1FH3A

Nmr structures of lqh iii alpha-like scorpion toxin from leiurus quinquestriatus corresponding to the major conformer in solution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
b'VRDGYIAQPENCVYHCFPGSSGCDTLCKEKGGTSGHCGFKVGHGLACWCNALPDNVGIIVEGEKCHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LQH III ALPHA-LIKE TOXIN
publication title A Cis-trans Isomerism of a Non-prolyl Peptide Bond in Lqh III Alpha-like Scorpion Toxin Revealed by Solution NMR
rcsb
molecule tags Toxin
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1fh3A00
1JZAA 1WWNA 2LR3A 2B68A 1BRZA 2LJMA 1ICAA 4AAZA 2E0HA 2N66A 2E3FA 2KBJA 2E3GA 1ZU3A 4KYPA 1ZVGA 2MZ0A 1I2VA 2KBKA 1PE4A 2NY8X 1T7BA 1LQIA 1VNAA 2N2QA 2I61A 2LI7A 1WT7A 2SN3A 1DQ7A 1TI5A 2A7TA 1T7AA 1ZVEA 2ASCA 5CY0A 1BCGA 1T7EA 2LKBA 1B7DA 1CHZA 1I6FA 1OMYA 1ZFUA 4HE7A 1BK8A 1B3CA 1VNBA 1FH3A 1NE5A 1JKZA 2NY9X 1MYNA 2KBHA 2B3CA 4UJ0A 1GPSA 4AEIA 1JXCA 4V1DC 1BMRA 3E7RL 2KYQA 2GL1A 1AYJA 1SN4A 1OZZA 1MR4A 1LQHA 1KV0A 1ZYWA 2N2RA 1SN1A 1GPTA 2LY6A 2M8BB 1LQQA 2BRZA 1AHOA 1SEGA 1JZBA 4HHFA 2KGQA 1C55A 2YEOA 1I6GA 5KK4A 1P00A 3PSMA 2LT8A 1C56A 1PX9A 2YBRC 2LJ7A 1NPIA 1P0AA 1WMTA 2LY5A 2N69A 1DJTA 2YC1C 1ZUTA 1PTXA 1NRBA 4AB0A 4CQKA 1T0ZA 1SNBA 1CN2A 3E7UX 1NRAA 2KJAA 1L4VA 1NH5A 2ATBA 1I2UA 2KPYA 1T1TA 2KSKA 1ZYVA 1N4NA
chains in the Genus database with same CATH superfamily
2V7ZA 1JZAA 1QQNA 1WWNA 2QWNA 2LR3A 3CQXA 3L4IA 2B68A 3QI7A 1BRZA 2LJMA 1ICAA 3FZHA 3FZKA 3HSCA 5EXWA 4AAZA 5AQJA 4UADE 2QW9A 3D2FB 5EX5A 5F0XA 1DKGD 5AQHA 5AQOA 5EY4A 2E0HA 2N66A 2QWOA 4IO8A 5AQWA 1BA1A 2E3FA 2KBJA 2E3GA 3C7NB 5AQXA 1ZU3A 2QXLA 4KYPA 5AR0A 1ZVGA 2MZ0A 5BPLA 2E2FA 3D2FA 1I2VA 2KBKA 5AQFA 1NGBA 4UAEF 3I33A 1POIA 2YIOA 2LN8A 3C7NA 1PE4A 2NY8X 1T7BA 1BA0A 1LQIA 1VNAA 2N2QA 2I61A 5AQVA 2LI7A 1WT7A 3CW4A 3GKUA 2SN3A 3JXUA 1DQ7A 1HPMA 5FPEA 5FPDA 2BUPA 5BPMA 2E8AA 4H5TA 1ATSA 1TI5A 2A7TA 4UAFE 1T7AA 1ZVEA 1KAYA 2ASCA 3LDOA 2D56A 1BCGA 5CY0A 5AQYA 2QWLA 1T7EA 2LKBA 1B7DA 5AQQA 1CHZA 5EVZA 2KHOA 4HWIA 1I6FA 1ZFUA 1KAXA 1NGDA 1OMYA 4HE7A 5AQZA 1BK8A 1B3CA 1VNBA 3IUCA 5AQSA 1NE5A 2G2KA 1NGIA 3A8YA 1JKZA 3LDQA 2NY9X 5BN8A 1BUPA 3GDQA 5AQUA 1MYNA 2KBHA 2B3CA 4UJ0A 3FZFA 1GPSA 1NGEA 4AEIA 5AQTA 1QQMA 1JXCA 4V1DC 1BMRA 3E7RL 1NGGA 2KYQA 2GL1A 1AYJA 1SN4A 1HJOA 4H5RA 1OZZA 1MR4A 3D2EB 3QMLA 3KP0A 1LQHA 1KV0A 1ZYWA 2N2RA 2MN5A 4GNIA 1KAZA 1SN1A 1GPTA 3AY9A 1UGLA 2LY6A 5AQMA 5FPNA 1NGJA 3D2EA 5F1XA 2QWPA 1K8BA 5AQGA 2MBKA 3KOXA 3KOYA 1NGFA 2M8BB 1LQQA 1NGCA 3KVGA 2BRZA 3L6QA 3LDPA 3M3ZA 1AHOA 3KHWA 5AQNA 1SEGA 2GMOA 1JZBA 4HHFA 2QWRA 3LDLA 2KGQA 2YILA 5AQIA 1QQOA 5AQLA 1C55A 1FH3A 2YIPA 3ATUA 5AQKA 3FE1A 4FSVA 2JDQD 2QWMA 1NGAA 5BN9A 2YEOA 1I6GA 5KK4A 1P00A 3PSMA 4H5NA 4H5WA 3SF4D 4FL9A 1ATRA 2LT8A 4KBOA 1C56A 3FZMA 3KP1A 1PX9A 2VY6A 2YBRC 3LDNA 2LJ7A 1NPIA 3KC6A 5AQRA 1P0AA 1WMTA 2K35A 2LY5A 1DJTA 2N69A 1ZUTA 1HX1A 1YUWA 2YC1C 3ATVA 3FZLA 3KOWA 1PTXA 3BK3C 1NRBA 3QFPA 2QWQA 3KOZA 3R2VA 5FPMA 4AB0A 5BPNA 5F2RA 4CQKA 3L56A 3GL1A 1T0ZA 1SNBA 1CN2A 1XRSB 1S3XA 3E7UX 1NRAA 4H5VA 2KJAA 1L4VA 1NH5A 2ATBA 1I2UA 2KPYA 1T1TA 2E88A 2KSKA 5AQPA 1NGHA 1ZYVA 3QFUA 1N4NA
chains in the Genus database with same CATH topology
1JZAA 1WWNA 2LR3A 2B68A 1BRZA 2LJMA 1ICAA 4AAZA 2E0HA 2N66A 2E3FA 2KBJA 2E3GA 1ZU3A 4KYPA 1ZVGA 2MZ0A 1I2VA 2KBKA 1PE4A 2NY8X 1T7BA 1LQIA 1VNAA 2N2QA 2I61A 2LI7A 1WT7A 2SN3A 1DQ7A 1TI5A 2A7TA 1T7AA 1ZVEA 2ASCA 5CY0A 1BCGA 1T7EA 2LKBA 1B7DA 1CHZA 1I6FA 1OMYA 1ZFUA 4HE7A 1BK8A 1B3CA 1VNBA 1FH3A 1NE5A 1JKZA 2NY9X 1MYNA 2KBHA 2B3CA 4UJ0A 1GPSA 4AEIA 1JXCA 4V1DC 1BMRA 3E7RL 2KYQA 2GL1A 1AYJA 1SN4A 1OZZA 1MR4A 1LQHA 1KV0A 1ZYWA 2N2RA 1SN1A 1GPTA 2LY6A 2M8BB 1LQQA 2BRZA 1AHOA 1SEGA 1JZBA 4HHFA 2KGQA 1C55A 2YEOA 1I6GA 5KK4A 1P00A 3PSMA 2LT8A 1C56A 1PX9A 2YBRC 2LJ7A 1NPIA 1P0AA 1WMTA 2LY5A 2N69A 1DJTA 2YC1C 1ZUTA 1PTXA 1NRBA 4AB0A 4CQKA 1T0ZA 1SNBA 1CN2A 3E7UX 1NRAA 2KJAA 1L4VA 1NH5A 2ATBA 1I2UA 2KPYA 1T1TA 2KSKA 1ZYVA 1N4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZA A;  1WWN A;  2LR3 A;  2B68 A;  1BRZ A;  2LJM A;  1ICA A;  4AAZ A;  2E0H A;  2N66 A;  2E3F A;  2KBJ A;  2E3G A;  1ZU3 A;  4KYP A;  1ZVG A;  2MZ0 A;  1I2V A;  2KBK A;  1PE4 A;  2NY8 X;  1T7B A;  1LQI A;  1VNA A;  2N2Q A;  2I61 A;  2LI7 A;  1WT7 A;  2SN3 A;  1DQ7 A;  1TI5 A;  2A7T A;  1T7A A;  1ZVE A;  2ASC A;  5CY0 A;  1BCG A;  1T7E A;  2LKB A;  1B7D A;  1CHZ A;  1I6F A;  1OMY A;  1ZFU A;  4HE7 A;  1BK8 A;  1B3C A;  1VNB A;  1FH3 A;  1NE5 A;  1JKZ A;  2NY9 X;  1MYN A;  2KBH A;  2B3C A;  4UJ0 A;  1GPS A;  4AEI A;  1JXC A;  4V1D C;  1BMR A;  3E7R L;  2KYQ A;  2GL1 A;  1AYJ A;  1SN4 A;  1OZZ A;  1MR4 A;  1LQH A;  1KV0 A;  1ZYW A;  2N2R A;  1SN1 A;  1GPT A;  2LY6 A;  2M8B B;  1LQQ A;  2BRZ A;  1AHO A;  1SEG A;  1JZB A;  4HHF A;  2KGQ A;  1C55 A;  2YEO A;  1I6G A;  5KK4 A;  1P00 A;  3PSM A;  2LT8 A;  1C56 A;  1PX9 A;  2YBR C;  2LJ7 A;  1NPI A;  1P0A A;  1WMT A;  2LY5 A;  2N69 A;  1DJT A;  2YC1 C;  1ZUT A;  1PTX A;  1NRB A;  4AB0 A;  4CQK A;  1T0Z A;  1SNB A;  1CN2 A;  3E7U X;  1NRA A;  2KJA A;  1L4V A;  1NH5 A;  2ATB A;  1I2U A;  2KPY A;  1T1T A;  2KSK A;  1ZYV A;  1N4N A; 
#chains in the Genus database with same CATH topology
 2V7Z A;  1JZA A;  1QQN A;  1WWN A;  2QWN A;  2LR3 A;  3CQX A;  3L4I A;  2B68 A;  3QI7 A;  1BRZ A;  2LJM A;  1ICA A;  3FZH A;  3FZK A;  3HSC A;  5EXW A;  4AAZ A;  5AQJ A;  4UAD E;  2QW9 A;  3D2F B;  5EX5 A;  5F0X A;  1DKG D;  5AQH A;  5AQO A;  5EY4 A;  2E0H A;  2N66 A;  2QWO A;  4IO8 A;  5AQW A;  1BA1 A;  2E3F A;  2KBJ A;  2E3G A;  3C7N B;  5AQX A;  1ZU3 A;  2QXL A;  4KYP A;  5AR0 A;  1ZVG A;  2MZ0 A;  5BPL A;  2E2F A;  3D2F A;  1I2V A;  2KBK A;  5AQF A;  1NGB A;  4UAE F;  3I33 A;  1POI A;  2YIO A;  2LN8 A;  3C7N A;  1PE4 A;  2NY8 X;  1T7B A;  1BA0 A;  1LQI A;  1VNA A;  2N2Q A;  2I61 A;  5AQV A;  2LI7 A;  1WT7 A;  3CW4 A;  3GKU A;  2SN3 A;  3JXU A;  1DQ7 A;  1HPM A;  5FPE A;  5FPD A;  2BUP A;  5BPM A;  2E8A A;  4H5T A;  1ATS A;  1TI5 A;  2A7T A;  4UAF E;  1T7A A;  1ZVE A;  1KAY A;  2ASC A;  3LDO A;  2D56 A;  1BCG A;  5CY0 A;  5AQY A;  2QWL A;  1T7E A;  2LKB A;  1B7D A;  5AQQ A;  1CHZ A;  5EVZ A;  2KHO A;  4HWI A;  1I6F A;  1ZFU A;  1KAX A;  1NGD A;  1OMY A;  4HE7 A;  5AQZ A;  1BK8 A;  1B3C A;  1VNB A;  3IUC A;  5AQS A;  1NE5 A;  2G2K A;  1NGI A;  3A8Y A;  1JKZ A;  3LDQ A;  2NY9 X;  5BN8 A;  1BUP A;  3GDQ A;  5AQU A;  1MYN A;  2KBH A;  2B3C A;  4UJ0 A;  3FZF A;  1GPS A;  1NGE A;  4AEI A;  5AQT A;  1QQM A;  1JXC A;  4V1D C;  1BMR A;  3E7R L;  1NGG A;  2KYQ A;  2GL1 A;  1AYJ A;  1SN4 A;  1HJO A;  4H5R A;  1OZZ A;  1MR4 A;  3D2E B;  3QML A;  3KP0 A;  1LQH A;  1KV0 A;  1ZYW A;  2N2R A;  2MN5 A;  4GNI A;  1KAZ A;  1SN1 A;  1GPT A;  3AY9 A;  1UGL A;  2LY6 A;  5AQM A;  5FPN A;  1NGJ A;  3D2E A;  5F1X A;  2QWP A;  1K8B A;  5AQG A;  2MBK A;  3KOX A;  3KOY A;  1NGF A;  2M8B B;  1LQQ A;  1NGC A;  3KVG A;  2BRZ A;  3L6Q A;  3LDP A;  3M3Z A;  1AHO A;  3KHW A;  5AQN A;  1SEG A;  2GMO A;  1JZB A;  4HHF A;  2QWR A;  3LDL A;  2KGQ A;  2YIL A;  5AQI A;  1QQO A;  5AQL A;  1C55 A;  1FH3 A;  2YIP A;  3ATU A;  5AQK A;  3FE1 A;  4FSV A;  2JDQ D;  2QWM A;  1NGA A;  5BN9 A;  2YEO A;  1I6G A;  5KK4 A;  1P00 A;  3PSM A;  4H5N A;  4H5W A;  3SF4 D;  4FL9 A;  1ATR A;  2LT8 A;  4KBO A;  1C56 A;  3FZM A;  3KP1 A;  1PX9 A;  2VY6 A;  2YBR C;  3LDN A;  2LJ7 A;  1NPI A;  3KC6 A;  5AQR A;  1P0A A;  1WMT A;  2K35 A;  2LY5 A;  1DJT A;  2N69 A;  1ZUT A;  1HX1 A;  1YUW A;  2YC1 C;  3ATV A;  3FZL A;  3KOW A;  1PTX A;  3BK3 C;  1NRB A;  3QFP A;  2QWQ A;  3KOZ A;  3R2V A;  5FPM A;  4AB0 A;  5BPN A;  5F2R A;  4CQK A;  3L56 A;  3GL1 A;  1T0Z A;  1SNB A;  1CN2 A;  1XRS B;  1S3X A;  3E7U X;  1NRA A;  4H5V A;  2KJA A;  1L4V A;  1NH5 A;  2ATB A;  1I2U A;  2KPY A;  1T1T A;  2E88 A;  2KSK A;  5AQP A;  1NGH A;  1ZYV A;  3QFU A;  1N4N A; 
#chains in the Genus database with same CATH homology
 1JZA A;  1WWN A;  2LR3 A;  2B68 A;  1BRZ A;  2LJM A;  1ICA A;  4AAZ A;  2E0H A;  2N66 A;  2E3F A;  2KBJ A;  2E3G A;  1ZU3 A;  4KYP A;  1ZVG A;  2MZ0 A;  1I2V A;  2KBK A;  1PE4 A;  2NY8 X;  1T7B A;  1LQI A;  1VNA A;  2N2Q A;  2I61 A;  2LI7 A;  1WT7 A;  2SN3 A;  1DQ7 A;  1TI5 A;  2A7T A;  1T7A A;  1ZVE A;  2ASC A;  5CY0 A;  1BCG A;  1T7E A;  2LKB A;  1B7D A;  1CHZ A;  1I6F A;  1OMY A;  1ZFU A;  4HE7 A;  1BK8 A;  1B3C A;  1VNB A;  1FH3 A;  1NE5 A;  1JKZ A;  2NY9 X;  1MYN A;  2KBH A;  2B3C A;  4UJ0 A;  1GPS A;  4AEI A;  1JXC A;  4V1D C;  1BMR A;  3E7R L;  2KYQ A;  2GL1 A;  1AYJ A;  1SN4 A;  1OZZ A;  1MR4 A;  1LQH A;  1KV0 A;  1ZYW A;  2N2R A;  1SN1 A;  1GPT A;  2LY6 A;  2M8B B;  1LQQ A;  2BRZ A;  1AHO A;  1SEG A;  1JZB A;  4HHF A;  2KGQ A;  1C55 A;  2YEO A;  1I6G A;  5KK4 A;  1P00 A;  3PSM A;  2LT8 A;  1C56 A;  1PX9 A;  2YBR C;  2LJ7 A;  1NPI A;  1P0A A;  1WMT A;  2LY5 A;  2N69 A;  1DJT A;  2YC1 C;  1ZUT A;  1PTX A;  1NRB A;  4AB0 A;  4CQK A;  1T0Z A;  1SNB A;  1CN2 A;  3E7U X;  1NRA A;  2KJA A;  1L4V A;  1NH5 A;  2ATB A;  1I2U A;  2KPY A;  1T1T A;  2KSK A;  1ZYV A;  1N4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...