1TI5A

Solution structure of plant defensin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
b'RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords plant defensin
publication title Solution structure of the plant defensin VrD1 from mung bean and its possible role in insecticidal activity against bruchids.
pubmed doi rcsb
molecule tags Plant protein
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ti5A00
1WMTA 4HHFA 1T7AA 1ZFUA 2N66A 1B3CA 1GPSA 2E3FA 1JZAA 1KV0A 1ZYWA 1LQIA 1CHZA 1T7BA 1WWNA 1B7DA 2N2QA 1NH5A 4KYPA 1CN2A 4CQKA 1T1TA 1ZVGA 1FH3A 2KPYA 1I6FA 1ICAA 1WT7A 2N69A 2KBHA 2NY8X 4HE7A 1LQHA 2YC1C 2LJ7A 1ZVEA 2GL1A 2LY6A 1DJTA 1MR4A 2NY9X 1BMRA 1N4NA 5KK4A 3E7UX 3E7RL 1T7EA 2B3CA 4AAZA 1SEGA 2ASCA 2YBRC 2N2RA 1BRZA 2E3GA 2BRZA 1JXCA 2A7TA 2I61A 1T0ZA 2LKBA 4UJ0A 2KBJA 1P0AA 1DQ7A 1PX9A 2KJAA 1OMYA 1TI5A 1BCGA 3PSMA 1ZUTA 1OZZA 1C55A 1I2VA 2LR3A 1SN4A 1NPIA 1I6GA 2E0HA 2KGQA 1NRAA 2B68A 1ZYVA 1JKZA 2SN3A 1P00A 1GPTA 2ATBA 2MZ0A 4AB0A 2KSKA 1NE5A 2LY5A 1LQQA 1SN1A 2KBKA 2YEOA 1ZU3A 1SNBA 1L4VA 1BK8A 2KYQA 5CY0A 1AHOA 1VNAA 1JZBA 2M8BB 1I2UA 2LJMA 2LT8A 2LI7A 1NRBA 1AYJA 1C56A 4V1DC 4AEIA 1PE4A 1PTXA 1MYNA 1VNBA
chains in the Genus database with same CATH superfamily
1ATSA 1S3XA 1BUPA 1WMTA 2QWMA 5AQGA 5BPLA 4HHFA 4UADE 5AQUA 1T7AA 1ZFUA 2N66A 3LDLA 1B3CA 2LN8A 1GPSA 2E3FA 1JZAA 3D2EB 1NGJA 1KV0A 2E2FA 2MN5A 1ZYWA 3KHWA 5AQQA 1LQIA 1CHZA 1NGAA 1T7BA 1WWNA 2G2KA 2YIOA 1B7DA 1NGIA 3JXUA 2N2QA 5BN9A 1NH5A 1DKGD 4GNIA 4KYPA 3LDOA 1CN2A 5AQYA 4CQKA 3GKUA 3D2EA 5F2RA 1T1TA 1ZVGA 3KOYA 3KVGA 1FH3A 3KOZA 5FPEA 3KP0A 3LDQA 2KPYA 3HSCA 1I6FA 1ICAA 1WT7A 2N69A 2KBHA 2NY8X 4HE7A 1LQHA 3KOXA 2YC1C 2LJ7A 1ZVEA 2GL1A 3FE1A 2LY6A 3A8YA 1DJTA 3QFUA 3IUCA 3L6QA 2MBKA 1HPMA 1KAXA 1MR4A 2NY9X 1N4NA 2QWQA 4H5WA 1QQNA 5EVZA 5KK4A 3E7UX 5FPMA 3ATVA 3E7RL 5AQHA 1T7EA 2B3CA 4AAZA 5AQMA 2QWLA 1NGDA 3C7NB 1SEGA 2ASCA 2K35A 2QWPA 2V7ZA 2N2RA 1NGFA 2YBRC 3M3ZA 5AQXA 5AQZA 2E3GA 2BRZA 3AY9A 5AQWA 1K8BA 3FZFA 1JXCA 3I33A 2A7TA 1ATRA 1KAYA 1T0ZA 2GMOA 2E88A 2I61A 2LKBA 3FZLA 2KBJA 4FSVA 4UJ0A 1P0AA 1DQ7A 1PX9A 3FZMA 2KJAA 5F1XA 5BPNA 5FPNA 3QMLA 3C7NA 2JDQD 1OMYA 1TI5A 1BCGA 2QW9A 4FL9A 4UAEF 2QWOA 3PSMA 1UGLA 4H5RA 5AQRA 5AQOA 4H5TA 1ZUTA 2E8AA 5AQPA 1BRZA 5EXWA 1OZZA 4H5VA 5AQSA 2QWNA 5AQNA 1NGBA 1C55A 5F0XA 2KHOA 1I2VA 2LR3A 1SN4A 3LDNA 5BN8A 1BMRA 5AQTA 5AQLA 5AQVA 1NPIA 2YILA 2E0HA 3QI7A 4KBOA 1NGEA 2KGQA 1I6GA 2QXLA 1BA1A 1NRAA 1ZYVA 2B68A 1JKZA 3CQXA 2SN3A 3CW4A 1P00A 5AQKA 1XRSB 3D2FB 3FZHA 5EX5A 1GPTA 1HJOA 2VY6A 1NGHA 2ATBA 3FZKA 2MZ0A 4AB0A 2KSKA 3ATUA 1NE5A 2LY5A 1LQQA 5BPMA 4UAFE 1SN1A 2KBKA 2YEOA 1ZU3A 1NGCA 2BUPA 1BA0A 1SNBA 3D2FA 3LDPA 3QFPA 1YUWA 3L56A 2YIPA 4H5NA 5AQFA 1QQOA 5AQIA 1L4VA 1BK8A 2KYQA 3GDQA 3KP1A 3R2VA 5CY0A 1AHOA 2D56A 3GL1A 4HWIA 5EY4A 1VNAA 2QWRA 1JZBA 2M8BB 3L4IA 3SF4D 1I2UA 1NGGA 5AQJA 2LJMA 1HX1A 2LT8A 3BK3C 5FPDA 2LI7A 1NRBA 4IO8A 1AYJA 1C56A 1KAZA 3KOWA 4V1DC 3KC6A 5AR0A 1PE4A 1PTXA 4AEIA 1POIA 1MYNA 1VNBA 1QQMA
chains in the Genus database with same CATH topology
1WMTA 4HHFA 1T7AA 1ZFUA 2N66A 1B3CA 1GPSA 2E3FA 1JZAA 1KV0A 1ZYWA 1LQIA 1CHZA 1T7BA 1WWNA 1B7DA 2N2QA 1NH5A 4KYPA 1CN2A 4CQKA 1T1TA 1ZVGA 1FH3A 2KPYA 1I6FA 1ICAA 1WT7A 2N69A 2KBHA 2NY8X 4HE7A 1LQHA 2YC1C 2LJ7A 1ZVEA 2GL1A 2LY6A 1DJTA 1MR4A 2NY9X 1BMRA 1N4NA 5KK4A 3E7UX 3E7RL 1T7EA 2B3CA 4AAZA 1SEGA 2ASCA 2YBRC 2N2RA 1BRZA 2E3GA 2BRZA 1JXCA 2A7TA 2I61A 1T0ZA 2LKBA 4UJ0A 2KBJA 1P0AA 1DQ7A 1PX9A 2KJAA 1OMYA 1TI5A 1BCGA 3PSMA 1ZUTA 1OZZA 1C55A 1I2VA 2LR3A 1SN4A 1NPIA 1I6GA 2E0HA 2KGQA 1NRAA 2B68A 1ZYVA 1JKZA 2SN3A 1P00A 1GPTA 2ATBA 2MZ0A 4AB0A 2KSKA 1NE5A 2LY5A 1LQQA 1SN1A 2KBKA 2YEOA 1ZU3A 1SNBA 1L4VA 1BK8A 2KYQA 5CY0A 1AHOA 1VNAA 1JZBA 2M8BB 1I2UA 2LJMA 2LT8A 2LI7A 1NRBA 1AYJA 1C56A 4V1DC 4AEIA 1PE4A 1PTXA 1MYNA 1VNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMT A;  4HHF A;  1T7A A;  1ZFU A;  2N66 A;  1B3C A;  1GPS A;  2E3F A;  1JZA A;  1KV0 A;  1ZYW A;  1LQI A;  1CHZ A;  1T7B A;  1WWN A;  1B7D A;  2N2Q A;  1NH5 A;  4KYP A;  1CN2 A;  4CQK A;  1T1T A;  1ZVG A;  1FH3 A;  2KPY A;  1I6F A;  1ICA A;  1WT7 A;  2N69 A;  2KBH A;  2NY8 X;  4HE7 A;  1LQH A;  2YC1 C;  2LJ7 A;  1ZVE A;  2GL1 A;  2LY6 A;  1DJT A;  1MR4 A;  2NY9 X;  1BMR A;  1N4N A;  5KK4 A;  3E7U X;  3E7R L;  1T7E A;  2B3C A;  4AAZ A;  1SEG A;  2ASC A;  2YBR C;  2N2R A;  1BRZ A;  2E3G A;  2BRZ A;  1JXC A;  2A7T A;  2I61 A;  1T0Z A;  2LKB A;  4UJ0 A;  2KBJ A;  1P0A A;  1DQ7 A;  1PX9 A;  2KJA A;  1OMY A;  1TI5 A;  1BCG A;  3PSM A;  1ZUT A;  1OZZ A;  1C55 A;  1I2V A;  2LR3 A;  1SN4 A;  1NPI A;  1I6G A;  2E0H A;  2KGQ A;  1NRA A;  2B68 A;  1ZYV A;  1JKZ A;  2SN3 A;  1P00 A;  1GPT A;  2ATB A;  2MZ0 A;  4AB0 A;  2KSK A;  1NE5 A;  2LY5 A;  1LQQ A;  1SN1 A;  2KBK A;  2YEO A;  1ZU3 A;  1SNB A;  1L4V A;  1BK8 A;  2KYQ A;  5CY0 A;  1AHO A;  1VNA A;  1JZB A;  2M8B B;  1I2U A;  2LJM A;  2LT8 A;  2LI7 A;  1NRB A;  1AYJ A;  1C56 A;  4V1D C;  4AEI A;  1PE4 A;  1PTX A;  1MYN A;  1VNB A; 
#chains in the Genus database with same CATH topology
 1ATS A;  1S3X A;  1BUP A;  1WMT A;  2QWM A;  5AQG A;  5BPL A;  4HHF A;  4UAD E;  5AQU A;  1T7A A;  1ZFU A;  2N66 A;  3LDL A;  1B3C A;  2LN8 A;  1GPS A;  2E3F A;  1JZA A;  3D2E B;  1NGJ A;  1KV0 A;  2E2F A;  2MN5 A;  1ZYW A;  3KHW A;  5AQQ A;  1LQI A;  1CHZ A;  1NGA A;  1T7B A;  1WWN A;  2G2K A;  2YIO A;  1B7D A;  1NGI A;  3JXU A;  2N2Q A;  5BN9 A;  1NH5 A;  1DKG D;  4GNI A;  4KYP A;  3LDO A;  1CN2 A;  5AQY A;  4CQK A;  3GKU A;  3D2E A;  5F2R A;  1T1T A;  1ZVG A;  3KOY A;  3KVG A;  1FH3 A;  3KOZ A;  5FPE A;  3KP0 A;  3LDQ A;  2KPY A;  3HSC A;  1I6F A;  1ICA A;  1WT7 A;  2N69 A;  2KBH A;  2NY8 X;  4HE7 A;  1LQH A;  3KOX A;  2YC1 C;  2LJ7 A;  1ZVE A;  2GL1 A;  3FE1 A;  2LY6 A;  3A8Y A;  1DJT A;  3QFU A;  3IUC A;  3L6Q A;  2MBK A;  1HPM A;  1KAX A;  1MR4 A;  2NY9 X;  1N4N A;  2QWQ A;  4H5W A;  1QQN A;  5EVZ A;  5KK4 A;  3E7U X;  5FPM A;  3ATV A;  3E7R L;  5AQH A;  1T7E A;  2B3C A;  4AAZ A;  5AQM A;  2QWL A;  1NGD A;  3C7N B;  1SEG A;  2ASC A;  2K35 A;  2QWP A;  2V7Z A;  2N2R A;  1NGF A;  2YBR C;  3M3Z A;  5AQX A;  5AQZ A;  2E3G A;  2BRZ A;  3AY9 A;  5AQW A;  1K8B A;  3FZF A;  1JXC A;  3I33 A;  2A7T A;  1ATR A;  1KAY A;  1T0Z A;  2GMO A;  2E88 A;  2I61 A;  2LKB A;  3FZL A;  2KBJ A;  4FSV A;  4UJ0 A;  1P0A A;  1DQ7 A;  1PX9 A;  3FZM A;  2KJA A;  5F1X A;  5BPN A;  5FPN A;  3QML A;  3C7N A;  2JDQ D;  1OMY A;  1TI5 A;  1BCG A;  2QW9 A;  4FL9 A;  4UAE F;  2QWO A;  3PSM A;  1UGL A;  4H5R A;  5AQR A;  5AQO A;  4H5T A;  1ZUT A;  2E8A A;  5AQP A;  1BRZ A;  5EXW A;  1OZZ A;  4H5V A;  5AQS A;  2QWN A;  5AQN A;  1NGB A;  1C55 A;  5F0X A;  2KHO A;  1I2V A;  2LR3 A;  1SN4 A;  3LDN A;  5BN8 A;  1BMR A;  5AQT A;  5AQL A;  5AQV A;  1NPI A;  2YIL A;  2E0H A;  3QI7 A;  4KBO A;  1NGE A;  2KGQ A;  1I6G A;  2QXL A;  1BA1 A;  1NRA A;  1ZYV A;  2B68 A;  1JKZ A;  3CQX A;  2SN3 A;  3CW4 A;  1P00 A;  5AQK A;  1XRS B;  3D2F B;  3FZH A;  5EX5 A;  1GPT A;  1HJO A;  2VY6 A;  1NGH A;  2ATB A;  3FZK A;  2MZ0 A;  4AB0 A;  2KSK A;  3ATU A;  1NE5 A;  2LY5 A;  1LQQ A;  5BPM A;  4UAF E;  1SN1 A;  2KBK A;  2YEO A;  1ZU3 A;  1NGC A;  2BUP A;  1BA0 A;  1SNB A;  3D2F A;  3LDP A;  3QFP A;  1YUW A;  3L56 A;  2YIP A;  4H5N A;  5AQF A;  1QQO A;  5AQI A;  1L4V A;  1BK8 A;  2KYQ A;  3GDQ A;  3KP1 A;  3R2V A;  5CY0 A;  1AHO A;  2D56 A;  3GL1 A;  4HWI A;  5EY4 A;  1VNA A;  2QWR A;  1JZB A;  2M8B B;  3L4I A;  3SF4 D;  1I2U A;  1NGG A;  5AQJ A;  2LJM A;  1HX1 A;  2LT8 A;  3BK3 C;  5FPD A;  2LI7 A;  1NRB A;  4IO8 A;  1AYJ A;  1C56 A;  1KAZ A;  3KOW A;  4V1D C;  3KC6 A;  5AR0 A;  1PE4 A;  1PTX A;  4AEI A;  1POI A;  1MYN A;  1VNB A;  1QQM A; 
#chains in the Genus database with same CATH homology
 1WMT A;  4HHF A;  1T7A A;  1ZFU A;  2N66 A;  1B3C A;  1GPS A;  2E3F A;  1JZA A;  1KV0 A;  1ZYW A;  1LQI A;  1CHZ A;  1T7B A;  1WWN A;  1B7D A;  2N2Q A;  1NH5 A;  4KYP A;  1CN2 A;  4CQK A;  1T1T A;  1ZVG A;  1FH3 A;  2KPY A;  1I6F A;  1ICA A;  1WT7 A;  2N69 A;  2KBH A;  2NY8 X;  4HE7 A;  1LQH A;  2YC1 C;  2LJ7 A;  1ZVE A;  2GL1 A;  2LY6 A;  1DJT A;  1MR4 A;  2NY9 X;  1BMR A;  1N4N A;  5KK4 A;  3E7U X;  3E7R L;  1T7E A;  2B3C A;  4AAZ A;  1SEG A;  2ASC A;  2YBR C;  2N2R A;  1BRZ A;  2E3G A;  2BRZ A;  1JXC A;  2A7T A;  2I61 A;  1T0Z A;  2LKB A;  4UJ0 A;  2KBJ A;  1P0A A;  1DQ7 A;  1PX9 A;  2KJA A;  1OMY A;  1TI5 A;  1BCG A;  3PSM A;  1ZUT A;  1OZZ A;  1C55 A;  1I2V A;  2LR3 A;  1SN4 A;  1NPI A;  1I6G A;  2E0H A;  2KGQ A;  1NRA A;  2B68 A;  1ZYV A;  1JKZ A;  2SN3 A;  1P00 A;  1GPT A;  2ATB A;  2MZ0 A;  4AB0 A;  2KSK A;  1NE5 A;  2LY5 A;  1LQQ A;  1SN1 A;  2KBK A;  2YEO A;  1ZU3 A;  1SNB A;  1L4V A;  1BK8 A;  2KYQ A;  5CY0 A;  1AHO A;  1VNA A;  1JZB A;  2M8B B;  1I2U A;  2LJM A;  2LT8 A;  2LI7 A;  1NRB A;  1AYJ A;  1C56 A;  4V1D C;  4AEI A;  1PE4 A;  1PTX A;  1MYN A;  1VNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...