4UJ0A

Crystal structure of the tomato defensin tpp3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
48
structure length
48
Chain Sequence
QQICKAPSQTFPGLCFMDSSCRKYCIKEKFTGGHCSKLQRKCLCTKPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOWER-SPECIFIC GAMMA-THIONIN-LIKE PROTEIN/ACIDIC PROTEIN
publication title The Tomato Defensin Tpp3 Binds Phosphatidylinositol (4,5)-Bisphosphate Via a Conserved Dimeric Cationic Grip Conformation to Mediate Cell Lysis.
pubmed doi rcsb
source organism Solanum lycopersicum
molecule tags Antibiotic
total genus 11
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4uj0A00
1ZVGA 1T7BA 1ZYVA 1SN1A 2SN3A 1BMRA 2YBRC 5KK4A 1T7EA 1OZZA 1L4VA 1GPSA 2E3GA 4AB0A 2M8BB 1AYJA 2ASCA 1B7DA 1CHZA 2KGQA 4HHFA 1I6GA 2LJ7A 1T1TA 4V1DC 1ZYWA 1I2UA 2KSKA 2LJMA 1SEGA 1NPIA 1GPTA 1BRZA 1AHOA 1B3CA 4CQKA 2I61A 2KBKA 2GL1A 2KYQA 1T0ZA 2BRZA 2LY5A 4AEIA 2ATBA 1DJTA 2N69A 1LQHA 1WT7A 1BK8A 2YEOA 2N2RA 2KBHA 1PX9A 1P0AA 2KJAA 1NH5A 2B3CA 1ZU3A 3E7RL 1PTXA 1SN4A 1C55A 1P00A 1TI5A 1JZAA 1C56A 4KYPA 1OMYA 1BCGA 1JXCA 2E0HA 1MR4A 1LQIA 2A7TA 4HE7A 1VNBA 2LY6A 2LR3A 1LQQA 1MYNA 1ZVEA 2LI7A 1T7AA 1SNBA 2KBJA 3PSMA 5CY0A 1WWNA 4UJ0A 2MZ0A 1N4NA 1DQ7A 1ZFUA 1JKZA 2NY9X 1NE5A 1I6FA 2N2QA 1ICAA 1KV0A 2B68A 1WMTA 1NRAA 1VNAA 1FH3A 2E3FA 2YC1C 1NRBA 1PE4A 1CN2A 2KPYA 3E7UX 1I2VA 2LT8A 4AAZA 2LKBA 1JZBA 2NY8X 2N66A 1ZUTA
chains in the Genus database with same CATH superfamily
2QWOA 3L56A 1ZVGA 2MN5A 3A8YA 1NGAA 1T7BA 2QXLA 1NGDA 1ZYVA 1SN1A 1ATRA 2QWQA 2SN3A 5EX5A 1BMRA 5AQPA 5AQRA 2YBRC 3IUCA 5KK4A 3KC6A 1T7EA 3KP1A 3LDLA 1OZZA 2GMOA 1GPSA 1L4VA 1NGHA 2E3GA 4AB0A 2M8BB 3GL1A 1YUWA 3LDOA 5AQOA 5AR0A 1AYJA 1QQOA 2ASCA 3I33A 1B7DA 1HJOA 3KOWA 5BN8A 5FPEA 1CHZA 2KGQA 2QW9A 3FZKA 3LDQA 5BPMA 4HHFA 4GNIA 4UAFE 1I6GA 2LJ7A 4FSVA 3BK3C 1T1TA 5EVZA 4V1DC 1ZYWA 5F0XA 1I2UA 5F1XA 2KSKA 2LJMA 1XRSB 1KAXA 1NGBA 1SEGA 1NPIA 1GPTA 3C7NB 3ATUA 3CQXA 2D56A 1BRZA 5AQMA 1AHOA 2QWPA 1BUPA 1QQMA 3D2FA 5AQIA 1B3CA 2YIOA 3LDPA 2I61A 2KBKA 1KAZA 2K35A 4CQKA 1K8BA 2GL1A 2KYQA 1T0ZA 2BUPA 3L6QA 5BPNA 2BRZA 2KHOA 3R2VA 1NGGA 2LY5A 4AEIA 2ATBA 1DJTA 5AQTA 2N69A 1LQHA 1KAYA 1WT7A 3D2FB 5AQJA 1BK8A 2YEOA 3QMLA 1DKGD 2N2RA 3D2EA 5BN9A 1HPMA 2KBHA 3FZHA 5AQGA 1PX9A 1P0AA 2KJAA 3LDNA 3QFPA 4H5NA 1QQNA 4IO8A 1NH5A 3GDQA 2B3CA 2E2FA 1ZU3A 3E7RL 1PTXA 1SN4A 3KOXA 3M3ZA 5AQLA 1C55A 3KOYA 1P00A 4UADE 5AQZA 2JDQD 1TI5A 1JZAA 3QFUA 1C56A 4KYPA 1NGEA 1OMYA 3KVGA 5AQHA 5F2RA 2QWMA 4KBOA 1BCGA 1JXCA 5AQKA 2E0HA 2E8AA 3QI7A 1BA0A 1LQIA 1MR4A 3SF4D 4H5RA 5FPDA 2A7TA 4HE7A 1VNBA 3HSCA 2G2KA 2LY6A 3GKUA 4H5WA 4HWIA 2LR3A 3FZMA 5AQUA 1NGJA 1LQQA 1MYNA 1ZVEA 2LI7A 1T7AA 2QWLA 5AQSA 2QWRA 1SNBA 2KBJA 2V7ZA 5AQWA 5AQXA 3PSMA 1POIA 5EY4A 5CY0A 1WWNA 1NGIA 4UJ0A 5AQQA 5AQFA 1UGLA 1N4NA 2MZ0A 3ATVA 3FE1A 3L4IA 1DQ7A 5FPNA 5BPLA 1ZFUA 1JKZA 2NY9X 1NE5A 2LN8A 1HX1A 2YIPA 3D2EB 1I6FA 2QWNA 2E88A 3KP0A 4UAEF 4H5VA 5AQNA 2VY6A 3AY9A 3FZLA 2N2QA 4H5TA 1ICAA 1KV0A 2B68A 1WMTA 1NRAA 1VNAA 3KHWA 2E3FA 3C7NA 3JXUA 1FH3A 1S3XA 2YC1C 1NRBA 1PE4A 3FZFA 1BA1A 1CN2A 2KPYA 1NGFA 3E7UX 4FL9A 5EXWA 5AQVA 2YILA 2LT8A 5FPMA 4AAZA 1I2VA 2LKBA 1JZBA 3CW4A 1NGCA 3KOZA 2MBKA 2NY8X 5AQYA 2N66A 1ATSA 1ZUTA
chains in the Genus database with same CATH topology
1ZVGA 1T7BA 1ZYVA 1SN1A 2SN3A 1BMRA 2YBRC 5KK4A 1T7EA 1OZZA 1L4VA 1GPSA 2E3GA 4AB0A 2M8BB 1AYJA 2ASCA 1B7DA 1CHZA 2KGQA 4HHFA 1I6GA 2LJ7A 1T1TA 4V1DC 1ZYWA 1I2UA 2KSKA 2LJMA 1SEGA 1NPIA 1GPTA 1BRZA 1AHOA 1B3CA 4CQKA 2I61A 2KBKA 2GL1A 2KYQA 1T0ZA 2BRZA 2LY5A 4AEIA 2ATBA 1DJTA 2N69A 1LQHA 1WT7A 1BK8A 2YEOA 2N2RA 2KBHA 1PX9A 1P0AA 2KJAA 1NH5A 2B3CA 1ZU3A 3E7RL 1PTXA 1SN4A 1C55A 1P00A 1TI5A 1JZAA 1C56A 4KYPA 1OMYA 1BCGA 1JXCA 2E0HA 1MR4A 1LQIA 2A7TA 4HE7A 1VNBA 2LY6A 2LR3A 1LQQA 1MYNA 1ZVEA 2LI7A 1T7AA 1SNBA 2KBJA 3PSMA 5CY0A 1WWNA 4UJ0A 2MZ0A 1N4NA 1DQ7A 1ZFUA 1JKZA 2NY9X 1NE5A 1I6FA 2N2QA 1ICAA 1KV0A 2B68A 1WMTA 1NRAA 1VNAA 1FH3A 2E3FA 2YC1C 1NRBA 1PE4A 1CN2A 2KPYA 3E7UX 1I2VA 2LT8A 4AAZA 2LKBA 1JZBA 2NY8X 2N66A 1ZUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVG A;  1T7B A;  1ZYV A;  1SN1 A;  2SN3 A;  1BMR A;  2YBR C;  5KK4 A;  1T7E A;  1OZZ A;  1L4V A;  1GPS A;  2E3G A;  4AB0 A;  2M8B B;  1AYJ A;  2ASC A;  1B7D A;  1CHZ A;  2KGQ A;  4HHF A;  1I6G A;  2LJ7 A;  1T1T A;  4V1D C;  1ZYW A;  1I2U A;  2KSK A;  2LJM A;  1SEG A;  1NPI A;  1GPT A;  1BRZ A;  1AHO A;  1B3C A;  4CQK A;  2I61 A;  2KBK A;  2GL1 A;  2KYQ A;  1T0Z A;  2BRZ A;  2LY5 A;  4AEI A;  2ATB A;  1DJT A;  2N69 A;  1LQH A;  1WT7 A;  1BK8 A;  2YEO A;  2N2R A;  2KBH A;  1PX9 A;  1P0A A;  2KJA A;  1NH5 A;  2B3C A;  1ZU3 A;  3E7R L;  1PTX A;  1SN4 A;  1C55 A;  1P00 A;  1TI5 A;  1JZA A;  1C56 A;  4KYP A;  1OMY A;  1BCG A;  1JXC A;  2E0H A;  1MR4 A;  1LQI A;  2A7T A;  4HE7 A;  1VNB A;  2LY6 A;  2LR3 A;  1LQQ A;  1MYN A;  1ZVE A;  2LI7 A;  1T7A A;  1SNB A;  2KBJ A;  3PSM A;  5CY0 A;  1WWN A;  4UJ0 A;  2MZ0 A;  1N4N A;  1DQ7 A;  1ZFU A;  1JKZ A;  2NY9 X;  1NE5 A;  1I6F A;  2N2Q A;  1ICA A;  1KV0 A;  2B68 A;  1WMT A;  1NRA A;  1VNA A;  1FH3 A;  2E3F A;  2YC1 C;  1NRB A;  1PE4 A;  1CN2 A;  2KPY A;  3E7U X;  1I2V A;  2LT8 A;  4AAZ A;  2LKB A;  1JZB A;  2NY8 X;  2N66 A;  1ZUT A; 
#chains in the Genus database with same CATH topology
 2QWO A;  3L56 A;  1ZVG A;  2MN5 A;  3A8Y A;  1NGA A;  1T7B A;  2QXL A;  1NGD A;  1ZYV A;  1SN1 A;  1ATR A;  2QWQ A;  2SN3 A;  5EX5 A;  1BMR A;  5AQP A;  5AQR A;  2YBR C;  3IUC A;  5KK4 A;  3KC6 A;  1T7E A;  3KP1 A;  3LDL A;  1OZZ A;  2GMO A;  1GPS A;  1L4V A;  1NGH A;  2E3G A;  4AB0 A;  2M8B B;  3GL1 A;  1YUW A;  3LDO A;  5AQO A;  5AR0 A;  1AYJ A;  1QQO A;  2ASC A;  3I33 A;  1B7D A;  1HJO A;  3KOW A;  5BN8 A;  5FPE A;  1CHZ A;  2KGQ A;  2QW9 A;  3FZK A;  3LDQ A;  5BPM A;  4HHF A;  4GNI A;  4UAF E;  1I6G A;  2LJ7 A;  4FSV A;  3BK3 C;  1T1T A;  5EVZ A;  4V1D C;  1ZYW A;  5F0X A;  1I2U A;  5F1X A;  2KSK A;  2LJM A;  1XRS B;  1KAX A;  1NGB A;  1SEG A;  1NPI A;  1GPT A;  3C7N B;  3ATU A;  3CQX A;  2D56 A;  1BRZ A;  5AQM A;  1AHO A;  2QWP A;  1BUP A;  1QQM A;  3D2F A;  5AQI A;  1B3C A;  2YIO A;  3LDP A;  2I61 A;  2KBK A;  1KAZ A;  2K35 A;  4CQK A;  1K8B A;  2GL1 A;  2KYQ A;  1T0Z A;  2BUP A;  3L6Q A;  5BPN A;  2BRZ A;  2KHO A;  3R2V A;  1NGG A;  2LY5 A;  4AEI A;  2ATB A;  1DJT A;  5AQT A;  2N69 A;  1LQH A;  1KAY A;  1WT7 A;  3D2F B;  5AQJ A;  1BK8 A;  2YEO A;  3QML A;  1DKG D;  2N2R A;  3D2E A;  5BN9 A;  1HPM A;  2KBH A;  3FZH A;  5AQG A;  1PX9 A;  1P0A A;  2KJA A;  3LDN A;  3QFP A;  4H5N A;  1QQN A;  4IO8 A;  1NH5 A;  3GDQ A;  2B3C A;  2E2F A;  1ZU3 A;  3E7R L;  1PTX A;  1SN4 A;  3KOX A;  3M3Z A;  5AQL A;  1C55 A;  3KOY A;  1P00 A;  4UAD E;  5AQZ A;  2JDQ D;  1TI5 A;  1JZA A;  3QFU A;  1C56 A;  4KYP A;  1NGE A;  1OMY A;  3KVG A;  5AQH A;  5F2R A;  2QWM A;  4KBO A;  1BCG A;  1JXC A;  5AQK A;  2E0H A;  2E8A A;  3QI7 A;  1BA0 A;  1LQI A;  1MR4 A;  3SF4 D;  4H5R A;  5FPD A;  2A7T A;  4HE7 A;  1VNB A;  3HSC A;  2G2K A;  2LY6 A;  3GKU A;  4H5W A;  4HWI A;  2LR3 A;  3FZM A;  5AQU A;  1NGJ A;  1LQQ A;  1MYN A;  1ZVE A;  2LI7 A;  1T7A A;  2QWL A;  5AQS A;  2QWR A;  1SNB A;  2KBJ A;  2V7Z A;  5AQW A;  5AQX A;  3PSM A;  1POI A;  5EY4 A;  5CY0 A;  1WWN A;  1NGI A;  4UJ0 A;  5AQQ A;  5AQF A;  1UGL A;  1N4N A;  2MZ0 A;  3ATV A;  3FE1 A;  3L4I A;  1DQ7 A;  5FPN A;  5BPL A;  1ZFU A;  1JKZ A;  2NY9 X;  1NE5 A;  2LN8 A;  1HX1 A;  2YIP A;  3D2E B;  1I6F A;  2QWN A;  2E88 A;  3KP0 A;  4UAE F;  4H5V A;  5AQN A;  2VY6 A;  3AY9 A;  3FZL A;  2N2Q A;  4H5T A;  1ICA A;  1KV0 A;  2B68 A;  1WMT A;  1NRA A;  1VNA A;  3KHW A;  2E3F A;  3C7N A;  3JXU A;  1FH3 A;  1S3X A;  2YC1 C;  1NRB A;  1PE4 A;  3FZF A;  1BA1 A;  1CN2 A;  2KPY A;  1NGF A;  3E7U X;  4FL9 A;  5EXW A;  5AQV A;  2YIL A;  2LT8 A;  5FPM A;  4AAZ A;  1I2V A;  2LKB A;  1JZB A;  3CW4 A;  1NGC A;  3KOZ A;  2MBK A;  2NY8 X;  5AQY A;  2N66 A;  1ATS A;  1ZUT A; 
#chains in the Genus database with same CATH homology
 1ZVG A;  1T7B A;  1ZYV A;  1SN1 A;  2SN3 A;  1BMR A;  2YBR C;  5KK4 A;  1T7E A;  1OZZ A;  1L4V A;  1GPS A;  2E3G A;  4AB0 A;  2M8B B;  1AYJ A;  2ASC A;  1B7D A;  1CHZ A;  2KGQ A;  4HHF A;  1I6G A;  2LJ7 A;  1T1T A;  4V1D C;  1ZYW A;  1I2U A;  2KSK A;  2LJM A;  1SEG A;  1NPI A;  1GPT A;  1BRZ A;  1AHO A;  1B3C A;  4CQK A;  2I61 A;  2KBK A;  2GL1 A;  2KYQ A;  1T0Z A;  2BRZ A;  2LY5 A;  4AEI A;  2ATB A;  1DJT A;  2N69 A;  1LQH A;  1WT7 A;  1BK8 A;  2YEO A;  2N2R A;  2KBH A;  1PX9 A;  1P0A A;  2KJA A;  1NH5 A;  2B3C A;  1ZU3 A;  3E7R L;  1PTX A;  1SN4 A;  1C55 A;  1P00 A;  1TI5 A;  1JZA A;  1C56 A;  4KYP A;  1OMY A;  1BCG A;  1JXC A;  2E0H A;  1MR4 A;  1LQI A;  2A7T A;  4HE7 A;  1VNB A;  2LY6 A;  2LR3 A;  1LQQ A;  1MYN A;  1ZVE A;  2LI7 A;  1T7A A;  1SNB A;  2KBJ A;  3PSM A;  5CY0 A;  1WWN A;  4UJ0 A;  2MZ0 A;  1N4N A;  1DQ7 A;  1ZFU A;  1JKZ A;  2NY9 X;  1NE5 A;  1I6F A;  2N2Q A;  1ICA A;  1KV0 A;  2B68 A;  1WMT A;  1NRA A;  1VNA A;  1FH3 A;  2E3F A;  2YC1 C;  1NRB A;  1PE4 A;  1CN2 A;  2KPY A;  3E7U X;  1I2V A;  2LT8 A;  4AAZ A;  2LKB A;  1JZB A;  2NY8 X;  2N66 A;  1ZUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...