C;  1KAY A;  1QQN A;  4CQK A;  5AR0 A;  5EY4 A;  3C7N B;  2B68 A;  1NGG A;  3KP0 A;  5KK4 A;  1POI A;  1PTX A;  5AQG A;  2YIP A;  3L6Q A;  2QWP A;  1T7A A;  2QW9 A;  5AQI A;  3SF4 D;  5BPL A;  4HE7 A;  1LQI A;  3IUC A;  1S3X A;  1WWN A;  3JXU A;  4GNI A;  1OMY A;  1SEG A;  1SN4 A;  2KJA A;  3D2E A;  4KYP A;  3A8Y A;  2GMO A;  3E7R L;  5AQV A;  4AEI A;  5AQK A;  2LJ7 A;  1NH5 A;  4H5T A;  2GL1 A;  2KSK A;  1SNB A;  5AQH A;  1ATS A;  5FPE A;  2ATB A;  3AY9 A; 
#chains in the Genus database with same CATH homology
 1MYN A;  2KGQ A;  1DJT A;  1MR4 A;  1I2V A;  2NY8 X;  1GPS A;  1C55 A;  2KYQ A;  1GPT A;  1ZFU A;  2LR3 A;  1VNB A;  1WMT A;  1L4V A;  1PE4 A;  1PX9 A;  4AB0 A;  3E7U X;  1TI5 A;  2KBJ A;  1T7E A;  2LY5 A;  1BK8 A;  2ASC A;  1BMR A;  1I2U A;  1JZB A;  2B3C A;  2I61 A;  1CN2 A;  2LT8 A;  2SN3 A;  2E3G A;  1BRZ A;  2KPY A;  1WT7 A;  2N2Q A;  2KBK A;  1N4N A;  1VNA A;  2N66 A;  1I6G A;  1I6F A;  1AHO A;  1NPI A;  2E0H A;  2E3F A;  1OZZ A;  2YEO A;  1DQ7 A;  2KBH A;  1JKZ A;  1JXC A;  4AAZ A;  1AYJ A;  1ZU3 A;  1P00 A;  4HHF A;  1ICA A;  2LI7 A;  1ZVG A;  5CY0 A;  4UJ0 A;  1B7D A;  2LJM A;  1SN1 A;  2M8B B;  1NE5 A;  2N69 A;  2NY9 X;  1NRB A;  1JZA A;  1ZUT A;  1T0Z A;  1KV0 A;  1ZYW A;  1NRA A;  1T7B A;  1C56 A;  1FH3 A;  2YC1 C;  2N2R A;  2MZ0 A;  1ZVE A;  2LKB A;  1LQH A;  2LY6 A;  1ZYV A;  2BRZ A;  3PSM A;  1T1T A;  2A7T A;  1CHZ A;  4V1D C;  1P0A A;  1B3C A;  1BCG A;  1LQQ A;  2YBR C;  4CQK A;  2B68 A;  5KK4 A;  1PTX A;  1T7A A;  4HE7 A;  1LQI A;  1WWN A;  1OMY A;  1SEG A;  1SN4 A;  2KJA A;  4KYP A;  4AEI A;  3E7R L;  2LJ7 A;  1NH5 A;  2GL1 A;  2KSK A;  1SNB A;  2ATB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...