1TI5A

Solution structure of plant defensin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
46
structure length
46
Chain Sequence
RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords plant defensin
publication title Solution structure of the plant defensin VrD1 from mung bean and its possible role in insecticidal activity against bruchids.
pubmed doi rcsb
molecule tags Plant protein
total genus 8
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ti5A00
2NY8X 2B3CA 4AEIA 1ICAA 2LKBA 2YBRC 2NY9X 1SN1A 1JZAA 1PE4A 1ZUTA 1DQ7A 1I6FA 1AHOA 1I2UA 2SN3A 4UJ0A 5KK4A 1PTXA 1T7EA 1WMTA 1T0ZA 1BCGA 2KJAA 2LI7A 1B7DA 1N4NA 2ATBA 1NRAA 1VNBA 2LJMA 2LY6A 2E3FA 1ZU3A 2B68A 2BRZA 1T7BA 1PX9A 5CY0A 2A7TA 3E7RL 1BRZA 1OMYA 1SEGA 1WWNA 4KYPA 1VNAA 1AYJA 1JKZA 2LT8A 1TI5A 4HHFA 1ZVEA 2YEOA 1ZYVA 1LQIA 1LQHA 1ZVGA 4AAZA 1JZBA 1NPIA 2N69A 1OZZA 4V1DC 2E3GA 1ZFUA 2LJ7A 2ASCA 1ZYWA 1NH5A 3E7UX 1NRBA 2YC1C 1NE5A 4AB0A 1T7AA 1P0AA 2N66A 2LY5A 2M8BB 1LQQA 1B3CA 1CN2A 2E0HA 1GPTA 1JXCA 4CQKA 2LR3A 1SNBA 2KYQA 1T1TA 2KBKA 1WT7A 2KBHA 4HE7A 2GL1A 2I61A 1BK8A 2KBJA 2KSKA 1SN4A 2MZ0A 1KV0A 1C56A 1FH3A 1CHZA 1BMRA 1C55A 1MYNA 1GPSA 1DJTA 1P00A 2KGQA 1L4VA 2N2RA 1I6GA 2KPYA 3PSMA 2N2QA 1MR4A 1I2VA
chains in the Genus database with same CATH superfamily
2QWRA 5AQUA 2NY8X 2B3CA 4AEIA 1QQNA 4UAFE 1ICAA 1NGGA 1YUWA 5AR0A 2LKBA 4H5WA 2YBRC 2NY9X 1SN1A 1JZAA 1NGCA 1PE4A 1ZUTA 1BA1A 2QWMA 5FPEA 3KOYA 4H5VA 1DQ7A 1I6FA 2LN8A 1AHOA 3BK3C 2QW9A 2SN3A 3ATVA 4UAEF 4UJ0A 1PTXA 5KK4A 3SF4D 1T7EA 1I2UA 3IUCA 5F0XA 3HSCA 1QQMA 1WMTA 5FPNA 5AQSA 5AQVA 3KVGA 2D56A 3R2VA 1T0ZA 1NGFA 1BCGA 2KJAA 1KAXA 2GMOA 2LI7A 5BN8A 1B7DA 1N4NA 2ATBA 1NRAA 1HPMA 1HX1A 1POIA 1KAYA 1VNBA 2MN5A 5BPLA 3QI7A 2K35A 1K8BA 3D2EA 3FZHA 1ATSA 2LJMA 2LY6A 2E3FA 1ZU3A 1NGIA 4FSVA 4IO8A 2B68A 5EX5A 2E2FA 4FL9A 5FPMA 5EVZA 2BRZA 1T7BA 1PX9A 5BPNA 3LDLA 5CY0A 2A7TA 3E7RL 4KBOA 1BRZA 1OMYA 1SEGA 1WWNA 4KYPA 1ATRA 1VNAA 1AYJA 2YIOA 4GNIA 5AQQA 1DKGD 3CW4A 1JKZA 2LT8A 5AQJA 1TI5A 5AQLA 4HHFA 3FZFA 1ZVEA 2YILA 3CQXA 5AQWA 3LDQA 2BUPA 2YEOA 1ZYVA 5AQOA 5AQYA 1LQIA 1LQHA 1ZVGA 5AQGA 4AAZA 1JZBA 1NPIA 3I33A 3LDOA 5AQTA 2N69A 1OZZA 4V1DC 5EY4A 5AQPA 3L4IA 2E8AA 5F1XA 2E3GA 2KHOA 3GKUA 3JXUA 3LDPA 3LDNA 1BA0A 4H5NA 1ZFUA 3KP0A 2LJ7A 3M3ZA 5BPMA 2QXLA 2ASCA 5AQFA 5BN9A 3D2FB 1ZYWA 1NH5A 3E7UX 3KC6A 2G2KA 1NRBA 2YC1C 3A8YA 3KOZA 1KAZA 1QQOA 1NE5A 2QWPA 2QWNA 1XRSB 2QWLA 3GDQA 4UADE 2E88A 4AB0A 3C7NB 2VY6A 1T7AA 3KOXA 2QWOA 5F2RA 1BUPA 1P0AA 1HJOA 2LY5A 2M8BB 1LQQA 2N66A 3L56A 4HWIA 5AQKA 2E0HA 1B3CA 1CN2A 1GPTA 1JXCA 4CQKA 2LR3A 1NGDA 1SNBA 5AQIA 2KYQA 1T1TA 2KBKA 1WT7A 2KBHA 1NGEA 3L6QA 4HE7A 2GL1A 2I61A 3KP1A 3QMLA 5AQHA 1BK8A 2KBJA 5AQMA 2KSKA 2JDQD 1SN4A 3FE1A 5FPDA 3KHWA 2MZ0A 1KV0A 3D2EB 1C56A 1NGJA 1NGHA 3ATUA 1FH3A 1CHZA 1S3XA 3D2FA 1BMRA 3QFPA 1C55A 1MYNA 1GPSA 1DJTA 1P00A 2QWQA 5AQXA 2KGQA 2YIPA 3C7NA 4H5RA 2MBKA 3GL1A 5AQZA 1L4VA 4H5TA 3FZMA 2N2RA 1NGBA 3QFUA 5AQNA 2V7ZA 1UGLA 2KPYA 1I6GA 3PSMA 3AY9A 2N2QA 3FZKA 1MR4A 3KOWA 1I2VA 3FZLA 5EXWA 5AQRA 1NGAA
chains in the Genus database with same CATH topology
2NY8X 2B3CA 4AEIA 1ICAA 2LKBA 2YBRC 2NY9X 1SN1A 1JZAA 1PE4A 1ZUTA 1DQ7A 1I6FA 1AHOA 1I2UA 2SN3A 4UJ0A 5KK4A 1PTXA 1T7EA 1WMTA 1T0ZA 1BCGA 2KJAA 2LI7A 1B7DA 1N4NA 2ATBA 1NRAA 1VNBA 2LJMA 2LY6A 2E3FA 1ZU3A 2B68A 2BRZA 1T7BA 1PX9A 5CY0A 2A7TA 3E7RL 1BRZA 1OMYA 1SEGA 1WWNA 4KYPA 1VNAA 1AYJA 1JKZA 2LT8A 1TI5A 4HHFA 1ZVEA 2YEOA 1ZYVA 1LQIA 1LQHA 1ZVGA 4AAZA 1JZBA 1NPIA 2N69A 1OZZA 4V1DC 2E3GA 1ZFUA 2LJ7A 2ASCA 1ZYWA 1NH5A 3E7UX 1NRBA 2YC1C 1NE5A 4AB0A 1T7AA 1P0AA 2N66A 2LY5A 2M8BB 1LQQA 1B3CA 1CN2A 2E0HA 1GPTA 1JXCA 4CQKA 2LR3A 1SNBA 2KYQA 1T1TA 2KBKA 1WT7A 2KBHA 4HE7A 2GL1A 2I61A 1BK8A 2KBJA 2KSKA 1SN4A 2MZ0A 1KV0A 1C56A 1FH3A 1CHZA 1BMRA 1C55A 1MYNA 1GPSA 1DJTA 1P00A 2KGQA 1L4VA 2N2RA 1I6GA 2KPYA 3PSMA 2N2QA 1MR4A 1I2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NY8 X;  2B3C A;  4AEI A;  1ICA A;  2LKB A;  2YBR C;  2NY9 X;  1SN1 A;  1JZA A;  1PE4 A;  1ZUT A;  1DQ7 A;  1I6F A;  1AHO A;  1I2U A;  2SN3 A;  4UJ0 A;  5KK4 A;  1PTX A;  1T7E A;  1WMT A;  1T0Z A;  1BCG A;  2KJA A;  2LI7 A;  1B7D A;  1N4N A;  2ATB A;  1NRA A;  1VNB A;  2LJM A;  2LY6 A;  2E3F A;  1ZU3 A;  2B68 A;  2BRZ A;  1T7B A;  1PX9 A;  5CY0 A;  2A7T A;  3E7R L;  1BRZ A;  1OMY A;  1SEG A;  1WWN A;  4KYP A;  1VNA A;  1AYJ A;  1JKZ A;  2LT8 A;  1TI5 A;  4HHF A;  1ZVE A;  2YEO A;  1ZYV A;  1LQI A;  1LQH A;  1ZVG A;  4AAZ A;  1JZB A;  1NPI A;  2N69 A;  1OZZ A;  4V1D C;  2E3G A;  1ZFU A;  2LJ7 A;  2ASC A;  1ZYW A;  1NH5 A;  3E7U X;  1NRB A;  2YC1 C;  1NE5 A;  4AB0 A;  1T7A A;  1P0A A;  2N66 A;  2LY5 A;  2M8B B;  1LQQ A;  1B3C A;  1CN2 A;  2E0H A;  1GPT A;  1JXC A;  4CQK A;  2LR3 A;  1SNB A;  2KYQ A;  1T1T A;  2KBK A;  1WT7 A;  2KBH A;  4HE7 A;  2GL1 A;  2I61 A;  1BK8 A;  2KBJ A;  2KSK A;  1SN4 A;  2MZ0 A;  1KV0 A;  1C56 A;  1FH3 A;  1CHZ A;  1BMR A;  1C55 A;  1MYN A;  1GPS A;  1DJT A;  1P00 A;  2KGQ A;  1L4V A;  2N2R A;  1I6G A;  2KPY A;  3PSM A;  2N2Q A;  1MR4 A;  1I2V A; 
#chains in the Genus database with same CATH topology
 2QWR A;  5AQU A;  2NY8 X;  2B3C A;  4AEI A;  1QQN A;  4UAF E;  1ICA A;  1NGG A;  1YUW A;  5AR0 A;  2LKB A;  4H5W A;  2YBR C;  2NY9 X;  1SN1 A;  1JZA A;  1NGC A;  1PE4 A;  1ZUT A;  1BA1 A;  2QWM A;  5FPE A;  3KOY A;  4H5V A;  1DQ7 A;  1I6F A;  2LN8 A;  1AHO A;  3BK3 C;  2QW9 A;  2SN3 A;  3ATV A;  4UAE F;  4UJ0 A;  1PTX A;  5KK4 A;  3SF4 D;  1T7E A;  1I2U A;  3IUC A;  5F0X A;  3HSC A;  1QQM A;  1WMT A;  5FPN A;  5AQS A;  5AQV A;  3KVG A;  2D56 A;  3R2V A;  1T0Z A;  1NGF A;  1BCG A;  2KJA A;  1KAX A;  2GMO A;  2LI7 A;  5BN8 A;  1B7D A;  1N4N A;  2ATB A;  1NRA A;  1HPM A;  1HX1 A;  1POI A;  1KAY A;  1VNB A;  2MN5 A;  5BPL A;  3QI7 A;  2K35 A;  1K8B A;  3D2E A;  3FZH A;  1ATS A;  2LJM A;  2LY6 A;  2E3F A;  1ZU3 A;  1NGI A;  4FSV A;  4IO8 A;  2B68 A;  5EX5 A;  2E2F A;  4FL9 A;  5FPM A;  5EVZ A;  2BRZ A;  1T7B A;  1PX9 A;  5BPN A;  3LDL A;  5CY0 A;  2A7T A;  3E7R L;  4KBO A;  1BRZ A;  1OMY A;  1SEG A;  1WWN A;  4KYP A;  1ATR A;  1VNA A;  1AYJ A;  2YIO A;  4GNI A;  5AQQ A;  1DKG D;  3CW4 A;  1JKZ A;  2LT8 A;  5AQJ A;  1TI5 A;  5AQL A;  4HHF A;  3FZF A;  1ZVE A;  2YIL A;  3CQX A;  5AQW A;  3LDQ A;  2BUP A;  2YEO A;  1ZYV A;  5AQO A;  5AQY A;  1LQI A;  1LQH A;  1ZVG A;  5AQG A;  4AAZ A;  1JZB A;  1NPI A;  3I33 A;  3LDO A;  5AQT A;  2N69 A;  1OZZ A;  4V1D C;  5EY4 A;  5AQP A;  3L4I A;  2E8A A;  5F1X A;  2E3G A;  2KHO A;  3GKU A;  3JXU A;  3LDP A;  3LDN A;  1BA0 A;  4H5N A;  1ZFU A;  3KP0 A;  2LJ7 A;  3M3Z A;  5BPM A;  2QXL A;  2ASC A;  5AQF A;  5BN9 A;  3D2F B;  1ZYW A;  1NH5 A;  3E7U X;  3KC6 A;  2G2K A;  1NRB A;  2YC1 C;  3A8Y A;  3KOZ A;  1KAZ A;  1QQO A;  1NE5 A;  2QWP A;  2QWN A;  1XRS B;  2QWL A;  3GDQ A;  4UAD E;  2E88 A;  4AB0 A;  3C7N B;  2VY6 A;  1T7A A;  3KOX A;  2QWO A;  5F2R A;  1BUP A;  1P0A A;  1HJO A;  2LY5 A;  2M8B B;  1LQQ A;  2N66 A;  3L56 A;  4HWI A;  5AQK A;  2E0H A;  1B3C A;  1CN2 A;  1GPT A;  1JXC A;  4CQK A;  2LR3 A;  1NGD A;  1SNB A;  5AQI A;  2KYQ A;  1T1T A;  2KBK A;  1WT7 A;  2KBH A;  1NGE A;  3L6Q A;  4HE7 A;  2GL1 A;  2I61 A;  3KP1 A;  3QML A;  5AQH A;  1BK8 A;  2KBJ A;  5AQM A;  2KSK A;  2JDQ D;  1SN4 A;  3FE1 A;  5FPD A;  3KHW A;  2MZ0 A;  1KV0 A;  3D2E B;  1C56 A;  1NGJ A;  1NGH A;  3ATU A;  1FH3 A;  1CHZ A;  1S3X A;  3D2F A;  1BMR A;  3QFP A;  1C55 A;  1MYN A;  1GPS A;  1DJT A;  1P00 A;  2QWQ A;  5AQX A;  2KGQ A;  2YIP A;  3C7N A;  4H5R A;  2MBK A;  3GL1 A;  5AQZ A;  1L4V A;  4H5T A;  3FZM A;  2N2R A;  1NGB A;  3QFU A;  5AQN A;  2V7Z A;  1UGL A;  2KPY A;  1I6G A;  3PSM A;  3AY9 A;  2N2Q A;  3FZK A;  1MR4 A;  3KOW A;  1I2V A;  3FZL A;  5EXW A;  5AQR A;  1NGA A; 
#chains in the Genus database with same CATH homology
 2NY8 X;  2B3C A;  4AEI A;  1ICA A;  2LKB A;  2YBR C;  2NY9 X;  1SN1 A;  1JZA A;  1PE4 A;  1ZUT A;  1DQ7 A;  1I6F A;  1AHO A;  1I2U A;  2SN3 A;  4UJ0 A;  5KK4 A;  1PTX A;  1T7E A;  1WMT A;  1T0Z A;  1BCG A;  2KJA A;  2LI7 A;  1B7D A;  1N4N A;  2ATB A;  1NRA A;  1VNB A;  2LJM A;  2LY6 A;  2E3F A;  1ZU3 A;  2B68 A;  2BRZ A;  1T7B A;  1PX9 A;  5CY0 A;  2A7T A;  3E7R L;  1BRZ A;  1OMY A;  1SEG A;  1WWN A;  4KYP A;  1VNA A;  1AYJ A;  1JKZ A;  2LT8 A;  1TI5 A;  4HHF A;  1ZVE A;  2YEO A;  1ZYV A;  1LQI A;  1LQH A;  1ZVG A;  4AAZ A;  1JZB A;  1NPI A;  2N69 A;  1OZZ A;  4V1D C;  2E3G A;  1ZFU A;  2LJ7 A;  2ASC A;  1ZYW A;  1NH5 A;  3E7U X;  1NRB A;  2YC1 C;  1NE5 A;  4AB0 A;  1T7A A;  1P0A A;  2N66 A;  2LY5 A;  2M8B B;  1LQQ A;  1B3C A;  1CN2 A;  2E0H A;  1GPT A;  1JXC A;  4CQK A;  2LR3 A;  1SNB A;  2KYQ A;  1T1T A;  2KBK A;  1WT7 A;  2KBH A;  4HE7 A;  2GL1 A;  2I61 A;  1BK8 A;  2KBJ A;  2KSK A;  1SN4 A;  2MZ0 A;  1KV0 A;  1C56 A;  1FH3 A;  1CHZ A;  1BMR A;  1C55 A;  1MYN A;  1GPS A;  1DJT A;  1P00 A;  2KGQ A;  1L4V A;  2N2R A;  1I6G A;  2KPY A;  3PSM A;  2N2Q A;  1MR4 A;  1I2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...