1FH3A

Nmr structures of lqh iii alpha-like scorpion toxin from leiurus quinquestriatus corresponding to the major conformer in solution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
VRDGYIAQPENCVYHCFPGSSGCDTLCKEKGGTSGHCGFKVGHGLACWCNALPDNVGIIVEGEKCHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords LQH III ALPHA-LIKE TOXIN
publication title A Cis-trans Isomerism of a Non-prolyl Peptide Bond in Lqh III Alpha-like Scorpion Toxin Revealed by Solution NMR
rcsb
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1fh3A00
1I6GA 2LJMA 4AB0A 2LY6A 2LT8A 1VNAA 2LY5A 2NY8X 1JZBA 1NH5A 1I2VA 2E0HA 1LQQA 1T7BA 1PE4A 2B68A 2LJ7A 1B7DA 1P0AA 2E3FA 1LQHA 2N2QA 1BCGA 1P00A 1AYJA 2N69A 1PX9A 1T7EA 1NE5A 1PTXA 2KBHA 4HHFA 1L4VA 1BRZA 1VNBA 1SNBA 1I6FA 2YC1C 4AAZA 1JXCA 1DJTA 1OMYA 3E7RL 2BRZA 4AEIA 2KPYA 4V1DC 1NRAA 1MR4A 5KK4A 1TI5A 1ZFUA 1LQIA 1ICAA 1WWNA 4HE7A 1CHZA 2N2RA 1ZYVA 2E3GA 1C56A 1KV0A 2KYQA 1FH3A 1ZVEA 2I61A 2KGQA 1CN2A 1SN4A 1SN1A 2A7TA 2N66A 1OZZA 2KBJA 2KSKA 2YEOA 1ZU3A 1ZVGA 2ATBA 3PSMA 2NY9X 1GPSA 1T1TA 1GPTA 1T7AA 2M8BB 2B3CA 1B3CA 1MYNA 3E7UX 1ZUTA 5CY0A 2LKBA 1ZYWA 1BK8A 1JZAA 4CQKA 1T0ZA 2SN3A 2KBKA 1NRBA 2LR3A 1N4NA 1I2UA 2GL1A 2LI7A 1NPIA 2YBRC 1BMRA 4KYPA 1JKZA 1C55A 4UJ0A 1DQ7A 2KJAA 1WT7A 2ASCA 1SEGA 2MZ0A 1AHOA 1WMTA
chains in the Genus database with same CATH superfamily
1I6GA 2LJMA 5AQXA 4AB0A 2BUPA 2LY6A 2LT8A 1NGFA 2V7ZA 4KBOA 2JDQD 5AQPA 1NGHA 1VNAA 2MBKA 3LDQA 2LY5A 2NY8X 1JZBA 1NH5A 3JXUA 1I2VA 2E0HA 3LDLA 1LQQA 4UAEF 4H5NA 3HSCA 3C7NA 1QQOA 3C7NB 3CW4A 2YIOA 3FZFA 3LDNA 3A8YA 5BN9A 1T7BA 1NGJA 1PE4A 2MN5A 1ATRA 2B68A 1KAXA 2LJ7A 1B7DA 3GL1A 1POIA 1P0AA 2E3FA 1LQHA 2N2QA 3L6QA 1BCGA 1P00A 5AQVA 1AYJA 2N69A 1PX9A 1T7EA 1NE5A 4FL9A 1PTXA 2QWMA 3L56A 2KBHA 2K35A 5EXWA 1QQMA 4HHFA 4H5RA 5AQYA 1L4VA 5EVZA 5AQTA 3CQXA 5AR0A 1NGAA 3ATUA 1BRZA 1VNBA 2G2KA 3GDQA 1NGGA 2QWQA 3GKUA 1SNBA 1I6FA 3IUCA 5F1XA 4HWIA 3FZLA 2YC1C 4H5TA 3BK3C 5AQUA 3LDOA 3AY9A 1S3XA 3QFUA 4AAZA 2QWOA 1JXCA 5AQZA 5FPEA 1DJTA 3KOWA 1OMYA 1BUPA 3D2EA 2BRZA 3E7RL 3I33A 5FPDA 3D2EB 4AEIA 5FPMA 1NGIA 2KPYA 3FZKA 2VY6A 3R2VA 4V1DC 5AQLA 1NRAA 1MR4A 1UGLA 5KK4A 1TI5A 1ZFUA 1LQIA 3QFPA 2E2FA 3KOXA 5AQSA 5AQGA 5F2RA 1WWNA 4HE7A 1ICAA 1CHZA 2N2RA 1ZYVA 2E3GA 4H5WA 4IO8A 5AQHA 1NGDA 1C56A 4H5VA 3QMLA 1KV0A 1BA1A 4FSVA 2KYQA 3KC6A 1FH3A 1ZVEA 2I61A 2KGQA 3M3ZA 1CN2A 2KHOA 2QW9A 1SN4A 1SN1A 5BPNA 3SF4D 5AQOA 3KP0A 5BPMA 2A7TA 2E8AA 4GNIA 3FZHA 2N66A 1OZZA 3KOZA 5F0XA 5AQFA 2KBJA 1XRSB 2KSKA 2QXLA 2YEOA 1ZU3A 5AQNA 1HJOA 1BA0A 1ZVGA 2ATBA 3PSMA 2GMOA 2NY9X 5BN8A 2QWLA 3QI7A 1GPSA 5AQJA 1QQNA 3D2FA 5AQKA 3D2FB 2LN8A 1NGBA 1T1TA 1GPTA 1K8BA 1T7AA 2M8BB 2B3CA 5AQQA 1B3CA 1NGEA 2D56A 1MYNA 1DKGD 2E88A 2YILA 3L4IA 5EY4A 1ATSA 3FE1A 3E7UX 1ZUTA 4UADE 5CY0A 2LKBA 3FZMA 1ZYWA 5FPNA 3LDPA 1KAYA 3KOYA 5AQMA 1BK8A 3KHWA 1JZAA 5EX5A 4CQKA 1T0ZA 2SN3A 5AQIA 1HPMA 2KBKA 1NRBA 2LR3A 1N4NA 2QWRA 2QWPA 2GL1A 2LI7A 1I2UA 3KVGA 1NPIA 1NGCA 2YBRC 2YIPA 1BMRA 2QWNA 4UAFE 4KYPA 1HX1A 1JKZA 1C55A 1KAZA 3ATVA 4UJ0A 3KP1A 1DQ7A 2KJAA 1WT7A 5BPLA 2ASCA 5AQWA 1SEGA 2MZ0A 1YUWA 1AHOA 1WMTA 5AQRA
chains in the Genus database with same CATH topology
1I6GA 2LJMA 4AB0A 2LY6A 2LT8A 1VNAA 2LY5A 2NY8X 1JZBA 1NH5A 1I2VA 2E0HA 1LQQA 1T7BA 1PE4A 2B68A 2LJ7A 1B7DA 1P0AA 2E3FA 1LQHA 2N2QA 1BCGA 1P00A 1AYJA 2N69A 1PX9A 1T7EA 1NE5A 1PTXA 2KBHA 4HHFA 1L4VA 1BRZA 1VNBA 1SNBA 1I6FA 2YC1C 4AAZA 1JXCA 1DJTA 1OMYA 3E7RL 2BRZA 4AEIA 2KPYA 4V1DC 1NRAA 1MR4A 5KK4A 1TI5A 1ZFUA 1LQIA 1ICAA 1WWNA 4HE7A 1CHZA 2N2RA 1ZYVA 2E3GA 1C56A 1KV0A 2KYQA 1FH3A 1ZVEA 2I61A 2KGQA 1CN2A 1SN4A 1SN1A 2A7TA 2N66A 1OZZA 2KBJA 2KSKA 2YEOA 1ZU3A 1ZVGA 2ATBA 3PSMA 2NY9X 1GPSA 1T1TA 1GPTA 1T7AA 2M8BB 2B3CA 1B3CA 1MYNA 3E7UX 1ZUTA 5CY0A 2LKBA 1ZYWA 1BK8A 1JZAA 4CQKA 1T0ZA 2SN3A 2KBKA 1NRBA 2LR3A 1N4NA 1I2UA 2GL1A 2LI7A 1NPIA 2YBRC 1BMRA 4KYPA 1JKZA 1C55A 4UJ0A 1DQ7A 2KJAA 1WT7A 2ASCA 1SEGA 2MZ0A 1AHOA 1WMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6G A;  2LJM A;  4AB0 A;  2LY6 A;  2LT8 A;  1VNA A;  2LY5 A;  2NY8 X;  1JZB A;  1NH5 A;  1I2V A;  2E0H A;  1LQQ A;  1T7B A;  1PE4 A;  2B68 A;  2LJ7 A;  1B7D A;  1P0A A;  2E3F A;  1LQH A;  2N2Q A;  1BCG A;  1P00 A;  1AYJ A;  2N69 A;  1PX9 A;  1T7E A;  1NE5 A;  1PTX A;  2KBH A;  4HHF A;  1L4V A;  1BRZ A;  1VNB A;  1SNB A;  1I6F A;  2YC1 C;  4AAZ A;  1JXC A;  1DJT A;  1OMY A;  3E7R L;  2BRZ A;  4AEI A;  2KPY A;  4V1D C;  1NRA A;  1MR4 A;  5KK4 A;  1TI5 A;  1ZFU A;  1LQI A;  1ICA A;  1WWN A;  4HE7 A;  1CHZ A;  2N2R A;  1ZYV A;  2E3G A;  1C56 A;  1KV0 A;  2KYQ A;  1FH3 A;  1ZVE A;  2I61 A;  2KGQ A;  1CN2 A;  1SN4 A;  1SN1 A;  2A7T A;  2N66 A;  1OZZ A;  2KBJ A;  2KSK A;  2YEO A;  1ZU3 A;  1ZVG A;  2ATB A;  3PSM A;  2NY9 X;  1GPS A;  1T1T A;  1GPT A;  1T7A A;  2M8B B;  2B3C A;  1B3C A;  1MYN A;  3E7U X;  1ZUT A;  5CY0 A;  2LKB A;  1ZYW A;  1BK8 A;  1JZA A;  4CQK A;  1T0Z A;  2SN3 A;  2KBK A;  1NRB A;  2LR3 A;  1N4N A;  1I2U A;  2GL1 A;  2LI7 A;  1NPI A;  2YBR C;  1BMR A;  4KYP A;  1JKZ A;  1C55 A;  4UJ0 A;  1DQ7 A;  2KJA A;  1WT7 A;  2ASC A;  1SEG A;  2MZ0 A;  1AHO A;  1WMT A; 
#chains in the Genus database with same CATH topology
 1I6G A;  2LJM A;  5AQX A;  4AB0 A;  2BUP A;  2LY6 A;  2LT8 A;  1NGF A;  2V7Z A;  4KBO A;  2JDQ D;  5AQP A;  1NGH A;  1VNA A;  2MBK A;  3LDQ A;  2LY5 A;  2NY8 X;  1JZB A;  1NH5 A;  3JXU A;  1I2V A;  2E0H A;  3LDL A;  1LQQ A;  4UAE F;  4H5N A;  3HSC A;  3C7N A;  1QQO A;  3C7N B;  3CW4 A;  2YIO A;  3FZF A;  3LDN A;  3A8Y A;  5BN9 A;  1T7B A;  1NGJ A;  1PE4 A;  2MN5 A;  1ATR A;  2B68 A;  1KAX A;  2LJ7 A;  1B7D A;  3GL1 A;  1POI A;  1P0A A;  2E3F A;  1LQH A;  2N2Q A;  3L6Q A;  1BCG A;  1P00 A;  5AQV A;  1AYJ A;  2N69 A;  1PX9 A;  1T7E A;  1NE5 A;  4FL9 A;  1PTX A;  2QWM A;  3L56 A;  2KBH A;  2K35 A;  5EXW A;  1QQM A;  4HHF A;  4H5R A;  5AQY A;  1L4V A;  5EVZ A;  5AQT A;  3CQX A;  5AR0 A;  1NGA A;  3ATU A;  1BRZ A;  1VNB A;  2G2K A;  3GDQ A;  1NGG A;  2QWQ A;  3GKU A;  1SNB A;  1I6F A;  3IUC A;  5F1X A;  4HWI A;  3FZL A;  2YC1 C;  4H5T A;  3BK3 C;  5AQU A;  3LDO A;  3AY9 A;  1S3X A;  3QFU A;  4AAZ A;  2QWO A;  1JXC A;  5AQZ A;  5FPE A;  1DJT A;  3KOW A;  1OMY A;  1BUP A;  3D2E A;  2BRZ A;  3E7R L;  3I33 A;  5FPD A;  3D2E B;  4AEI A;  5FPM A;  1NGI A;  2KPY A;  3FZK A;  2VY6 A;  3R2V A;  4V1D C;  5AQL A;  1NRA A;  1MR4 A;  1UGL A;  5KK4 A;  1TI5 A;  1ZFU A;  1LQI A;  3QFP A;  2E2F A;  3KOX A;  5AQS A;  5AQG A;  5F2R A;  1WWN A;  4HE7 A;  1ICA A;  1CHZ A;  2N2R A;  1ZYV A;  2E3G A;  4H5W A;  4IO8 A;  5AQH A;  1NGD A;  1C56 A;  4H5V A;  3QML A;  1KV0 A;  1BA1 A;  4FSV A;  2KYQ A;  3KC6 A;  1FH3 A;  1ZVE A;  2I61 A;  2KGQ A;  3M3Z A;  1CN2 A;  2KHO A;  2QW9 A;  1SN4 A;  1SN1 A;  5BPN A;  3SF4 D;  5AQO A;  3KP0 A;  5BPM A;  2A7T A;  2E8A A;  4GNI A;  3FZH A;  2N66 A;  1OZZ A;  3KOZ A;  5F0X A;  5AQF A;  2KBJ A;  1XRS B;  2KSK A;  2QXL A;  2YEO A;  1ZU3 A;  5AQN A;  1HJO A;  1BA0 A;  1ZVG A;  2ATB A;  3PSM A;  2GMO A;  2NY9 X;  5BN8 A;  2QWL A;  3QI7 A;  1GPS A;  5AQJ A;  1QQN A;  3D2F A;  5AQK A;  3D2F B;  2LN8 A;  1NGB A;  1T1T A;  1GPT A;  1K8B A;  1T7A A;  2M8B B;  2B3C A;  5AQQ A;  1B3C A;  1NGE A;  2D56 A;  1MYN A;  1DKG D;  2E88 A;  2YIL A;  3L4I A;  5EY4 A;  1ATS A;  3FE1 A;  3E7U X;  1ZUT A;  4UAD E;  5CY0 A;  2LKB A;  3FZM A;  1ZYW A;  5FPN A;  3LDP A;  1KAY A;  3KOY A;  5AQM A;  1BK8 A;  3KHW A;  1JZA A;  5EX5 A;  4CQK A;  1T0Z A;  2SN3 A;  5AQI A;  1HPM A;  2KBK A;  1NRB A;  2LR3 A;  1N4N A;  2QWR A;  2QWP A;  2GL1 A;  2LI7 A;  1I2U A;  3KVG A;  1NPI A;  1NGC A;  2YBR C;  2YIP A;  1BMR A;  2QWN A;  4UAF E;  4KYP A;  1HX1 A;  1JKZ A;  1C55 A;  1KAZ A;  3ATV A;  4UJ0 A;  3KP1 A;  1DQ7 A;  2KJA A;  1WT7 A;  5BPL A;  2ASC A;  5AQW A;  1SEG A;  2MZ0 A;  1YUW A;  1AHO A;  1WMT A;  5AQR A; 
#chains in the Genus database with same CATH homology
 1I6G A;  2LJM A;  4AB0 A;  2LY6 A;  2LT8 A;  1VNA A;  2LY5 A;  2NY8 X;  1JZB A;  1NH5 A;  1I2V A;  2E0H A;  1LQQ A;  1T7B A;  1PE4 A;  2B68 A;  2LJ7 A;  1B7D A;  1P0A A;  2E3F A;  1LQH A;  2N2Q A;  1BCG A;  1P00 A;  1AYJ A;  2N69 A;  1PX9 A;  1T7E A;  1NE5 A;  1PTX A;  2KBH A;  4HHF A;  1L4V A;  1BRZ A;  1VNB A;  1SNB A;  1I6F A;  2YC1 C;  4AAZ A;  1JXC A;  1DJT A;  1OMY A;  3E7R L;  2BRZ A;  4AEI A;  2KPY A;  4V1D C;  1NRA A;  1MR4 A;  5KK4 A;  1TI5 A;  1ZFU A;  1LQI A;  1ICA A;  1WWN A;  4HE7 A;  1CHZ A;  2N2R A;  1ZYV A;  2E3G A;  1C56 A;  1KV0 A;  2KYQ A;  1FH3 A;  1ZVE A;  2I61 A;  2KGQ A;  1CN2 A;  1SN4 A;  1SN1 A;  2A7T A;  2N66 A;  1OZZ A;  2KBJ A;  2KSK A;  2YEO A;  1ZU3 A;  1ZVG A;  2ATB A;  3PSM A;  2NY9 X;  1GPS A;  1T1T A;  1GPT A;  1T7A A;  2M8B B;  2B3C A;  1B3C A;  1MYN A;  3E7U X;  1ZUT A;  5CY0 A;  2LKB A;  1ZYW A;  1BK8 A;  1JZA A;  4CQK A;  1T0Z A;  2SN3 A;  2KBK A;  1NRB A;  2LR3 A;  1N4N A;  1I2U A;  2GL1 A;  2LI7 A;  1NPI A;  2YBR C;  1BMR A;  4KYP A;  1JKZ A;  1C55 A;  4UJ0 A;  1DQ7 A;  2KJA A;  1WT7 A;  2ASC A;  1SEG A;  2MZ0 A;  1AHO A;  1WMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...