2YEOA

A39l mutation of scorpion toxin lqh-alpha-it
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MVRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWLGKYGNACWCYALPDNVPIRVPGKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ALPHA-INSECT TOXIN LQHAIT
publication title Crystal Structures of Scorpion Alpha-Toxinsmutants Reveal Conformational Constraints that Dictate Preference for Mammalian Brain Voltage-Gated Na- Channels
rcsb
source organism Leiurus quinquestriatus hebraeus
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2yeoA00
1KV0A 1AHOA 1VNBA 2N2RA 2KGQA 1SN4A 2KSKA 1JXCA 1T0ZA 1ZVEA 1GPTA 2ASCA 2LI7A 4HHFA 2LKBA 2B3CA 1BMRA 1FH3A 4AB0A 2KYQA 2KBKA 1I6GA 1AYJA 1L4VA 2KBHA 1B3CA 1T7AA 1I2UA 4AEIA 1WWNA 2NY8X 1C55A 1OZZA 1TI5A 3E7UX 1OMYA 2N69A 2YBRC 2LR3A 1NH5A 1CHZA 1B7DA 2N66A 2N2QA 2KJAA 2M8BB 4CQKA 1T7BA 1T7EA 2YC1C 1I2VA 1N4NA 2KPYA 4AAZA 3E7RL 1WMTA 2I61A 1PE4A 1T1TA 1ZUTA 1ZYVA 2MZ0A 4V1DC 1NE5A 1LQQA 2E3GA 1P0AA 1JZBA 1PX9A 1LQIA 3PSMA 1BCGA 2YEOA 1SN1A 1SNBA 1NPIA 1JZAA 1I6FA 1ICAA 2ATBA 2LJ7A 1WT7A 4HE7A 1ZYWA 4KYPA 1DQ7A 2LY6A 2NY9X 2SN3A 2LJMA 2GL1A 4UJ0A 2KBJA 1VNAA 1CN2A 1JKZA 1P00A 2LT8A 1ZVGA 1MR4A 5KK4A 1LQHA 2LY5A 1MYNA 1NRAA 1C56A 2BRZA 5CY0A 1BRZA 1GPSA 1PTXA 1ZFUA 2A7TA 1NRBA 1ZU3A 1SEGA 2B68A 1BK8A 1DJTA 2E3FA 2E0HA
chains in the Genus database with same CATH superfamily
1KV0A 1AHOA 1VNBA 4IO8A 2N2RA 5AQYA 5BN8A 2KGQA 1NGFA 1SN4A 2KSKA 1JXCA 1S3XA 1T0ZA 3FZKA 5AQGA 5AQQA 1ZVEA 1GPTA 5AQMA 1UGLA 2ASCA 4H5RA 2LI7A 4HHFA 2LKBA 2B3CA 5AQRA 1NGHA 1BMRA 1FH3A 4AB0A 2KYQA 3ATUA 5AQHA 2KBKA 3CW4A 4H5VA 2MBKA 4FL9A 2QW9A 1I6GA 3KOYA 1AYJA 1L4VA 2KBHA 1B3CA 1T7AA 5AQKA 1I2UA 1NGCA 3KOXA 5AQOA 5AQWA 2QXLA 4AEIA 5AQIA 1WWNA 2NY8X 3R2VA 4H5WA 1HJOA 5BPNA 5AQTA 1OZZA 1TI5A 3KOZA 5AQXA 1C55A 1NGJA 3L4IA 2MN5A 3E7UX 1OMYA 3KVGA 2N69A 3FZHA 2BUPA 2YBRC 1XRSB 2QWMA 3ATVA 2LR3A 3QFPA 1NH5A 3FZMA 5AQFA 1CHZA 3GDQA 5AQJA 1B7DA 3C7NB 2N66A 2N2QA 3LDQA 2KJAA 5AQVA 3FZFA 2M8BB 4CQKA 3GKUA 1T7BA 1T7EA 2G2KA 2YC1C 1I2VA 1N4NA 2KPYA 4AAZA 1NGAA 1NGIA 3KC6A 1KAYA 3E7RL 1WMTA 2I61A 2VY6A 1PE4A 1T1TA 3JXUA 1ZUTA 2E88A 5AQSA 2V7ZA 1ZYVA 1QQOA 2MZ0A 3I33A 4FSVA 4V1DC 3IUCA 1NE5A 1LQQA 2E3GA 5EY4A 1P0AA 1JZBA 1PX9A 3L56A 1LQIA 5AQZA 3LDPA 2D56A 1HPMA 2E8AA 2QWOA 3KOWA 3QFUA 5EVZA 3PSMA 5AQUA 1BCGA 5EX5A 1HX1A 1POIA 5F1XA 2YEOA 4H5TA 2GMOA 3AY9A 1SN1A 3CQXA 2QWPA 5F2RA 2YIPA 3QI7A 1SNBA 3HSCA 1NPIA 1KAXA 3C7NA 1NGEA 3QMLA 1JZAA 1I6FA 3M3ZA 4HWIA 2ATBA 2LJ7A 5F0XA 1ICAA 1BA1A 1DKGD 1WT7A 5AQNA 3D2FB 1ZYWA 4HE7A 2KHOA 1DQ7A 1ATRA 2LY6A 2NY9X 2SN3A 4KYPA 4UAEF 2LJMA 5FPNA 5BPLA 2GL1A 3D2EB 3L6QA 4UJ0A 2E2FA 2KBJA 1VNAA 5AQPA 1CN2A 5FPMA 1JKZA 4GNIA 3KHWA 3KP1A 1P00A 2LT8A 2QWLA 5AQLA 1ZVGA 5BN9A 3BK3C 3LDOA 5FPEA 4UAFE 1K8BA 1MR4A 3FE1A 5EXWA 2JDQD 5KK4A 1LQHA 2LY5A 1ATSA 1MYNA 1YUWA 1NRAA 1C56A 2BRZA 5CY0A 1BRZA 1NGDA 1GPSA 4UADE 3D2FA 1KAZA 1PTXA 1ZFUA 1NGBA 1QQMA 2A7TA 5BPMA 3FZLA 1NRBA 2K35A 2LN8A 3LDLA 1BUPA 3KP0A 3D2EA 1ZU3A 3SF4D 1SEGA 2B68A 1BK8A 2YIOA 2QWQA 1QQNA 1DJTA 1NGGA 2YILA 4H5NA 1BA0A 5FPDA 2QWRA 3GL1A 2E3FA 3A8YA 2QWNA 4KBOA 3LDNA 5AR0A 2E0HA
chains in the Genus database with same CATH topology
1KV0A 1AHOA 1VNBA 2N2RA 2KGQA 1SN4A 2KSKA 1JXCA 1T0ZA 1ZVEA 1GPTA 2ASCA 2LI7A 4HHFA 2LKBA 2B3CA 1BMRA 1FH3A 4AB0A 2KYQA 2KBKA 1I6GA 1AYJA 1L4VA 2KBHA 1B3CA 1T7AA 1I2UA 4AEIA 1WWNA 2NY8X 1C55A 1OZZA 1TI5A 3E7UX 1OMYA 2N69A 2YBRC 2LR3A 1NH5A 1CHZA 1B7DA 2N66A 2N2QA 2KJAA 2M8BB 4CQKA 1T7BA 1T7EA 2YC1C 1I2VA 1N4NA 2KPYA 4AAZA 3E7RL 1WMTA 2I61A 1PE4A 1T1TA 1ZUTA 1ZYVA 2MZ0A 4V1DC 1NE5A 1LQQA 2E3GA 1P0AA 1JZBA 1PX9A 1LQIA 3PSMA 1BCGA 2YEOA 1SN1A 1SNBA 1NPIA 1JZAA 1I6FA 1ICAA 2ATBA 2LJ7A 1WT7A 4HE7A 1ZYWA 4KYPA 1DQ7A 2LY6A 2NY9X 2SN3A 2LJMA 2GL1A 4UJ0A 2KBJA 1VNAA 1CN2A 1JKZA 1P00A 2LT8A 1ZVGA 1MR4A 5KK4A 1LQHA 2LY5A 1MYNA 1NRAA 1C56A 2BRZA 5CY0A 1BRZA 1GPSA 1PTXA 1ZFUA 2A7TA 1NRBA 1ZU3A 1SEGA 2B68A 1BK8A 1DJTA 2E3FA 2E0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KV0 A;  1AHO A;  1VNB A;  2N2R A;  2KGQ A;  1SN4 A;  2KSK A;  1JXC A;  1T0Z A;  1ZVE A;  1GPT A;  2ASC A;  2LI7 A;  4HHF A;  2LKB A;  2B3C A;  1BMR A;  1FH3 A;  4AB0 A;  2KYQ A;  2KBK A;  1I6G A;  1AYJ A;  1L4V A;  2KBH A;  1B3C A;  1T7A A;  1I2U A;  4AEI A;  1WWN A;  2NY8 X;  1C55 A;  1OZZ A;  1TI5 A;  3E7U X;  1OMY A;  2N69 A;  2YBR C;  2LR3 A;  1NH5 A;  1CHZ A;  1B7D A;  2N66 A;  2N2Q A;  2KJA A;  2M8B B;  4CQK A;  1T7B A;  1T7E A;  2YC1 C;  1I2V A;  1N4N A;  2KPY A;  4AAZ A;  3E7R L;  1WMT A;  2I61 A;  1PE4 A;  1T1T A;  1ZUT A;  1ZYV A;  2MZ0 A;  4V1D C;  1NE5 A;  1LQQ A;  2E3G A;  1P0A A;  1JZB A;  1PX9 A;  1LQI A;  3PSM A;  1BCG A;  2YEO A;  1SN1 A;  1SNB A;  1NPI A;  1JZA A;  1I6F A;  1ICA A;  2ATB A;  2LJ7 A;  1WT7 A;  4HE7 A;  1ZYW A;  4KYP A;  1DQ7 A;  2LY6 A;  2NY9 X;  2SN3 A;  2LJM A;  2GL1 A;  4UJ0 A;  2KBJ A;  1VNA A;  1CN2 A;  1JKZ A;  1P00 A;  2LT8 A;  1ZVG A;  1MR4 A;  5KK4 A;  1LQH A;  2LY5 A;  1MYN A;  1NRA A;  1C56 A;  2BRZ A;  5CY0 A;  1BRZ A;  1GPS A;  1PTX A;  1ZFU A;  2A7T A;  1NRB A;  1ZU3 A;  1SEG A;  2B68 A;  1BK8 A;  1DJT A;  2E3F A;  2E0H A; 
#chains in the Genus database with same CATH topology
 1KV0 A;  1AHO A;  1VNB A;  4IO8 A;  2N2R A;  5AQY A;  5BN8 A;  2KGQ A;  1NGF A;  1SN4 A;  2KSK A;  1JXC A;  1S3X A;  1T0Z A;  3FZK A;  5AQG A;  5AQQ A;  1ZVE A;  1GPT A;  5AQM A;  1UGL A;  2ASC A;  4H5R A;  2LI7 A;  4HHF A;  2LKB A;  2B3C A;  5AQR A;  1NGH A;  1BMR A;  1FH3 A;  4AB0 A;  2KYQ A;  3ATU A;  5AQH A;  2KBK A;  3CW4 A;  4H5V A;  2MBK A;  4FL9 A;  2QW9 A;  1I6G A;  3KOY A;  1AYJ A;  1L4V A;  2KBH A;  1B3C A;  1T7A A;  5AQK A;  1I2U A;  1NGC A;  3KOX A;  5AQO A;  5AQW A;  2QXL A;  4AEI A;  5AQI A;  1WWN A;  2NY8 X;  3R2V A;  4H5W A;  1HJO A;  5BPN A;  5AQT A;  1OZZ A;  1TI5 A;  3KOZ A;  5AQX A;  1C55 A;  1NGJ A;  3L4I A;  2MN5 A;  3E7U X;  1OMY A;  3KVG A;  2N69 A;  3FZH A;  2BUP A;  2YBR C;  1XRS B;  2QWM A;  3ATV A;  2LR3 A;  3QFP A;  1NH5 A;  3FZM A;  5AQF A;  1CHZ A;  3GDQ A;  5AQJ A;  1B7D A;  3C7N B;  2N66 A;  2N2Q A;  3LDQ A;  2KJA A;  5AQV A;  3FZF A;  2M8B B;  4CQK A;  3GKU A;  1T7B A;  1T7E A;  2G2K A;  2YC1 C;  1I2V A;  1N4N A;  2KPY A;  4AAZ A;  1NGA A;  1NGI A;  3KC6 A;  1KAY A;  3E7R L;  1WMT A;  2I61 A;  2VY6 A;  1PE4 A;  1T1T A;  3JXU A;  1ZUT A;  2E88 A;  5AQS A;  2V7Z A;  1ZYV A;  1QQO A;  2MZ0 A;  3I33 A;  4FSV A;  4V1D C;  3IUC A;  1NE5 A;  1LQQ A;  2E3G A;  5EY4 A;  1P0A A;  1JZB A;  1PX9 A;  3L56 A;  1LQI A;  5AQZ A;  3LDP A;  2D56 A;  1HPM A;  2E8A A;  2QWO A;  3KOW A;  3QFU A;  5EVZ A;  3PSM A;  5AQU A;  1BCG A;  5EX5 A;  1HX1 A;  1POI A;  5F1X A;  2YEO A;  4H5T A;  2GMO A;  3AY9 A;  1SN1 A;  3CQX A;  2QWP A;  5F2R A;  2YIP A;  3QI7 A;  1SNB A;  3HSC A;  1NPI A;  1KAX A;  3C7N A;  1NGE A;  3QML A;  1JZA A;  1I6F A;  3M3Z A;  4HWI A;  2ATB A;  2LJ7 A;  5F0X A;  1ICA A;  1BA1 A;  1DKG D;  1WT7 A;  5AQN A;  3D2F B;  1ZYW A;  4HE7 A;  2KHO A;  1DQ7 A;  1ATR A;  2LY6 A;  2NY9 X;  2SN3 A;  4KYP A;  4UAE F;  2LJM A;  5FPN A;  5BPL A;  2GL1 A;  3D2E B;  3L6Q A;  4UJ0 A;  2E2F A;  2KBJ A;  1VNA A;  5AQP A;  1CN2 A;  5FPM A;  1JKZ A;  4GNI A;  3KHW A;  3KP1 A;  1P00 A;  2LT8 A;  2QWL A;  5AQL A;  1ZVG A;  5BN9 A;  3BK3 C;  3LDO A;  5FPE A;  4UAF E;  1K8B A;  1MR4 A;  3FE1 A;  5EXW A;  2JDQ D;  5KK4 A;  1LQH A;  2LY5 A;  1ATS A;  1MYN A;  1YUW A;  1NRA A;  1C56 A;  2BRZ A;  5CY0 A;  1BRZ A;  1NGD A;  1GPS A;  4UAD E;  3D2F A;  1KAZ A;  1PTX A;  1ZFU A;  1NGB A;  1QQM A;  2A7T A;  5BPM A;  3FZL A;  1NRB A;  2K35 A;  2LN8 A;  3LDL A;  1BUP A;  3KP0 A;  3D2E A;  1ZU3 A;  3SF4 D;  1SEG A;  2B68 A;  1BK8 A;  2YIO A;  2QWQ A;  1QQN A;  1DJT A;  1NGG A;  2YIL A;  4H5N A;  1BA0 A;  5FPD A;  2QWR A;  3GL1 A;  2E3F A;  3A8Y A;  2QWN A;  4KBO A;  3LDN A;  5AR0 A;  2E0H A; 
#chains in the Genus database with same CATH homology
 1KV0 A;  1AHO A;  1VNB A;  2N2R A;  2KGQ A;  1SN4 A;  2KSK A;  1JXC A;  1T0Z A;  1ZVE A;  1GPT A;  2ASC A;  2LI7 A;  4HHF A;  2LKB A;  2B3C A;  1BMR A;  1FH3 A;  4AB0 A;  2KYQ A;  2KBK A;  1I6G A;  1AYJ A;  1L4V A;  2KBH A;  1B3C A;  1T7A A;  1I2U A;  4AEI A;  1WWN A;  2NY8 X;  1C55 A;  1OZZ A;  1TI5 A;  3E7U X;  1OMY A;  2N69 A;  2YBR C;  2LR3 A;  1NH5 A;  1CHZ A;  1B7D A;  2N66 A;  2N2Q A;  2KJA A;  2M8B B;  4CQK A;  1T7B A;  1T7E A;  2YC1 C;  1I2V A;  1N4N A;  2KPY A;  4AAZ A;  3E7R L;  1WMT A;  2I61 A;  1PE4 A;  1T1T A;  1ZUT A;  1ZYV A;  2MZ0 A;  4V1D C;  1NE5 A;  1LQQ A;  2E3G A;  1P0A A;  1JZB A;  1PX9 A;  1LQI A;  3PSM A;  1BCG A;  2YEO A;  1SN1 A;  1SNB A;  1NPI A;  1JZA A;  1I6F A;  1ICA A;  2ATB A;  2LJ7 A;  1WT7 A;  4HE7 A;  1ZYW A;  4KYP A;  1DQ7 A;  2LY6 A;  2NY9 X;  2SN3 A;  2LJM A;  2GL1 A;  4UJ0 A;  2KBJ A;  1VNA A;  1CN2 A;  1JKZ A;  1P00 A;  2LT8 A;  1ZVG A;  1MR4 A;  5KK4 A;  1LQH A;  2LY5 A;  1MYN A;  1NRA A;  1C56 A;  2BRZ A;  5CY0 A;  1BRZ A;  1GPS A;  1PTX A;  1ZFU A;  2A7T A;  1NRB A;  1ZU3 A;  1SEG A;  2B68 A;  1BK8 A;  1DJT A;  2E3F A;  2E0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...