2YEOA

A39l mutation of scorpion toxin lqh-alpha-it
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
b'MVRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWLGKYGNACWCYALPDNVPIRVPGKCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-INSECT TOXIN LQHAIT
publication title Crystal Structures of Scorpion Alpha-Toxinsmutants Reveal Conformational Constraints that Dictate Preference for Mammalian Brain Voltage-Gated Na- Channels
rcsb
source organism Leiurus quinquestriatus hebraeus
molecule tags Toxin
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2yeoA00
1NPIA 4AEIA 1T1TA 1LQHA 2LY6A 1P00A 2LKBA 2LJ7A 2N2RA 1ZVGA 2B3CA 1BMRA 1SNBA 2M8BB 1FH3A 1JXCA 2ATBA 1OZZA 3E7RL 2KSKA 1ICAA 1ZFUA 2KGQA 1PTXA 2MZ0A 1WMTA 1GPTA 1ZYWA 2KBKA 2E0HA 1WT7A 1I6GA 1AYJA 2KBJA 2KBHA 1DQ7A 2YC1C 1I2UA 1B3CA 1BRZA 1T0ZA 1B7DA 4HE7A 1WWNA 4AB0A 2E3FA 1I2VA 2LI7A 2YEOA 1T7EA 1ZYVA 2LJMA 1P0AA 1AHOA 1BCGA 1C55A 2BRZA 1TI5A 1SEGA 1PE4A 1BK8A 2ASCA 1NRAA 2N66A 3E7UX 1I6FA 1SN1A 1N4NA 1NH5A 2YBRC 5CY0A 2A7TA 1JZAA 1LQQA 1CHZA 1VNBA 1NE5A 2GL1A 1OMYA 1ZU3A 2LR3A 2LY5A 2N69A 4KYPA 1T7BA 1VNAA 5KK4A 2B68A 4CQKA 1L4VA 1SN4A 1PX9A 2SN3A 3PSMA 2KPYA 1GPSA 2KJAA 1JZBA 2I61A 1DJTA 2E3GA 4AAZA 1KV0A 1ZVEA 4V1DC 1C56A 1NRBA 2N2QA 1MYNA 4HHFA 2KYQA 1ZUTA 4UJ0A 1JKZA 1T7AA 1LQIA 1CN2A 2NY9X 2NY8X 1MR4A 2LT8A
chains in the Genus database with same CATH superfamily
1NPIA 4AEIA 5F0XA 1T1TA 3FZFA 1QQNA 1LQHA 3QFUA 2LY6A 5FPEA 1P00A 2LKBA 5AQVA 5F2RA 2LJ7A 1YUWA 2N2RA 1ZVGA 1BUPA 2B3CA 3FZMA 3I33A 3D2FA 4H5TA 1SNBA 2M8BB 1BMRA 1NGBA 3FZHA 1FH3A 3LDPA 1S3XA 1JXCA 2QWRA 2V7ZA 2GMOA 2ATBA 5AQNA 1KAZA 1OZZA 5AQPA 3E7RL 2KSKA 1ICAA 1ZFUA 2KGQA 5AQTA 2MN5A 1PTXA 2MZ0A 1HJOA 1HPMA 1WMTA 2QWQA 3KHWA 2QWNA 4IO8A 2LN8A 3FZLA 2E88A 5AQWA 3D2EA 1ZYWA 3CW4A 1GPTA 2KBKA 3C7NA 4UAFE 3KP1A 2E0HA 1NGFA 5EXWA 1WT7A 2QWOA 1I6GA 1AYJA 2KBJA 2KBHA 4H5RA 1DQ7A 2YC1C 3FZKA 3AY9A 3LDNA 3D2EB 1B3CA 1I2UA 3BK3C 3C7NB 1BRZA 1T0ZA 1ATRA 3QI7A 1B7DA 5AQQA 5AQRA 3HSCA 4HE7A 1WWNA 2YIPA 2K35A 2QWLA 3KOWA 4AB0A 3M3ZA 2E3FA 1I2VA 2LI7A 5FPDA 2JDQD 2YEOA 3ATVA 2YILA 5AQKA 3SF4D 1T7EA 1ZYVA 4H5WA 2KHOA 3LDLA 2LJMA 4GNIA 1P0AA 1XRSB 1AHOA 1BCGA 2BUPA 5AQHA 5BN8A 5AQFA 4UADE 1C55A 2QW9A 2E8AA 2BRZA 2D56A 1TI5A 3IUCA 3FE1A 3L56A 1ATSA 1SEGA 5AQUA 5BPMA 3LDQA 4KBOA 1PE4A 1POIA 1BK8A 2ASCA 1NRAA 5BN9A 3CQXA 1NGGA 2N66A 4FSVA 5EVZA 1NGAA 1QQOA 3JXUA 3KVGA 1NGHA 3R2VA 3E7UX 1I6FA 5EX5A 1SN1A 1BA0A 1NGJA 5AQJA 1N4NA 3KOZA 1NH5A 5AQIA 1BA1A 2YBRC 2A7TA 2QWPA 5AR0A 3GDQA 3GKUA 1JZAA 5FPMA 5CY0A 1LQQA 3QFPA 1NGIA 1NGEA 3LDOA 2YIOA 1CHZA 5AQLA 1VNBA 1NE5A 4FL9A 2GL1A 5AQSA 2MBKA 1OMYA 1ZU3A 2LR3A 1HX1A 2LY5A 2N69A 3GL1A 4KYPA 3KP0A 1T7BA 1VNAA 3KC6A 3KOXA 5AQXA 5FPNA 5KK4A 2B68A 2E2FA 4CQKA 1L4VA 1SN4A 1PX9A 2SN3A 3PSMA 1KAYA 2KPYA 1GPSA 1KAXA 2KJAA 5BPNA 1JZBA 5AQZA 2I61A 5F1XA 5AQMA 1DJTA 3QMLA 2E3GA 1UGLA 4AAZA 1KV0A 1ZVEA 3L6QA 1DKGD 2QXLA 1NGCA 1C56A 1NRBA 4V1DC 5AQYA 5EY4A 1K8BA 2N2QA 4H5VA 2QWMA 3KOYA 2G2KA 3D2FB 2VY6A 3L4IA 1MYNA 4HWIA 5BPLA 4HHFA 2KYQA 5AQOA 1ZUTA 4UJ0A 3A8YA 4H5NA 1NGDA 1JKZA 5AQGA 1T7AA 1LQIA 1CN2A 3ATUA 1QQMA 2NY9X 4UAEF 2NY8X 1MR4A 2LT8A
chains in the Genus database with same CATH topology
1NPIA 4AEIA 1T1TA 1LQHA 2LY6A 1P00A 2LKBA 2LJ7A 2N2RA 1ZVGA 2B3CA 1BMRA 1SNBA 2M8BB 1FH3A 1JXCA 2ATBA 1OZZA 3E7RL 2KSKA 1ICAA 1ZFUA 2KGQA 1PTXA 2MZ0A 1WMTA 1GPTA 1ZYWA 2KBKA 2E0HA 1WT7A 1I6GA 1AYJA 2KBJA 2KBHA 1DQ7A 2YC1C 1I2UA 1B3CA 1BRZA 1T0ZA 1B7DA 4HE7A 1WWNA 4AB0A 2E3FA 1I2VA 2LI7A 2YEOA 1T7EA 1ZYVA 2LJMA 1P0AA 1AHOA 1BCGA 1C55A 2BRZA 1TI5A 1SEGA 1PE4A 1BK8A 2ASCA 1NRAA 2N66A 3E7UX 1I6FA 1SN1A 1N4NA 1NH5A 2YBRC 5CY0A 2A7TA 1JZAA 1LQQA 1CHZA 1VNBA 1NE5A 2GL1A 1OMYA 1ZU3A 2LR3A 2LY5A 2N69A 4KYPA 1T7BA 1VNAA 5KK4A 2B68A 4CQKA 1L4VA 1SN4A 1PX9A 2SN3A 3PSMA 2KPYA 1GPSA 2KJAA 1JZBA 2I61A 1DJTA 2E3GA 4AAZA 1KV0A 1ZVEA 4V1DC 1C56A 1NRBA 2N2QA 1MYNA 4HHFA 2KYQA 1ZUTA 4UJ0A 1JKZA 1T7AA 1LQIA 1CN2A 2NY9X 2NY8X 1MR4A 2LT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPI A;  4AEI A;  1T1T A;  1LQH A;  2LY6 A;  1P00 A;  2LKB A;  2LJ7 A;  2N2R A;  1ZVG A;  2B3C A;  1BMR A;  1SNB A;  2M8B B;  1FH3 A;  1JXC A;  2ATB A;  1OZZ A;  3E7R L;  2KSK A;  1ICA A;  1ZFU A;  2KGQ A;  1PTX A;  2MZ0 A;  1WMT A;  1GPT A;  1ZYW A;  2KBK A;  2E0H A;  1WT7 A;  1I6G A;  1AYJ A;  2KBJ A;  2KBH A;  1DQ7 A;  2YC1 C;  1I2U A;  1B3C A;  1BRZ A;  1T0Z A;  1B7D A;  4HE7 A;  1WWN A;  4AB0 A;  2E3F A;  1I2V A;  2LI7 A;  2YEO A;  1T7E A;  1ZYV A;  2LJM A;  1P0A A;  1AHO A;  1BCG A;  1C55 A;  2BRZ A;  1TI5 A;  1SEG A;  1PE4 A;  1BK8 A;  2ASC A;  1NRA A;  2N66 A;  3E7U X;  1I6F A;  1SN1 A;  1N4N A;  1NH5 A;  2YBR C;  5CY0 A;  2A7T A;  1JZA A;  1LQQ A;  1CHZ A;  1VNB A;  1NE5 A;  2GL1 A;  1OMY A;  1ZU3 A;  2LR3 A;  2LY5 A;  2N69 A;  4KYP A;  1T7B A;  1VNA A;  5KK4 A;  2B68 A;  4CQK A;  1L4V A;  1SN4 A;  1PX9 A;  2SN3 A;  3PSM A;  2KPY A;  1GPS A;  2KJA A;  1JZB A;  2I61 A;  1DJT A;  2E3G A;  4AAZ A;  1KV0 A;  1ZVE A;  4V1D C;  1C56 A;  1NRB A;  2N2Q A;  1MYN A;  4HHF A;  2KYQ A;  1ZUT A;  4UJ0 A;  1JKZ A;  1T7A A;  1LQI A;  1CN2 A;  2NY9 X;  2NY8 X;  1MR4 A;  2LT8 A; 
#chains in the Genus database with same CATH topology
 1NPI A;  4AEI A;  5F0X A;  1T1T A;  3FZF A;  1QQN A;  1LQH A;  3QFU A;  2LY6 A;  5FPE A;  1P00 A;  2LKB A;  5AQV A;  5F2R A;  2LJ7 A;  1YUW A;  2N2R A;  1ZVG A;  1BUP A;  2B3C A;  3FZM A;  3I33 A;  3D2F A;  4H5T A;  1SNB A;  2M8B B;  1BMR A;  1NGB A;  3FZH A;  1FH3 A;  3LDP A;  1S3X A;  1JXC A;  2QWR A;  2V7Z A;  2GMO A;  2ATB A;  5AQN A;  1KAZ A;  1OZZ A;  5AQP A;  3E7R L;  2KSK A;  1ICA A;  1ZFU A;  2KGQ A;  5AQT A;  2MN5 A;  1PTX A;  2MZ0 A;  1HJO A;  1HPM A;  1WMT A;  2QWQ A;  3KHW A;  2QWN A;  4IO8 A;  2LN8 A;  3FZL A;  2E88 A;  5AQW A;  3D2E A;  1ZYW A;  3CW4 A;  1GPT A;  2KBK A;  3C7N A;  4UAF E;  3KP1 A;  2E0H A;  1NGF A;  5EXW A;  1WT7 A;  2QWO A;  1I6G A;  1AYJ A;  2KBJ A;  2KBH A;  4H5R A;  1DQ7 A;  2YC1 C;  3FZK A;  3AY9 A;  3LDN A;  3D2E B;  1B3C A;  1I2U A;  3BK3 C;  3C7N B;  1BRZ A;  1T0Z A;  1ATR A;  3QI7 A;  1B7D A;  5AQQ A;  5AQR A;  3HSC A;  4HE7 A;  1WWN A;  2YIP A;  2K35 A;  2QWL A;  3KOW A;  4AB0 A;  3M3Z A;  2E3F A;  1I2V A;  2LI7 A;  5FPD A;  2JDQ D;  2YEO A;  3ATV A;  2YIL A;  5AQK A;  3SF4 D;  1T7E A;  1ZYV A;  4H5W A;  2KHO A;  3LDL A;  2LJM A;  4GNI A;  1P0A A;  1XRS B;  1AHO A;  1BCG A;  2BUP A;  5AQH A;  5BN8 A;  5AQF A;  4UAD E;  1C55 A;  2QW9 A;  2E8A A;  2BRZ A;  2D56 A;  1TI5 A;  3IUC A;  3FE1 A;  3L56 A;  1ATS A;  1SEG A;  5AQU A;  5BPM A;  3LDQ A;  4KBO A;  1PE4 A;  1POI A;  1BK8 A;  2ASC A;  1NRA A;  5BN9 A;  3CQX A;  1NGG A;  2N66 A;  4FSV A;  5EVZ A;  1NGA A;  1QQO A;  3JXU A;  3KVG A;  1NGH A;  3R2V A;  3E7U X;  1I6F A;  5EX5 A;  1SN1 A;  1BA0 A;  1NGJ A;  5AQJ A;  1N4N A;  3KOZ A;  1NH5 A;  5AQI A;  1BA1 A;  2YBR C;  2A7T A;  2QWP A;  5AR0 A;  3GDQ A;  3GKU A;  1JZA A;  5FPM A;  5CY0 A;  1LQQ A;  3QFP A;  1NGI A;  1NGE A;  3LDO A;  2YIO A;  1CHZ A;  5AQL A;  1VNB A;  1NE5 A;  4FL9 A;  2GL1 A;  5AQS A;  2MBK A;  1OMY A;  1ZU3 A;  2LR3 A;  1HX1 A;  2LY5 A;  2N69 A;  3GL1 A;  4KYP A;  3KP0 A;  1T7B A;  1VNA A;  3KC6 A;  3KOX A;  5AQX A;  5FPN A;  5KK4 A;  2B68 A;  2E2F A;  4CQK A;  1L4V A;  1SN4 A;  1PX9 A;  2SN3 A;  3PSM A;  1KAY A;  2KPY A;  1GPS A;  1KAX A;  2KJA A;  5BPN A;  1JZB A;  5AQZ A;  2I61 A;  5F1X A;  5AQM A;  1DJT A;  3QML A;  2E3G A;  1UGL A;  4AAZ A;  1KV0 A;  1ZVE A;  3L6Q A;  1DKG D;  2QXL A;  1NGC A;  1C56 A;  1NRB A;  4V1D C;  5AQY A;  5EY4 A;  1K8B A;  2N2Q A;  4H5V A;  2QWM A;  3KOY A;  2G2K A;  3D2F B;  2VY6 A;  3L4I A;  1MYN A;  4HWI A;  5BPL A;  4HHF A;  2KYQ A;  5AQO A;  1ZUT A;  4UJ0 A;  3A8Y A;  4H5N A;  1NGD A;  1JKZ A;  5AQG A;  1T7A A;  1LQI A;  1CN2 A;  3ATU A;  1QQM A;  2NY9 X;  4UAE F;  2NY8 X;  1MR4 A;  2LT8 A; 
#chains in the Genus database with same CATH homology
 1NPI A;  4AEI A;  1T1T A;  1LQH A;  2LY6 A;  1P00 A;  2LKB A;  2LJ7 A;  2N2R A;  1ZVG A;  2B3C A;  1BMR A;  1SNB A;  2M8B B;  1FH3 A;  1JXC A;  2ATB A;  1OZZ A;  3E7R L;  2KSK A;  1ICA A;  1ZFU A;  2KGQ A;  1PTX A;  2MZ0 A;  1WMT A;  1GPT A;  1ZYW A;  2KBK A;  2E0H A;  1WT7 A;  1I6G A;  1AYJ A;  2KBJ A;  2KBH A;  1DQ7 A;  2YC1 C;  1I2U A;  1B3C A;  1BRZ A;  1T0Z A;  1B7D A;  4HE7 A;  1WWN A;  4AB0 A;  2E3F A;  1I2V A;  2LI7 A;  2YEO A;  1T7E A;  1ZYV A;  2LJM A;  1P0A A;  1AHO A;  1BCG A;  1C55 A;  2BRZ A;  1TI5 A;  1SEG A;  1PE4 A;  1BK8 A;  2ASC A;  1NRA A;  2N66 A;  3E7U X;  1I6F A;  1SN1 A;  1N4N A;  1NH5 A;  2YBR C;  5CY0 A;  2A7T A;  1JZA A;  1LQQ A;  1CHZ A;  1VNB A;  1NE5 A;  2GL1 A;  1OMY A;  1ZU3 A;  2LR3 A;  2LY5 A;  2N69 A;  4KYP A;  1T7B A;  1VNA A;  5KK4 A;  2B68 A;  4CQK A;  1L4V A;  1SN4 A;  1PX9 A;  2SN3 A;  3PSM A;  2KPY A;  1GPS A;  2KJA A;  1JZB A;  2I61 A;  1DJT A;  2E3G A;  4AAZ A;  1KV0 A;  1ZVE A;  4V1D C;  1C56 A;  1NRB A;  2N2Q A;  1MYN A;  4HHF A;  2KYQ A;  1ZUT A;  4UJ0 A;  1JKZ A;  1T7A A;  1LQI A;  1CN2 A;  2NY9 X;  2NY8 X;  1MR4 A;  2LT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...