2BRZA

Solution nmr structure of the sweet protein brazzein, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
EDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRAZZEIN
publication title Solution structure of the thermostable sweet-tasting protein brazzein.
pubmed doi rcsb
molecule tags Sweet protein
total genus 7
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1998-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2brzA00
2KGQA 1PX9A 1OMYA 4V1DC 2B3CA 2SN3A 2N66A 1T7AA 4UJ0A 1WWNA 1SEGA 2KSKA 1AYJA 2N69A 1NRBA 1AHOA 1SN4A 1SNBA 2NY8X 2E3GA 1N4NA 2LY5A 4HE7A 2YBRC 1P00A 2KPYA 1I2UA 2B68A 2E0HA 1B7DA 2LT8A 4CQKA 1BCGA 1PE4A 1JZAA 1ZVGA 1GPSA 1VNBA 4HHFA 4AAZA 2LKBA 1JKZA 5CY0A 1ZU3A 4AB0A 2LJMA 2LJ7A 2BRZA 1ZFUA 1T1TA 1L4VA 1CHZA 5KK4A 1ZYVA 1LQHA 1NRAA 2NY9X 1BRZA 3E7UX 1DJTA 1ZYWA 1BMRA 2E3FA 1C56A 2LI7A 1T0ZA 3PSMA 1I6FA 1NPIA 1P0AA 1LQIA 1DQ7A 1I6GA 1LQQA 1OZZA 1PTXA 2A7TA 1ZVEA 1ICAA 1MYNA 1ZUTA 2ASCA 2LY6A 2MZ0A 1B3CA 3E7RL 1T7BA 1SN1A 1JZBA 4KYPA 2YC1C 2LR3A 1NH5A 2KYQA 1FH3A 1VNAA 1BK8A 2KBKA 1WT7A 1MR4A 2GL1A 1T7EA 1WMTA 2YEOA 2N2QA 1CN2A 1TI5A 2KBHA 2M8BB 2I61A 1JXCA 2KJAA 1GPTA 4AEIA 1I2VA 1NE5A 2N2RA 1C55A 2ATBA 2KBJA 1KV0A
chains in the Genus database with same CATH superfamily
3KP1A 2KGQA 1PX9A 1HPMA 1OMYA 3L4IA 2B3CA 2SN3A 4V1DC 5AQHA 5AQJA 1QQOA 2MN5A 2N66A 5AQNA 3SF4D 1T7AA 3JXUA 5AQIA 5AQQA 3LDQA 4UJ0A 5F0XA 1WWNA 1SEGA 2E2FA 4UAEF 5AQUA 1S3XA 2KSKA 5AQWA 3KP0A 1NGDA 1AYJA 2N69A 2JDQD 1NRBA 3QFUA 2QWLA 2KHOA 5FPEA 2G2KA 1AHOA 1SN4A 2QWRA 1SNBA 3KOWA 3R2VA 3ATVA 5AQTA 1NGHA 2NY8X 5F2RA 1NGBA 2YIOA 4GNIA 2E3GA 1N4NA 2LY5A 4HE7A 3FE1A 5AQFA 3FZFA 5AQXA 1NGCA 2YBRC 3A8YA 5AQOA 4KBOA 1P00A 5AQKA 2KPYA 3BK3C 2B68A 3GDQA 2E0HA 3L56A 5FPDA 5EXWA 1I2UA 3FZKA 2QWQA 1HJOA 1B7DA 2LT8A 3CW4A 3QFPA 1BA1A 5AQGA 1UGLA 4CQKA 1BCGA 1PE4A 1NGAA 1NGEA 4UADE 1JZAA 5BPMA 1ZVGA 3FZMA 3KOZA 3I33A 1GPSA 1VNBA 3KVGA 4H5RA 1KAZA 1BA0A 3D2EA 2LN8A 4HHFA 4AAZA 3M3ZA 3D2FA 4UAFE 2LKBA 1KAYA 3CQXA 1JKZA 5CY0A 5EY4A 2K35A 3KC6A 3GKUA 1HX1A 1ZU3A 1B3CA 1QQMA 4AB0A 2LJMA 4H5NA 2LJ7A 1BUPA 2BRZA 3D2EB 1ATRA 1T1TA 1ZFUA 2YILA 1L4VA 1CHZA 5KK4A 5FPMA 2QWMA 2QWPA 2GMOA 1ZYVA 5BPLA 1LQHA 1NRAA 2NY9X 3LDLA 5BN8A 1BRZA 3LDNA 3E7UX 1DJTA 2QW9A 1YUWA 2BUPA 4FSVA 3C7NA 1ZYWA 2QWNA 2E3FA 4H5VA 5AQRA 5BPNA 1BMRA 1C56A 2LI7A 1KAXA 1T0ZA 3PSMA 2N2RA 1I6FA 1NPIA 1P0AA 1LQIA 1DQ7A 3LDOA 1XRSB 3FZHA 1I6GA 1LQQA 3L6QA 3ATUA 5EVZA 3HSCA 1NGGA 1OZZA 1PTXA 1DKGD 1ZVEA 2A7TA 3FZLA 3GL1A 4H5WA 1ICAA 1MYNA 5AQMA 1ZUTA 1NGFA 2ASCA 2MBKA 2LY6A 2MZ0A 3AY9A 3E7RL 1T7BA 1ATSA 1SN1A 1JZBA 2VY6A 3IUCA 4KYPA 5AQPA 5AQVA 3D2FB 2YC1C 2LR3A 5F1XA 1NH5A 2KYQA 1QQNA 1FH3A 1VNAA 5AR0A 2KBKA 1BK8A 3QI7A 1WT7A 1MR4A 2E8AA 2GL1A 5AQZA 1T7EA 1WMTA 2YEOA 2N2QA 3LDPA 5FPNA 1K8BA 1CN2A 1TI5A 1NGIA 2KBHA 5EX5A 4IO8A 5AQSA 3KHWA 2E88A 2QXLA 2D56A 3C7NB 2M8BB 5BN9A 2I61A 2QWOA 1JXCA 4HWIA 2KJAA 3KOYA 4FL9A 4H5TA 1GPTA 3KOXA 3QMLA 4AEIA 1I2VA 5AQLA 1NE5A 2YIPA 1POIA 2V7ZA 5AQYA 1NGJA 1C55A 2ATBA 2KBJA 1KV0A
chains in the Genus database with same CATH topology
2KGQA 1PX9A 1OMYA 4V1DC 2B3CA 2SN3A 2N66A 1T7AA 4UJ0A 1WWNA 1SEGA 2KSKA 1AYJA 2N69A 1NRBA 1AHOA 1SN4A 1SNBA 2NY8X 2E3GA 1N4NA 2LY5A 4HE7A 2YBRC 1P00A 2KPYA 1I2UA 2B68A 2E0HA 1B7DA 2LT8A 4CQKA 1BCGA 1PE4A 1JZAA 1ZVGA 1GPSA 1VNBA 4HHFA 4AAZA 2LKBA 1JKZA 5CY0A 1ZU3A 4AB0A 2LJMA 2LJ7A 2BRZA 1ZFUA 1T1TA 1L4VA 1CHZA 5KK4A 1ZYVA 1LQHA 1NRAA 2NY9X 1BRZA 3E7UX 1DJTA 1ZYWA 1BMRA 2E3FA 1C56A 2LI7A 1T0ZA 3PSMA 1I6FA 1NPIA 1P0AA 1LQIA 1DQ7A 1I6GA 1LQQA 1OZZA 1PTXA 2A7TA 1ZVEA 1ICAA 1MYNA 1ZUTA 2ASCA 2LY6A 2MZ0A 1B3CA 3E7RL 1T7BA 1SN1A 1JZBA 4KYPA 2YC1C 2LR3A 1NH5A 2KYQA 1FH3A 1VNAA 1BK8A 2KBKA 1WT7A 1MR4A 2GL1A 1T7EA 1WMTA 2YEOA 2N2QA 1CN2A 1TI5A 2KBHA 2M8BB 2I61A 1JXCA 2KJAA 1GPTA 4AEIA 1I2VA 1NE5A 2N2RA 1C55A 2ATBA 2KBJA 1KV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGQ A;  1PX9 A;  1OMY A;  4V1D C;  2B3C A;  2SN3 A;  2N66 A;  1T7A A;  4UJ0 A;  1WWN A;  1SEG A;  2KSK A;  1AYJ A;  2N69 A;  1NRB A;  1AHO A;  1SN4 A;  1SNB A;  2NY8 X;  2E3G A;  1N4N A;  2LY5 A;  4HE7 A;  2YBR C;  1P00 A;  2KPY A;  1I2U A;  2B68 A;  2E0H A;  1B7D A;  2LT8 A;  4CQK A;  1BCG A;  1PE4 A;  1JZA A;  1ZVG A;  1GPS A;  1VNB A;  4HHF A;  4AAZ A;  2LKB A;  1JKZ A;  5CY0 A;  1ZU3 A;  4AB0 A;  2LJM A;  2LJ7 A;  2BRZ A;  1ZFU A;  1T1T A;  1L4V A;  1CHZ A;  5KK4 A;  1ZYV A;  1LQH A;  1NRA A;  2NY9 X;  1BRZ A;  3E7U X;  1DJT A;  1ZYW A;  1BMR A;  2E3F A;  1C56 A;  2LI7 A;  1T0Z A;  3PSM A;  1I6F A;  1NPI A;  1P0A A;  1LQI A;  1DQ7 A;  1I6G A;  1LQQ A;  1OZZ A;  1PTX A;  2A7T A;  1ZVE A;  1ICA A;  1MYN A;  1ZUT A;  2ASC A;  2LY6 A;  2MZ0 A;  1B3C A;  3E7R L;  1T7B A;  1SN1 A;  1JZB A;  4KYP A;  2YC1 C;  2LR3 A;  1NH5 A;  2KYQ A;  1FH3 A;  1VNA A;  1BK8 A;  2KBK A;  1WT7 A;  1MR4 A;  2GL1 A;  1T7E A;  1WMT A;  2YEO A;  2N2Q A;  1CN2 A;  1TI5 A;  2KBH A;  2M8B B;  2I61 A;  1JXC A;  2KJA A;  1GPT A;  4AEI A;  1I2V A;  1NE5 A;  2N2R A;  1C55 A;  2ATB A;  2KBJ A;  1KV0 A; 
#chains in the Genus database with same CATH topology
 3KP1 A;  2KGQ A;  1PX9 A;  1HPM A;  1OMY A;  3L4I A;  2B3C A;  2SN3 A;  4V1D C;  5AQH A;  5AQJ A;  1QQO A;  2MN5 A;  2N66 A;  5AQN A;  3SF4 D;  1T7A A;  3JXU A;  5AQI A;  5AQQ A;  3LDQ A;  4UJ0 A;  5F0X A;  1WWN A;  1SEG A;  2E2F A;  4UAE F;  5AQU A;  1S3X A;  2KSK A;  5AQW A;  3KP0 A;  1NGD A;  1AYJ A;  2N69 A;  2JDQ D;  1NRB A;  3QFU A;  2QWL A;  2KHO A;  5FPE A;  2G2K A;  1AHO A;  1SN4 A;  2QWR A;  1SNB A;  3KOW A;  3R2V A;  3ATV A;  5AQT A;  1NGH A;  2NY8 X;  5F2R A;  1NGB A;  2YIO A;  4GNI A;  2E3G A;  1N4N A;  2LY5 A;  4HE7 A;  3FE1 A;  5AQF A;  3FZF A;  5AQX A;  1NGC A;  2YBR C;  3A8Y A;  5AQO A;  4KBO A;  1P00 A;  5AQK A;  2KPY A;  3BK3 C;  2B68 A;  3GDQ A;  2E0H A;  3L56 A;  5FPD A;  5EXW A;  1I2U A;  3FZK A;  2QWQ A;  1HJO A;  1B7D A;  2LT8 A;  3CW4 A;  3QFP A;  1BA1 A;  5AQG A;  1UGL A;  4CQK A;  1BCG A;  1PE4 A;  1NGA A;  1NGE A;  4UAD E;  1JZA A;  5BPM A;  1ZVG A;  3FZM A;  3KOZ A;  3I33 A;  1GPS A;  1VNB A;  3KVG A;  4H5R A;  1KAZ A;  1BA0 A;  3D2E A;  2LN8 A;  4HHF A;  4AAZ A;  3M3Z A;  3D2F A;  4UAF E;  2LKB A;  1KAY A;  3CQX A;  1JKZ A;  5CY0 A;  5EY4 A;  2K35 A;  3KC6 A;  3GKU A;  1HX1 A;  1ZU3 A;  1B3C A;  1QQM A;  4AB0 A;  2LJM A;  4H5N A;  2LJ7 A;  1BUP A;  2BRZ A;  3D2E B;  1ATR A;  1T1T A;  1ZFU A;  2YIL A;  1L4V A;  1CHZ A;  5KK4 A;  5FPM A;  2QWM A;  2QWP A;  2GMO A;  1ZYV A;  5BPL A;  1LQH A;  1NRA A;  2NY9 X;  3LDL A;  5BN8 A;  1BRZ A;  3LDN A;  3E7U X;  1DJT A;  2QW9 A;  1YUW A;  2BUP A;  4FSV A;  3C7N A;  1ZYW A;  2QWN A;  2E3F A;  4H5V A;  5AQR A;  5BPN A;  1BMR A;  1C56 A;  2LI7 A;  1KAX A;  1T0Z A;  3PSM A;  2N2R A;  1I6F A;  1NPI A;  1P0A A;  1LQI A;  1DQ7 A;  3LDO A;  1XRS B;  3FZH A;  1I6G A;  1LQQ A;  3L6Q A;  3ATU A;  5EVZ A;  3HSC A;  1NGG A;  1OZZ A;  1PTX A;  1DKG D;  1ZVE A;  2A7T A;  3FZL A;  3GL1 A;  4H5W A;  1ICA A;  1MYN A;  5AQM A;  1ZUT A;  1NGF A;  2ASC A;  2MBK A;  2LY6 A;  2MZ0 A;  3AY9 A;  3E7R L;  1T7B A;  1ATS A;  1SN1 A;  1JZB A;  2VY6 A;  3IUC A;  4KYP A;  5AQP A;  5AQV A;  3D2F B;  2YC1 C;  2LR3 A;  5F1X A;  1NH5 A;  2KYQ A;  1QQN A;  1FH3 A;  1VNA A;  5AR0 A;  2KBK A;  1BK8 A;  3QI7 A;  1WT7 A;  1MR4 A;  2E8A A;  2GL1 A;  5AQZ A;  1T7E A;  1WMT A;  2YEO A;  2N2Q A;  3LDP A;  5FPN A;  1K8B A;  1CN2 A;  1TI5 A;  1NGI A;  2KBH A;  5EX5 A;  4IO8 A;  5AQS A;  3KHW A;  2E88 A;  2QXL A;  2D56 A;  3C7N B;  2M8B B;  5BN9 A;  2I61 A;  2QWO A;  1JXC A;  4HWI A;  2KJA A;  3KOY A;  4FL9 A;  4H5T A;  1GPT A;  3KOX A;  3QML A;  4AEI A;  1I2V A;  5AQL A;  1NE5 A;  2YIP A;  1POI A;  2V7Z A;  5AQY A;  1NGJ A;  1C55 A;  2ATB A;  2KBJ A;  1KV0 A; 
#chains in the Genus database with same CATH homology
 2KGQ A;  1PX9 A;  1OMY A;  4V1D C;  2B3C A;  2SN3 A;  2N66 A;  1T7A A;  4UJ0 A;  1WWN A;  1SEG A;  2KSK A;  1AYJ A;  2N69 A;  1NRB A;  1AHO A;  1SN4 A;  1SNB A;  2NY8 X;  2E3G A;  1N4N A;  2LY5 A;  4HE7 A;  2YBR C;  1P00 A;  2KPY A;  1I2U A;  2B68 A;  2E0H A;  1B7D A;  2LT8 A;  4CQK A;  1BCG A;  1PE4 A;  1JZA A;  1ZVG A;  1GPS A;  1VNB A;  4HHF A;  4AAZ A;  2LKB A;  1JKZ A;  5CY0 A;  1ZU3 A;  4AB0 A;  2LJM A;  2LJ7 A;  2BRZ A;  1ZFU A;  1T1T A;  1L4V A;  1CHZ A;  5KK4 A;  1ZYV A;  1LQH A;  1NRA A;  2NY9 X;  1BRZ A;  3E7U X;  1DJT A;  1ZYW A;  1BMR A;  2E3F A;  1C56 A;  2LI7 A;  1T0Z A;  3PSM A;  1I6F A;  1NPI A;  1P0A A;  1LQI A;  1DQ7 A;  1I6G A;  1LQQ A;  1OZZ A;  1PTX A;  2A7T A;  1ZVE A;  1ICA A;  1MYN A;  1ZUT A;  2ASC A;  2LY6 A;  2MZ0 A;  1B3C A;  3E7R L;  1T7B A;  1SN1 A;  1JZB A;  4KYP A;  2YC1 C;  2LR3 A;  1NH5 A;  2KYQ A;  1FH3 A;  1VNA A;  1BK8 A;  2KBK A;  1WT7 A;  1MR4 A;  2GL1 A;  1T7E A;  1WMT A;  2YEO A;  2N2Q A;  1CN2 A;  1TI5 A;  2KBH A;  2M8B B;  2I61 A;  1JXC A;  2KJA A;  1GPT A;  4AEI A;  1I2V A;  1NE5 A;  2N2R A;  1C55 A;  2ATB A;  2KBJ A;  1KV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...