2BRZA

Solution nmr structure of the sweet protein brazzein, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
EDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sweet protein
molecule keywords BRAZZEIN
publication title Solution structure of the thermostable sweet-tasting protein brazzein.
pubmed doi rcsb
total genus 7
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1998-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2brzA00
1MR4A 1LQHA 2SN3A 1SNBA 2BRZA 2KBKA 4UJ0A 1AHOA 1WWNA 2KPYA 3E7RL 1TI5A 2KYQA 2MZ0A 2LY6A 2E0HA 2ASCA 1B3CA 1DQ7A 1NE5A 2LI7A 1PE4A 2KBHA 1T0ZA 1ZVEA 4CQKA 1ZYWA 2E3GA 1NRBA 5KK4A 5CY0A 2I61A 2YC1C 2LT8A 1I2UA 1NH5A 1ZUTA 1LQIA 1CHZA 2KGQA 1DJTA 4KYPA 1VNBA 2GL1A 2YBRC 2N2QA 1I6FA 1MYNA 2B3CA 1ZFUA 2ATBA 1C55A 1B7DA 1BK8A 1VNAA 2N66A 1KV0A 1I6GA 4AAZA 1P0AA 1NRAA 2LY5A 1PTXA 2N69A 1JZBA 2YEOA 1ZU3A 1P00A 1T7EA 3E7UX 4AB0A 1JKZA 1FH3A 2LJMA 4HHFA 1PX9A 1SN1A 4AEIA 1AYJA 1T1TA 2A7TA 1ICAA 1LQQA 2LKBA 2M8BB 1L4VA 2B68A 1ZVGA 3PSMA 1BCGA 2NY8X 2NY9X 2N2RA 1ZYVA 1BRZA 1WT7A 4V1DC 1T7BA 1BMRA 2KSKA 1OZZA 2LJ7A 1T7AA 4HE7A 1NPIA 1CN2A 1N4NA 2LR3A 2E3FA 1SN4A 1JXCA 1I2VA 1JZAA 1C56A 1GPTA 2KJAA 1GPSA 2KBJA 1OMYA 1SEGA 1WMTA
chains in the Genus database with same CATH superfamily
1BA1A 1HX1A 1MR4A 1LQHA 5AQFA 2SN3A 1SNBA 2QWNA 2BRZA 2KBKA 3C7NB 4UJ0A 3C7NA 1WWNA 1AHOA 1NGFA 2KPYA 3E7RL 1TI5A 4KBOA 2KYQA 2QWOA 1NGAA 3QFUA 1KAYA 1BA0A 2MZ0A 4H5VA 3ATVA 4H5NA 5AQXA 5EXWA 1QQOA 1HJOA 2LY6A 4HWIA 5EX5A 2D56A 2E0HA 3ATUA 5AQKA 3LDPA 2ASCA 1B3CA 5AQJA 1DQ7A 2QW9A 5F0XA 2MBKA 1NE5A 2LI7A 1UGLA 3D2FB 4IO8A 1PE4A 3D2FA 2KBHA 1T0ZA 1ZVEA 2JDQD 1ZYWA 3QI7A 5FPMA 4CQKA 2E3GA 1NRBA 5KK4A 2QWRA 5BN9A 3LDNA 5CY0A 2I61A 2BUPA 1KAXA 2YC1C 3FZFA 4GNIA 2YILA 2LT8A 5EVZA 1I2UA 3KOWA 3LDOA 1NH5A 2V7ZA 1ZUTA 1LQIA 2E2FA 3KP1A 2G2KA 1CHZA 2KGQA 1HPMA 2MN5A 1QQNA 3FZLA 1QQMA 1DJTA 2VY6A 3FZKA 2E8AA 2K35A 3LDQA 4KYPA 1VNBA 2GL1A 2YBRC 2N2QA 1ATSA 1I6FA 1MYNA 2B3CA 3QMLA 5AQTA 3GDQA 3QFPA 5AQZA 1ZFUA 2ATBA 3A8YA 5AR0A 3KOZA 4H5TA 1C55A 1YUWA 2QWQA 1NGCA 5AQLA 3FZHA 4FSVA 1B7DA 2E88A 1VNAA 1NGHA 5AQVA 2QWPA 1BK8A 2N66A 5AQSA 1KV0A 1S3XA 3KC6A 1I6GA 1ATRA 2YIOA 3M3ZA 4AAZA 1P0AA 3IUCA 3AY9A 1NRAA 2LY5A 1PTXA 2N69A 1JZBA 2YEOA 3CQXA 1ZU3A 2LN8A 2QXLA 3KHWA 5AQPA 5AQUA 3CW4A 1P00A 1T7EA 3D2EA 3KVGA 5FPNA 5AQHA 3E7UX 4AB0A 1JKZA 3L4IA 5FPDA 2GMOA 1FH3A 4FL9A 2LJMA 4HHFA 5AQYA 1PX9A 1SN1A 4AEIA 3KOXA 1AYJA 5AQOA 1T1TA 5AQNA 2A7TA 1ICAA 1LQQA 2QWMA 1NGBA 2LKBA 2M8BB 5AQRA 1L4VA 5BPMA 2B68A 1ZVGA 2KHOA 1BCGA 2NY8X 2QWLA 3PSMA 5AQQA 5F1XA 2NY9X 1DKGD 1NGEA 2N2RA 5BN8A 1ZYVA 4H5RA 1BRZA 1WT7A 1NGJA 4V1DC 3SF4D 3KOYA 1T7BA 3FE1A 2KSKA 3FZMA 1OZZA 3R2VA 2LJ7A 1BMRA 1K8BA 1T7AA 5BPLA 1NGIA 1XRSB 3D2EB 3KP0A 4HE7A 1NPIA 3L56A 4UAEF 5AQWA 3GKUA 3L6QA 1CN2A 1N4NA 2LR3A 5AQIA 1KAZA 1NGGA 3I33A 4UAFE 5BPNA 3HSCA 2E3FA 1SN4A 3JXUA 1JXCA 1POIA 1JZAA 1BUPA 1C56A 3LDLA 2KJAA 5EY4A 1GPTA 1I2VA 4UADE 1GPSA 2YIPA 5AQMA 3BK3C 5AQGA 2KBJA 1OMYA 3GL1A 4H5WA 1NGDA 5FPEA 1SEGA 1WMTA 5F2RA
chains in the Genus database with same CATH topology
1MR4A 1LQHA 2SN3A 1SNBA 2BRZA 2KBKA 4UJ0A 1AHOA 1WWNA 2KPYA 3E7RL 1TI5A 2KYQA 2MZ0A 2LY6A 2E0HA 2ASCA 1B3CA 1DQ7A 1NE5A 2LI7A 1PE4A 2KBHA 1T0ZA 1ZVEA 4CQKA 1ZYWA 2E3GA 1NRBA 5KK4A 5CY0A 2I61A 2YC1C 2LT8A 1I2UA 1NH5A 1ZUTA 1LQIA 1CHZA 2KGQA 1DJTA 4KYPA 1VNBA 2GL1A 2YBRC 2N2QA 1I6FA 1MYNA 2B3CA 1ZFUA 2ATBA 1C55A 1B7DA 1BK8A 1VNAA 2N66A 1KV0A 1I6GA 4AAZA 1P0AA 1NRAA 2LY5A 1PTXA 2N69A 1JZBA 2YEOA 1ZU3A 1P00A 1T7EA 3E7UX 4AB0A 1JKZA 1FH3A 2LJMA 4HHFA 1PX9A 1SN1A 4AEIA 1AYJA 1T1TA 2A7TA 1ICAA 1LQQA 2LKBA 2M8BB 1L4VA 2B68A 1ZVGA 3PSMA 1BCGA 2NY8X 2NY9X 2N2RA 1ZYVA 1BRZA 1WT7A 4V1DC 1T7BA 1BMRA 2KSKA 1OZZA 2LJ7A 1T7AA 4HE7A 1NPIA 1CN2A 1N4NA 2LR3A 2E3FA 1SN4A 1JXCA 1I2VA 1JZAA 1C56A 1GPTA 2KJAA 1GPSA 2KBJA 1OMYA 1SEGA 1WMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR4 A;  1LQH A;  2SN3 A;  1SNB A;  2BRZ A;  2KBK A;  4UJ0 A;  1AHO A;  1WWN A;  2KPY A;  3E7R L;  1TI5 A;  2KYQ A;  2MZ0 A;  2LY6 A;  2E0H A;  2ASC A;  1B3C A;  1DQ7 A;  1NE5 A;  2LI7 A;  1PE4 A;  2KBH A;  1T0Z A;  1ZVE A;  4CQK A;  1ZYW A;  2E3G A;  1NRB A;  5KK4 A;  5CY0 A;  2I61 A;  2YC1 C;  2LT8 A;  1I2U A;  1NH5 A;  1ZUT A;  1LQI A;  1CHZ A;  2KGQ A;  1DJT A;  4KYP A;  1VNB A;  2GL1 A;  2YBR C;  2N2Q A;  1I6F A;  1MYN A;  2B3C A;  1ZFU A;  2ATB A;  1C55 A;  1B7D A;  1BK8 A;  1VNA A;  2N66 A;  1KV0 A;  1I6G A;  4AAZ A;  1P0A A;  1NRA A;  2LY5 A;  1PTX A;  2N69 A;  1JZB A;  2YEO A;  1ZU3 A;  1P00 A;  1T7E A;  3E7U X;  4AB0 A;  1JKZ A;  1FH3 A;  2LJM A;  4HHF A;  1PX9 A;  1SN1 A;  4AEI A;  1AYJ A;  1T1T A;  2A7T A;  1ICA A;  1LQQ A;  2LKB A;  2M8B B;  1L4V A;  2B68 A;  1ZVG A;  3PSM A;  1BCG A;  2NY8 X;  2NY9 X;  2N2R A;  1ZYV A;  1BRZ A;  1WT7 A;  4V1D C;  1T7B A;  1BMR A;  2KSK A;  1OZZ A;  2LJ7 A;  1T7A A;  4HE7 A;  1NPI A;  1CN2 A;  1N4N A;  2LR3 A;  2E3F A;  1SN4 A;  1JXC A;  1I2V A;  1JZA A;  1C56 A;  1GPT A;  2KJA A;  1GPS A;  2KBJ A;  1OMY A;  1SEG A;  1WMT A; 
#chains in the Genus database with same CATH topology
 1BA1 A;  1HX1 A;  1MR4 A;  1LQH A;  5AQF A;  2SN3 A;  1SNB A;  2QWN A;  2BRZ A;  2KBK A;  3C7N B;  4UJ0 A;  3C7N A;  1WWN A;  1AHO A;  1NGF A;  2KPY A;  3E7R L;  1TI5 A;  4KBO A;  2KYQ A;  2QWO A;  1NGA A;  3QFU A;  1KAY A;  1BA0 A;  2MZ0 A;  4H5V A;  3ATV A;  4H5N A;  5AQX A;  5EXW A;  1QQO A;  1HJO A;  2LY6 A;  4HWI A;  5EX5 A;  2D56 A;  2E0H A;  3ATU A;  5AQK A;  3LDP A;  2ASC A;  1B3C A;  5AQJ A;  1DQ7 A;  2QW9 A;  5F0X A;  2MBK A;  1NE5 A;  2LI7 A;  1UGL A;  3D2F B;  4IO8 A;  1PE4 A;  3D2F A;  2KBH A;  1T0Z A;  1ZVE A;  2JDQ D;  1ZYW A;  3QI7 A;  5FPM A;  4CQK A;  2E3G A;  1NRB A;  5KK4 A;  2QWR A;  5BN9 A;  3LDN A;  5CY0 A;  2I61 A;  2BUP A;  1KAX A;  2YC1 C;  3FZF A;  4GNI A;  2YIL A;  2LT8 A;  5EVZ A;  1I2U A;  3KOW A;  3LDO A;  1NH5 A;  2V7Z A;  1ZUT A;  1LQI A;  2E2F A;  3KP1 A;  2G2K A;  1CHZ A;  2KGQ A;  1HPM A;  2MN5 A;  1QQN A;  3FZL A;  1QQM A;  1DJT A;  2VY6 A;  3FZK A;  2E8A A;  2K35 A;  3LDQ A;  4KYP A;  1VNB A;  2GL1 A;  2YBR C;  2N2Q A;  1ATS A;  1I6F A;  1MYN A;  2B3C A;  3QML A;  5AQT A;  3GDQ A;  3QFP A;  5AQZ A;  1ZFU A;  2ATB A;  3A8Y A;  5AR0 A;  3KOZ A;  4H5T A;  1C55 A;  1YUW A;  2QWQ A;  1NGC A;  5AQL A;  3FZH A;  4FSV A;  1B7D A;  2E88 A;  1VNA A;  1NGH A;  5AQV A;  2QWP A;  1BK8 A;  2N66 A;  5AQS A;  1KV0 A;  1S3X A;  3KC6 A;  1I6G A;  1ATR A;  2YIO A;  3M3Z A;  4AAZ A;  1P0A A;  3IUC A;  3AY9 A;  1NRA A;  2LY5 A;  1PTX A;  2N69 A;  1JZB A;  2YEO A;  3CQX A;  1ZU3 A;  2LN8 A;  2QXL A;  3KHW A;  5AQP A;  5AQU A;  3CW4 A;  1P00 A;  1T7E A;  3D2E A;  3KVG A;  5FPN A;  5AQH A;  3E7U X;  4AB0 A;  1JKZ A;  3L4I A;  5FPD A;  2GMO A;  1FH3 A;  4FL9 A;  2LJM A;  4HHF A;  5AQY A;  1PX9 A;  1SN1 A;  4AEI A;  3KOX A;  1AYJ A;  5AQO A;  1T1T A;  5AQN A;  2A7T A;  1ICA A;  1LQQ A;  2QWM A;  1NGB A;  2LKB A;  2M8B B;  5AQR A;  1L4V A;  5BPM A;  2B68 A;  1ZVG A;  2KHO A;  1BCG A;  2NY8 X;  2QWL A;  3PSM A;  5AQQ A;  5F1X A;  2NY9 X;  1DKG D;  1NGE A;  2N2R A;  5BN8 A;  1ZYV A;  4H5R A;  1BRZ A;  1WT7 A;  1NGJ A;  4V1D C;  3SF4 D;  3KOY A;  1T7B A;  3FE1 A;  2KSK A;  3FZM A;  1OZZ A;  3R2V A;  2LJ7 A;  1BMR A;  1K8B A;  1T7A A;  5BPL A;  1NGI A;  1XRS B;  3D2E B;  3KP0 A;  4HE7 A;  1NPI A;  3L56 A;  4UAE F;  5AQW A;  3GKU A;  3L6Q A;  1CN2 A;  1N4N A;  2LR3 A;  5AQI A;  1KAZ A;  1NGG A;  3I33 A;  4UAF E;  5BPN A;  3HSC A;  2E3F A;  1SN4 A;  3JXU A;  1JXC A;  1POI A;  1JZA A;  1BUP A;  1C56 A;  3LDL A;  2KJA A;  5EY4 A;  1GPT A;  1I2V A;  4UAD E;  1GPS A;  2YIP A;  5AQM A;  3BK3 C;  5AQG A;  2KBJ A;  1OMY A;  3GL1 A;  4H5W A;  1NGD A;  5FPE A;  1SEG A;  1WMT A;  5F2R A; 
#chains in the Genus database with same CATH homology
 1MR4 A;  1LQH A;  2SN3 A;  1SNB A;  2BRZ A;  2KBK A;  4UJ0 A;  1AHO A;  1WWN A;  2KPY A;  3E7R L;  1TI5 A;  2KYQ A;  2MZ0 A;  2LY6 A;  2E0H A;  2ASC A;  1B3C A;  1DQ7 A;  1NE5 A;  2LI7 A;  1PE4 A;  2KBH A;  1T0Z A;  1ZVE A;  4CQK A;  1ZYW A;  2E3G A;  1NRB A;  5KK4 A;  5CY0 A;  2I61 A;  2YC1 C;  2LT8 A;  1I2U A;  1NH5 A;  1ZUT A;  1LQI A;  1CHZ A;  2KGQ A;  1DJT A;  4KYP A;  1VNB A;  2GL1 A;  2YBR C;  2N2Q A;  1I6F A;  1MYN A;  2B3C A;  1ZFU A;  2ATB A;  1C55 A;  1B7D A;  1BK8 A;  1VNA A;  2N66 A;  1KV0 A;  1I6G A;  4AAZ A;  1P0A A;  1NRA A;  2LY5 A;  1PTX A;  2N69 A;  1JZB A;  2YEO A;  1ZU3 A;  1P00 A;  1T7E A;  3E7U X;  4AB0 A;  1JKZ A;  1FH3 A;  2LJM A;  4HHF A;  1PX9 A;  1SN1 A;  4AEI A;  1AYJ A;  1T1T A;  2A7T A;  1ICA A;  1LQQ A;  2LKB A;  2M8B B;  1L4V A;  2B68 A;  1ZVG A;  3PSM A;  1BCG A;  2NY8 X;  2NY9 X;  2N2R A;  1ZYV A;  1BRZ A;  1WT7 A;  4V1D C;  1T7B A;  1BMR A;  2KSK A;  1OZZ A;  2LJ7 A;  1T7A A;  4HE7 A;  1NPI A;  1CN2 A;  1N4N A;  2LR3 A;  2E3F A;  1SN4 A;  1JXC A;  1I2V A;  1JZA A;  1C56 A;  1GPT A;  2KJA A;  1GPS A;  2KBJ A;  1OMY A;  1SEG A;  1WMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...