1FH3A

Nmr structures of lqh iii alpha-like scorpion toxin from leiurus quinquestriatus corresponding to the major conformer in solution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
VRDGYIAQPENCVYHCFPGSSGCDTLCKEKGGTSGHCGFKVGHGLACWCNALPDNVGIIVEGEKCHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LQH III ALPHA-LIKE TOXIN
publication title A Cis-trans Isomerism of a Non-prolyl Peptide Bond in Lqh III Alpha-like Scorpion Toxin Revealed by Solution NMR
rcsb
molecule tags Toxin
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1fh3A00
2N69A 1C55A 1I6FA 5KK4A 1BCGA 2YEOA 2KBHA 1DQ7A 1GPSA 4CQKA 1BK8A 2N2QA 4HE7A 2LY6A 1BMRA 1PX9A 1ZUTA 1T0ZA 1T7EA 2YBRC 2M8BB 1WWNA 1N4NA 2A7TA 1VNAA 1LQHA 1P0AA 2MZ0A 1NH5A 2LY5A 1ZVGA 1C56A 1L4VA 2B3CA 1NRBA 2E0HA 1JKZA 1P00A 1JZAA 1MYNA 2N2RA 5CY0A 1T7AA 4AEIA 4UJ0A 4HHFA 2GL1A 2KGQA 2LR3A 2N66A 1ZU3A 2ASCA 2NY9X 1VNBA 2E3GA 1B7DA 2SN3A 2NY8X 1ZVEA 1T1TA 2LJ7A 1ZYWA 3PSMA 1OMYA 1I6GA 1B3CA 2BRZA 1T7BA 1JXCA 2B68A 2LT8A 1CHZA 2KBKA 3E7RL 1WT7A 1LQIA 1SEGA 4KYPA 1SN4A 1CN2A 1LQQA 1OZZA 1ICAA 1ZFUA 1JZBA 4V1DC 1AHOA 2KYQA 4AAZA 2LJMA 1I2VA 1WMTA 2LKBA 1FH3A 1SN1A 4AB0A 1I2UA 2YC1C 2ATBA 2KJAA 3E7UX 1GPTA 1AYJA 2KPYA 1MR4A 1NE5A 2KBJA 1ZYVA 1BRZA 2E3FA 2I61A 1DJTA 1TI5A 2LI7A 1SNBA 1NPIA 2KSKA 1PE4A 1PTXA 1NRAA 1KV0A
chains in the Genus database with same CATH superfamily
2N69A 3ATUA 1C55A 1I6FA 5KK4A 3SF4D 1BCGA 3HSCA 2YEOA 2KBHA 1DQ7A 3FE1A 3KOYA 4H5VA 3QI7A 2QWPA 4H5TA 4CQKA 1BK8A 2N2QA 1XRSB 4HE7A 2LY6A 3KHWA 5BN9A 1BMRA 2E2FA 5BPLA 1PX9A 1ZUTA 1T0ZA 5AR0A 1T7EA 2YBRC 2M8BB 1WWNA 1N4NA 3L56A 2A7TA 3A8YA 1VNAA 3KP0A 4KBOA 1KAZA 5AQUA 5AQIA 3BK3C 3KOWA 1LQHA 5AQRA 1NGGA 1NGIA 1P0AA 1YUWA 1NH5A 2MZ0A 2QWOA 2LY5A 1ZVGA 1QQMA 3FZMA 4HWIA 4UAEF 1C56A 1L4VA 3LDLA 2B3CA 1NRBA 2QWQA 5AQWA 2E0HA 1NGBA 3LDNA 2KHOA 4FSVA 3KOXA 1JKZA 3LDOA 1P00A 1JZAA 1MYNA 2N2RA 3FZHA 2QW9A 1QQNA 2YIPA 3R2VA 5CY0A 5AQYA 1T7AA 1NGCA 1KAYA 1KAXA 2QWLA 5EXWA 5F2RA 5AQQA 5AQKA 5AQMA 4AEIA 3KP1A 3KOZA 1S3XA 2K35A 3KVGA 4H5RA 4UJ0A 1K8BA 4IO8A 1POIA 5EX5A 4HHFA 2GL1A 1NGAA 2KGQA 2YILA 2LR3A 2N66A 1HJOA 3C7NB 3D2FA 5AQOA 1ZU3A 3FZFA 3LDQA 2ASCA 2G2KA 2V7ZA 2NY9X 1VNBA 1B7DA 2E3GA 3GL1A 5AQHA 2BUPA 4UADE 2QXLA 2NY8X 2SN3A 2MN5A 3AY9A 5AQGA 1BA1A 3D2FB 3QMLA 5AQFA 1ZVEA 1T1TA 5EVZA 3KC6A 2LJ7A 5AQSA 1ZYWA 3PSMA 1OMYA 1I6GA 4GNIA 1B3CA 5EY4A 5AQVA 2BRZA 1T7BA 1NGJA 5BPNA 1JXCA 3JXUA 2B68A 2LT8A 3D2EB 1CHZA 2KBKA 3E7RL 1NGHA 1WT7A 2VY6A 3CQXA 4FL9A 2MBKA 1LQIA 3C7NA 1NGEA 1SEGA 4KYPA 1ATRA 4UAFE 3M3ZA 1SN4A 1CN2A 1UGLA 1NGDA 5FPNA 1LQQA 1OZZA 5AQJA 1NGFA 2LN8A 4H5WA 5AQNA 1GPSA 5FPEA 1ICAA 1ZFUA 1JZBA 4V1DC 4H5NA 5F0XA 1AHOA 2KYQA 4AAZA 2LJMA 5AQPA 1I2VA 2JDQD 2YIOA 3L6QA 1ATSA 1WMTA 1HX1A 2D56A 2LKBA 2QWRA 5FPMA 1FH3A 1SN1A 3GKUA 3I33A 5AQXA 4AB0A 2E88A 1I2UA 2YC1C 2ATBA 2QWNA 2KJAA 3CW4A 3E7UX 5AQLA 1GPTA 5FPDA 3D2EA 5BPMA 5AQTA 3ATVA 3GDQA 3QFPA 1AYJA 1BUPA 2KPYA 1MR4A 1BA0A 1NE5A 5AQZA 2KBJA 1ZYVA 1BRZA 1DKGD 3FZLA 2E3FA 2I61A 2QWMA 3IUCA 1DJTA 1TI5A 1QQOA 2LI7A 3L4IA 1SNBA 1HPMA 1NPIA 5BN8A 3QFUA 2GMOA 2KSKA 3FZKA 3LDPA 1PE4A 1PTXA 1NRAA 2E8AA 5F1XA 1KV0A
chains in the Genus database with same CATH topology
2N69A 1C55A 1I6FA 5KK4A 1BCGA 2YEOA 2KBHA 1DQ7A 1GPSA 4CQKA 1BK8A 2N2QA 4HE7A 2LY6A 1BMRA 1PX9A 1ZUTA 1T0ZA 1T7EA 2YBRC 2M8BB 1WWNA 1N4NA 2A7TA 1VNAA 1LQHA 1P0AA 2MZ0A 1NH5A 2LY5A 1ZVGA 1C56A 1L4VA 2B3CA 1NRBA 2E0HA 1JKZA 1P00A 1JZAA 1MYNA 2N2RA 5CY0A 1T7AA 4AEIA 4UJ0A 4HHFA 2GL1A 2KGQA 2LR3A 2N66A 1ZU3A 2ASCA 2NY9X 1VNBA 2E3GA 1B7DA 2SN3A 2NY8X 1ZVEA 1T1TA 2LJ7A 1ZYWA 3PSMA 1OMYA 1I6GA 1B3CA 2BRZA 1T7BA 1JXCA 2B68A 2LT8A 1CHZA 2KBKA 3E7RL 1WT7A 1LQIA 1SEGA 4KYPA 1SN4A 1CN2A 1LQQA 1OZZA 1ICAA 1ZFUA 1JZBA 4V1DC 1AHOA 2KYQA 4AAZA 2LJMA 1I2VA 1WMTA 2LKBA 1FH3A 1SN1A 4AB0A 1I2UA 2YC1C 2ATBA 2KJAA 3E7UX 1GPTA 1AYJA 2KPYA 1MR4A 1NE5A 2KBJA 1ZYVA 1BRZA 2E3FA 2I61A 1DJTA 1TI5A 2LI7A 1SNBA 1NPIA 2KSKA 1PE4A 1PTXA 1NRAA 1KV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N69 A;  1C55 A;  1I6F A;  5KK4 A;  1BCG A;  2YEO A;  2KBH A;  1DQ7 A;  1GPS A;  4CQK A;  1BK8 A;  2N2Q A;  4HE7 A;  2LY6 A;  1BMR A;  1PX9 A;  1ZUT A;  1T0Z A;  1T7E A;  2YBR C;  2M8B B;  1WWN A;  1N4N A;  2A7T A;  1VNA A;  1LQH A;  1P0A A;  2MZ0 A;  1NH5 A;  2LY5 A;  1ZVG A;  1C56 A;  1L4V A;  2B3C A;  1NRB A;  2E0H A;  1JKZ A;  1P00 A;  1JZA A;  1MYN A;  2N2R A;  5CY0 A;  1T7A A;  4AEI A;  4UJ0 A;  4HHF A;  2GL1 A;  2KGQ A;  2LR3 A;  2N66 A;  1ZU3 A;  2ASC A;  2NY9 X;  1VNB A;  2E3G A;  1B7D A;  2SN3 A;  2NY8 X;  1ZVE A;  1T1T A;  2LJ7 A;  1ZYW A;  3PSM A;  1OMY A;  1I6G A;  1B3C A;  2BRZ A;  1T7B A;  1JXC A;  2B68 A;  2LT8 A;  1CHZ A;  2KBK A;  3E7R L;  1WT7 A;  1LQI A;  1SEG A;  4KYP A;  1SN4 A;  1CN2 A;  1LQQ A;  1OZZ A;  1ICA A;  1ZFU A;  1JZB A;  4V1D C;  1AHO A;  2KYQ A;  4AAZ A;  2LJM A;  1I2V A;  1WMT A;  2LKB A;  1FH3 A;  1SN1 A;  4AB0 A;  1I2U A;  2YC1 C;  2ATB A;  2KJA A;  3E7U X;  1GPT A;  1AYJ A;  2KPY A;  1MR4 A;  1NE5 A;  2KBJ A;  1ZYV A;  1BRZ A;  2E3F A;  2I61 A;  1DJT A;  1TI5 A;  2LI7 A;  1SNB A;  1NPI A;  2KSK A;  1PE4 A;  1PTX A;  1NRA A;  1KV0 A; 
#chains in the Genus database with same CATH topology
 2N69 A;  3ATU A;  1C55 A;  1I6F A;  5KK4 A;  3SF4 D;  1BCG A;  3HSC A;  2YEO A;  2KBH A;  1DQ7 A;  3FE1 A;  3KOY A;  4H5V A;  3QI7 A;  2QWP A;  4H5T A;  4CQK A;  1BK8 A;  2N2Q A;  1XRS B;  4HE7 A;  2LY6 A;  3KHW A;  5BN9 A;  1BMR A;  2E2F A;  5BPL A;  1PX9 A;  1ZUT A;  1T0Z A;  5AR0 A;  1T7E A;  2YBR C;  2M8B B;  1WWN A;  1N4N A;  3L56 A;  2A7T A;  3A8Y A;  1VNA A;  3KP0 A;  4KBO A;  1KAZ A;  5AQU A;  5AQI A;  3BK3 C;  3KOW A;  1LQH A;  5AQR A;  1NGG A;  1NGI A;  1P0A A;  1YUW A;  1NH5 A;  2MZ0 A;  2QWO A;  2LY5 A;  1ZVG A;  1QQM A;  3FZM A;  4HWI A;  4UAE F;  1C56 A;  1L4V A;  3LDL A;  2B3C A;  1NRB A;  2QWQ A;  5AQW A;  2E0H A;  1NGB A;  3LDN A;  2KHO A;  4FSV A;  3KOX A;  1JKZ A;  3LDO A;  1P00 A;  1JZA A;  1MYN A;  2N2R A;  3FZH A;  2QW9 A;  1QQN A;  2YIP A;  3R2V A;  5CY0 A;  5AQY A;  1T7A A;  1NGC A;  1KAY A;  1KAX A;  2QWL A;  5EXW A;  5F2R A;  5AQQ A;  5AQK A;  5AQM A;  4AEI A;  3KP1 A;  3KOZ A;  1S3X A;  2K35 A;  3KVG A;  4H5R A;  4UJ0 A;  1K8B A;  4IO8 A;  1POI A;  5EX5 A;  4HHF A;  2GL1 A;  1NGA A;  2KGQ A;  2YIL A;  2LR3 A;  2N66 A;  1HJO A;  3C7N B;  3D2F A;  5AQO A;  1ZU3 A;  3FZF A;  3LDQ A;  2ASC A;  2G2K A;  2V7Z A;  2NY9 X;  1VNB A;  1B7D A;  2E3G A;  3GL1 A;  5AQH A;  2BUP A;  4UAD E;  2QXL A;  2NY8 X;  2SN3 A;  2MN5 A;  3AY9 A;  5AQG A;  1BA1 A;  3D2F B;  3QML A;  5AQF A;  1ZVE A;  1T1T A;  5EVZ A;  3KC6 A;  2LJ7 A;  5AQS A;  1ZYW A;  3PSM A;  1OMY A;  1I6G A;  4GNI A;  1B3C A;  5EY4 A;  5AQV A;  2BRZ A;  1T7B A;  1NGJ A;  5BPN A;  1JXC A;  3JXU A;  2B68 A;  2LT8 A;  3D2E B;  1CHZ A;  2KBK A;  3E7R L;  1NGH A;  1WT7 A;  2VY6 A;  3CQX A;  4FL9 A;  2MBK A;  1LQI A;  3C7N A;  1NGE A;  1SEG A;  4KYP A;  1ATR A;  4UAF E;  3M3Z A;  1SN4 A;  1CN2 A;  1UGL A;  1NGD A;  5FPN A;  1LQQ A;  1OZZ A;  5AQJ A;  1NGF A;  2LN8 A;  4H5W A;  5AQN A;  1GPS A;  5FPE A;  1ICA A;  1ZFU A;  1JZB A;  4V1D C;  4H5N A;  5F0X A;  1AHO A;  2KYQ A;  4AAZ A;  2LJM A;  5AQP A;  1I2V A;  2JDQ D;  2YIO A;  3L6Q A;  1ATS A;  1WMT A;  1HX1 A;  2D56 A;  2LKB A;  2QWR A;  5FPM A;  1FH3 A;  1SN1 A;  3GKU A;  3I33 A;  5AQX A;  4AB0 A;  2E88 A;  1I2U A;  2YC1 C;  2ATB A;  2QWN A;  2KJA A;  3CW4 A;  3E7U X;  5AQL A;  1GPT A;  5FPD A;  3D2E A;  5BPM A;  5AQT A;  3ATV A;  3GDQ A;  3QFP A;  1AYJ A;  1BUP A;  2KPY A;  1MR4 A;  1BA0 A;  1NE5 A;  5AQZ A;  2KBJ A;  1ZYV A;  1BRZ A;  1DKG D;  3FZL A;  2E3F A;  2I61 A;  2QWM A;  3IUC A;  1DJT A;  1TI5 A;  1QQO A;  2LI7 A;  3L4I A;  1SNB A;  1HPM A;  1NPI A;  5BN8 A;  3QFU A;  2GMO A;  2KSK A;  3FZK A;  3LDP A;  1PE4 A;  1PTX A;  1NRA A;  2E8A A;  5F1X A;  1KV0 A; 
#chains in the Genus database with same CATH homology
 2N69 A;  1C55 A;  1I6F A;  5KK4 A;  1BCG A;  2YEO A;  2KBH A;  1DQ7 A;  1GPS A;  4CQK A;  1BK8 A;  2N2Q A;  4HE7 A;  2LY6 A;  1BMR A;  1PX9 A;  1ZUT A;  1T0Z A;  1T7E A;  2YBR C;  2M8B B;  1WWN A;  1N4N A;  2A7T A;  1VNA A;  1LQH A;  1P0A A;  2MZ0 A;  1NH5 A;  2LY5 A;  1ZVG A;  1C56 A;  1L4V A;  2B3C A;  1NRB A;  2E0H A;  1JKZ A;  1P00 A;  1JZA A;  1MYN A;  2N2R A;  5CY0 A;  1T7A A;  4AEI A;  4UJ0 A;  4HHF A;  2GL1 A;  2KGQ A;  2LR3 A;  2N66 A;  1ZU3 A;  2ASC A;  2NY9 X;  1VNB A;  2E3G A;  1B7D A;  2SN3 A;  2NY8 X;  1ZVE A;  1T1T A;  2LJ7 A;  1ZYW A;  3PSM A;  1OMY A;  1I6G A;  1B3C A;  2BRZ A;  1T7B A;  1JXC A;  2B68 A;  2LT8 A;  1CHZ A;  2KBK A;  3E7R L;  1WT7 A;  1LQI A;  1SEG A;  4KYP A;  1SN4 A;  1CN2 A;  1LQQ A;  1OZZ A;  1ICA A;  1ZFU A;  1JZB A;  4V1D C;  1AHO A;  2KYQ A;  4AAZ A;  2LJM A;  1I2V A;  1WMT A;  2LKB A;  1FH3 A;  1SN1 A;  4AB0 A;  1I2U A;  2YC1 C;  2ATB A;  2KJA A;  3E7U X;  1GPT A;  1AYJ A;  2KPY A;  1MR4 A;  1NE5 A;  2KBJ A;  1ZYV A;  1BRZ A;  2E3F A;  2I61 A;  1DJT A;  1TI5 A;  2LI7 A;  1SNB A;  1NPI A;  2KSK A;  1PE4 A;  1PTX A;  1NRA A;  1KV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...