4UJ0A

Crystal structure of the tomato defensin tpp3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
48
structure length
48
Chain Sequence
QQICKAPSQTFPGLCFMDSSCRKYCIKEKFTGGHCSKLQRKCLCTKPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords FLOWER-SPECIFIC GAMMA-THIONIN-LIKE PROTEIN/ACIDIC PROTEIN
publication title The Tomato Defensin Tpp3 Binds Phosphatidylinositol (4,5)-Bisphosphate Via a Conserved Dimeric Cationic Grip Conformation to Mediate Cell Lysis.
pubmed doi rcsb
source organism Solanum lycopersicum
total genus 11
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4uj0A00
4V1DC 2ASCA 1L4VA 2KGQA 1WWNA 2LJMA 2LKBA 2N69A 3E7UX 1BRZA 5CY0A 1VNBA 1ZVEA 1ZYWA 4KYPA 2A7TA 1I2VA 2NY9X 1CN2A 2YEOA 2BRZA 2LY5A 1LQQA 2LR3A 1AHOA 1P0AA 1VNAA 4HE7A 2ATBA 2GL1A 2MZ0A 1TI5A 1GPSA 2N2QA 2YBRC 1NPIA 1JXCA 4CQKA 1OZZA 1MYNA 1LQHA 1SN1A 1JKZA 2B3CA 1BK8A 1PX9A 1WT7A 2LT8A 1NRAA 1KV0A 1SNBA 1SEGA 2NY8X 1B7DA 1WMTA 2KBJA 4HHFA 1DQ7A 2YC1C 1ZUTA 3PSMA 2LJ7A 1OMYA 1T7AA 2KSKA 1ZVGA 4UJ0A 3E7RL 1T7BA 1PE4A 2E0HA 4AEIA 1NH5A 1NRBA 1ICAA 1JZBA 1P00A 2KBHA 2KBKA 1BMRA 1CHZA 1JZAA 1T1TA 4AB0A 1C56A 2E3GA 4AAZA 1SN4A 1I6FA 2N66A 2SN3A 1BCGA 1I6GA 1ZU3A 1N4NA 1NE5A 2KYQA 1C55A 1LQIA 2LY6A 1GPTA 1AYJA 2KPYA 1ZYVA 1T0ZA 5KK4A 1I2UA 2E3FA 2KJAA 2LI7A 1MR4A 1FH3A 2M8BB 1PTXA 2B68A 1DJTA 1T7EA 2I61A 2N2RA 1B3CA 1ZFUA
chains in the Genus database with same CATH superfamily
3GKUA 1YUWA 3FZMA 4V1DC 2ASCA 5BPNA 1L4VA 2KGQA 2QWRA 2QW9A 5AQGA 3SF4D 3LDPA 4FSVA 1WWNA 2LJMA 2MN5A 2LKBA 2QWNA 3FZFA 3KOZA 2N69A 3E7UX 3KOYA 5AQLA 1BRZA 5CY0A 3HSCA 1VNBA 1ZVEA 1ZYWA 4KYPA 3ATVA 3C7NA 5AQRA 2QWLA 3QI7A 2A7TA 1I2VA 1NGBA 2NY9X 4HWIA 1CN2A 2QWMA 5AQOA 3C7NB 5BN8A 2YEOA 2VY6A 3FZHA 3LDQA 1NGEA 4UAFE 2E88A 1S3XA 5AQXA 2QXLA 2BRZA 3AY9A 2LY5A 3KOXA 1LQQA 2E8AA 2LR3A 5BPMA 3JXUA 1AHOA 1ATSA 3IUCA 1P0AA 1VNAA 4HE7A 2ATBA 2GL1A 5AQYA 2MZ0A 1TI5A 1GPSA 3KHWA 1NGGA 1NGHA 4GNIA 3LDNA 4UADE 2N2QA 2YBRC 2GMOA 3GDQA 1NPIA 3KVGA 1JXCA 3KP1A 4CQKA 1NGDA 1OZZA 2D56A 1MYNA 1LQHA 1KAXA 2K35A 1SN1A 2YILA 2QWQA 5EY4A 5FPNA 1QQOA 2YIPA 5AQMA 3KC6A 1JKZA 2B3CA 1NGIA 3CW4A 1BK8A 1HX1A 4H5VA 4UAEF 4IO8A 5AR0A 1PX9A 3L6QA 1NGCA 1WT7A 2LT8A 5AQQA 1NRAA 1KV0A 3BK3C 1SNBA 3FZKA 3R2VA 1SEGA 4FL9A 2NY8X 1B7DA 5AQUA 1UGLA 1HJOA 1WMTA 2KBJA 2QWPA 4HHFA 1DQ7A 5FPDA 3D2EA 2YC1C 1ZUTA 5AQIA 3PSMA 3QFUA 2LJ7A 3CQXA 5AQHA 2E2FA 5AQPA 4H5WA 1OMYA 1T7AA 2KSKA 5AQZA 5F2RA 1ZVGA 3FE1A 3D2EB 4UJ0A 5F0XA 3E7RL 1DKGD 1T7BA 1PE4A 2E0HA 1KAZA 4AEIA 1NGJA 1NH5A 1NRBA 3GL1A 3L4IA 1JZBA 1P00A 5AQJA 2KBHA 2KBKA 1BMRA 1ICAA 1K8BA 1CHZA 1JZAA 1T1TA 4AB0A 1C56A 3A8YA 2E3GA 2KHOA 1BUPA 2BUPA 1KAYA 3KOWA 4H5TA 2JDQD 4AAZA 1SN4A 1I6FA 1BA1A 5AQWA 3QFPA 2N66A 1HPMA 1BCGA 2SN3A 2V7ZA 1QQMA 1ZU3A 1I6GA 1N4NA 1NE5A 3FZLA 3LDOA 3I33A 5FPEA 5AQVA 2KYQA 2G2KA 2YIOA 1QQNA 1LQIA 1C55A 2LY6A 5BN9A 1GPTA 3LDLA 5EX5A 5EXWA 3D2FA 5AQKA 5AQFA 3ATUA 1AYJA 3M3ZA 1NGAA 2KPYA 1ATRA 1ZYVA 1T0ZA 3D2FB 3KP0A 5AQNA 5KK4A 5EVZA 1I2UA 2E3FA 2KJAA 1XRSB 5BPLA 5F1XA 5FPMA 2LI7A 5AQSA 1MR4A 1FH3A 1NGFA 2MBKA 1POIA 4H5NA 2M8BB 5AQTA 1PTXA 2B68A 3QMLA 3L56A 1DJTA 1T7EA 2I61A 1BA0A 2LN8A 2N2RA 2QWOA 1B3CA 1ZFUA 4H5RA 4KBOA
chains in the Genus database with same CATH topology
4V1DC 2ASCA 1L4VA 2KGQA 1WWNA 2LJMA 2LKBA 2N69A 3E7UX 1BRZA 5CY0A 1VNBA 1ZVEA 1ZYWA 4KYPA 2A7TA 1I2VA 2NY9X 1CN2A 2YEOA 2BRZA 2LY5A 1LQQA 2LR3A 1AHOA 1P0AA 1VNAA 4HE7A 2ATBA 2GL1A 2MZ0A 1TI5A 1GPSA 2N2QA 2YBRC 1NPIA 1JXCA 4CQKA 1OZZA 1MYNA 1LQHA 1SN1A 1JKZA 2B3CA 1BK8A 1PX9A 1WT7A 2LT8A 1NRAA 1KV0A 1SNBA 1SEGA 2NY8X 1B7DA 1WMTA 2KBJA 4HHFA 1DQ7A 2YC1C 1ZUTA 3PSMA 2LJ7A 1OMYA 1T7AA 2KSKA 1ZVGA 4UJ0A 3E7RL 1T7BA 1PE4A 2E0HA 4AEIA 1NH5A 1NRBA 1ICAA 1JZBA 1P00A 2KBHA 2KBKA 1BMRA 1CHZA 1JZAA 1T1TA 4AB0A 1C56A 2E3GA 4AAZA 1SN4A 1I6FA 2N66A 2SN3A 1BCGA 1I6GA 1ZU3A 1N4NA 1NE5A 2KYQA 1C55A 1LQIA 2LY6A 1GPTA 1AYJA 2KPYA 1ZYVA 1T0ZA 5KK4A 1I2UA 2E3FA 2KJAA 2LI7A 1MR4A 1FH3A 2M8BB 1PTXA 2B68A 1DJTA 1T7EA 2I61A 2N2RA 1B3CA 1ZFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V1D C;  2ASC A;  1L4V A;  2KGQ A;  1WWN A;  2LJM A;  2LKB A;  2N69 A;  3E7U X;  1BRZ A;  5CY0 A;  1VNB A;  1ZVE A;  1ZYW A;  4KYP A;  2A7T A;  1I2V A;  2NY9 X;  1CN2 A;  2YEO A;  2BRZ A;  2LY5 A;  1LQQ A;  2LR3 A;  1AHO A;  1P0A A;  1VNA A;  4HE7 A;  2ATB A;  2GL1 A;  2MZ0 A;  1TI5 A;  1GPS A;  2N2Q A;  2YBR C;  1NPI A;  1JXC A;  4CQK A;  1OZZ A;  1MYN A;  1LQH A;  1SN1 A;  1JKZ A;  2B3C A;  1BK8 A;  1PX9 A;  1WT7 A;  2LT8 A;  1NRA A;  1KV0 A;  1SNB A;  1SEG A;  2NY8 X;  1B7D A;  1WMT A;  2KBJ A;  4HHF A;  1DQ7 A;  2YC1 C;  1ZUT A;  3PSM A;  2LJ7 A;  1OMY A;  1T7A A;  2KSK A;  1ZVG A;  4UJ0 A;  3E7R L;  1T7B A;  1PE4 A;  2E0H A;  4AEI A;  1NH5 A;  1NRB A;  1ICA A;  1JZB A;  1P00 A;  2KBH A;  2KBK A;  1BMR A;  1CHZ A;  1JZA A;  1T1T A;  4AB0 A;  1C56 A;  2E3G A;  4AAZ A;  1SN4 A;  1I6F A;  2N66 A;  2SN3 A;  1BCG A;  1I6G A;  1ZU3 A;  1N4N A;  1NE5 A;  2KYQ A;  1C55 A;  1LQI A;  2LY6 A;  1GPT A;  1AYJ A;  2KPY A;  1ZYV A;  1T0Z A;  5KK4 A;  1I2U A;  2E3F A;  2KJA A;  2LI7 A;  1MR4 A;  1FH3 A;  2M8B B;  1PTX A;  2B68 A;  1DJT A;  1T7E A;  2I61 A;  2N2R A;  1B3C A;  1ZFU A; 
#chains in the Genus database with same CATH topology
 3GKU A;  1YUW A;  3FZM A;  4V1D C;  2ASC A;  5BPN A;  1L4V A;  2KGQ A;  2QWR A;  2QW9 A;  5AQG A;  3SF4 D;  3LDP A;  4FSV A;  1WWN A;  2LJM A;  2MN5 A;  2LKB A;  2QWN A;  3FZF A;  3KOZ A;  2N69 A;  3E7U X;  3KOY A;  5AQL A;  1BRZ A;  5CY0 A;  3HSC A;  1VNB A;  1ZVE A;  1ZYW A;  4KYP A;  3ATV A;  3C7N A;  5AQR A;  2QWL A;  3QI7 A;  2A7T A;  1I2V A;  1NGB A;  2NY9 X;  4HWI A;  1CN2 A;  2QWM A;  5AQO A;  3C7N B;  5BN8 A;  2YEO A;  2VY6 A;  3FZH A;  3LDQ A;  1NGE A;  4UAF E;  2E88 A;  1S3X A;  5AQX A;  2QXL A;  2BRZ A;  3AY9 A;  2LY5 A;  3KOX A;  1LQQ A;  2E8A A;  2LR3 A;  5BPM A;  3JXU A;  1AHO A;  1ATS A;  3IUC A;  1P0A A;  1VNA A;  4HE7 A;  2ATB A;  2GL1 A;  5AQY A;  2MZ0 A;  1TI5 A;  1GPS A;  3KHW A;  1NGG A;  1NGH A;  4GNI A;  3LDN A;  4UAD E;  2N2Q A;  2YBR C;  2GMO A;  3GDQ A;  1NPI A;  3KVG A;  1JXC A;  3KP1 A;  4CQK A;  1NGD A;  1OZZ A;  2D56 A;  1MYN A;  1LQH A;  1KAX A;  2K35 A;  1SN1 A;  2YIL A;  2QWQ A;  5EY4 A;  5FPN A;  1QQO A;  2YIP A;  5AQM A;  3KC6 A;  1JKZ A;  2B3C A;  1NGI A;  3CW4 A;  1BK8 A;  1HX1 A;  4H5V A;  4UAE F;  4IO8 A;  5AR0 A;  1PX9 A;  3L6Q A;  1NGC A;  1WT7 A;  2LT8 A;  5AQQ A;  1NRA A;  1KV0 A;  3BK3 C;  1SNB A;  3FZK A;  3R2V A;  1SEG A;  4FL9 A;  2NY8 X;  1B7D A;  5AQU A;  1UGL A;  1HJO A;  1WMT A;  2KBJ A;  2QWP A;  4HHF A;  1DQ7 A;  5FPD A;  3D2E A;  2YC1 C;  1ZUT A;  5AQI A;  3PSM A;  3QFU A;  2LJ7 A;  3CQX A;  5AQH A;  2E2F A;  5AQP A;  4H5W A;  1OMY A;  1T7A A;  2KSK A;  5AQZ A;  5F2R A;  1ZVG A;  3FE1 A;  3D2E B;  4UJ0 A;  5F0X A;  3E7R L;  1DKG D;  1T7B A;  1PE4 A;  2E0H A;  1KAZ A;  4AEI A;  1NGJ A;  1NH5 A;  1NRB A;  3GL1 A;  3L4I A;  1JZB A;  1P00 A;  5AQJ A;  2KBH A;  2KBK A;  1BMR A;  1ICA A;  1K8B A;  1CHZ A;  1JZA A;  1T1T A;  4AB0 A;  1C56 A;  3A8Y A;  2E3G A;  2KHO A;  1BUP A;  2BUP A;  1KAY A;  3KOW A;  4H5T A;  2JDQ D;  4AAZ A;  1SN4 A;  1I6F A;  1BA1 A;  5AQW A;  3QFP A;  2N66 A;  1HPM A;  1BCG A;  2SN3 A;  2V7Z A;  1QQM A;  1ZU3 A;  1I6G A;  1N4N A;  1NE5 A;  3FZL A;  3LDO A;  3I33 A;  5FPE A;  5AQV A;  2KYQ A;  2G2K A;  2YIO A;  1QQN A;  1LQI A;  1C55 A;  2LY6 A;  5BN9 A;  1GPT A;  3LDL A;  5EX5 A;  5EXW A;  3D2F A;  5AQK A;  5AQF A;  3ATU A;  1AYJ A;  3M3Z A;  1NGA A;  2KPY A;  1ATR A;  1ZYV A;  1T0Z A;  3D2F B;  3KP0 A;  5AQN A;  5KK4 A;  5EVZ A;  1I2U A;  2E3F A;  2KJA A;  1XRS B;  5BPL A;  5F1X A;  5FPM A;  2LI7 A;  5AQS A;  1MR4 A;  1FH3 A;  1NGF A;  2MBK A;  1POI A;  4H5N A;  2M8B B;  5AQT A;  1PTX A;  2B68 A;  3QML A;  3L56 A;  1DJT A;  1T7E A;  2I61 A;  1BA0 A;  2LN8 A;  2N2R A;  2QWO A;  1B3C A;  1ZFU A;  4H5R A;  4KBO A; 
#chains in the Genus database with same CATH homology
 4V1D C;  2ASC A;  1L4V A;  2KGQ A;  1WWN A;  2LJM A;  2LKB A;  2N69 A;  3E7U X;  1BRZ A;  5CY0 A;  1VNB A;  1ZVE A;  1ZYW A;  4KYP A;  2A7T A;  1I2V A;  2NY9 X;  1CN2 A;  2YEO A;  2BRZ A;  2LY5 A;  1LQQ A;  2LR3 A;  1AHO A;  1P0A A;  1VNA A;  4HE7 A;  2ATB A;  2GL1 A;  2MZ0 A;  1TI5 A;  1GPS A;  2N2Q A;  2YBR C;  1NPI A;  1JXC A;  4CQK A;  1OZZ A;  1MYN A;  1LQH A;  1SN1 A;  1JKZ A;  2B3C A;  1BK8 A;  1PX9 A;  1WT7 A;  2LT8 A;  1NRA A;  1KV0 A;  1SNB A;  1SEG A;  2NY8 X;  1B7D A;  1WMT A;  2KBJ A;  4HHF A;  1DQ7 A;  2YC1 C;  1ZUT A;  3PSM A;  2LJ7 A;  1OMY A;  1T7A A;  2KSK A;  1ZVG A;  4UJ0 A;  3E7R L;  1T7B A;  1PE4 A;  2E0H A;  4AEI A;  1NH5 A;  1NRB A;  1ICA A;  1JZB A;  1P00 A;  2KBH A;  2KBK A;  1BMR A;  1CHZ A;  1JZA A;  1T1T A;  4AB0 A;  1C56 A;  2E3G A;  4AAZ A;  1SN4 A;  1I6F A;  2N66 A;  2SN3 A;  1BCG A;  1I6G A;  1ZU3 A;  1N4N A;  1NE5 A;  2KYQ A;  1C55 A;  1LQI A;  2LY6 A;  1GPT A;  1AYJ A;  2KPY A;  1ZYV A;  1T0Z A;  5KK4 A;  1I2U A;  2E3F A;  2KJA A;  2LI7 A;  1MR4 A;  1FH3 A;  2M8B B;  1PTX A;  2B68 A;  1DJT A;  1T7E A;  2I61 A;  2N2R A;  1B3C A;  1ZFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...