1BRZA

Solution structure of the sweet protein brazzein, nmr, 43 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
EDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRAZZEIN
publication title Solution structure of the thermostable sweet-tasting protein brazzein.
pubmed doi rcsb
molecule tags Sweet protein
total genus 7
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1998-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1brzA00
5CY0A 2N2RA 1NPIA 2B68A 4AEIA 2KYQA 1I6GA 1DJTA 1JZAA 2KSKA 2NY9X 1ZYWA 1BCGA 2BRZA 2KBHA 1CHZA 2ATBA 1NRAA 4UJ0A 1T1TA 1WT7A 1B7DA 2B3CA 4AAZA 3PSMA 2LY6A 1SN1A 3E7RL 1PTXA 2MZ0A 1NH5A 1SEGA 1PX9A 1VNAA 1T7EA 2A7TA 1T7BA 2LI7A 1JZBA 1L4VA 2YEOA 1ZYVA 2LT8A 2LJMA 1WMTA 2LJ7A 1T7AA 1VNBA 4HHFA 4HE7A 1JXCA 1N4NA 1LQIA 1PE4A 2E3GA 1TI5A 1WWNA 3E7UX 1ZFUA 1C55A 2LY5A 2NY8X 1I2UA 2M8BB 1BRZA 2LKBA 4CQKA 1NE5A 1NRBA 2LR3A 2YC1C 1CN2A 1SN4A 1BMRA 1OMYA 1LQHA 2KBJA 2SN3A 1DQ7A 2N69A 4KYPA 1ZVGA 5KK4A 1FH3A 1ZUTA 1P00A 1ZU3A 1SNBA 1AHOA 2KPYA 1I6FA 1BK8A 2N2QA 2KBKA 2I61A 1I2VA 1B3CA 1ZVEA 1LQQA 1OZZA 1KV0A 1MYNA 1GPSA 2E3FA 4AB0A 1AYJA 1P0AA 1T0ZA 1C56A 2N66A 2ASCA 1ICAA 4V1DC 1MR4A 2E0HA 2GL1A 2KGQA 1GPTA 1JKZA 2KJAA 2YBRC
chains in the Genus database with same CATH superfamily
5EX5A 5F2RA 5CY0A 2MN5A 2N2RA 1NPIA 2B68A 2KHOA 5AQYA 1BUPA 2KYQA 4AEIA 1BA1A 1DJTA 1I6GA 1JZAA 2YILA 3QFUA 2MBKA 2KSKA 3HSCA 5AQTA 2NY9X 1ZYWA 4UAFE 5F1XA 1KAZA 3M3ZA 3KOWA 2VY6A 1BCGA 2BRZA 5AQKA 2LN8A 2KBHA 1CHZA 1ATSA 2G2KA 3C7NA 3KC6A 5AQLA 2ATBA 5AQOA 1NGFA 1NGIA 3D2EB 3KOZA 1NRAA 4UJ0A 1T1TA 1POIA 2YIOA 4UADE 2GMOA 3C7NB 1WT7A 2QWPA 1B7DA 3LDOA 5BPLA 2B3CA 3QMLA 4AAZA 3PSMA 4H5RA 2LY6A 1SN1A 3L6QA 3KOYA 5AQPA 3E7RL 3FZMA 3KVGA 2YIPA 2E2FA 3I33A 3KP0A 3LDPA 3FZFA 1PTXA 2MZ0A 1NH5A 1NGEA 1HPMA 1SEGA 1PX9A 3L4IA 4HWIA 5BPMA 1YUWA 3FE1A 1NGJA 1K8BA 1VNAA 5AQIA 3BK3C 5FPMA 1T7EA 2A7TA 1T7BA 2LI7A 3D2FA 1JZBA 1L4VA 2YEOA 1ZYVA 3D2EA 3LDLA 2D56A 4UAEF 2LT8A 2LJMA 1WMTA 3CQXA 1BA0A 3D2FB 5AQMA 2LJ7A 1T7AA 1VNBA 4HHFA 5AQQA 3ATVA 3GKUA 5AQWA 1DKGD 4HE7A 1JXCA 1N4NA 1NGGA 1LQIA 1PE4A 2E3GA 1TI5A 1WWNA 3E7UX 1ZFUA 5AQSA 5AR0A 1C55A 2LY5A 2NY8X 1I2UA 2M8BB 1BRZA 2LKBA 4FL9A 4CQKA 2QWRA 1NE5A 1NRBA 4H5TA 4H5VA 2E88A 5AQHA 2LR3A 2YC1C 3KOXA 4H5WA 2QWNA 1CN2A 5AQGA 5F0XA 4IO8A 1SN4A 1BMRA 5EVZA 5FPDA 3L56A 5AQRA 1QQNA 1HX1A 5AQJA 1KAYA 3CW4A 2K35A 3KP1A 1OMYA 3LDQA 5AQFA 1LQHA 2KBJA 1XRSB 1ATRA 1DQ7A 2SN3A 5AQXA 2JDQD 2N69A 5AQNA 2QWLA 4KYPA 3QI7A 1ZVGA 5KK4A 1FH3A 1ZUTA 1P00A 1ZU3A 1SNBA 4FSVA 1AHOA 2KPYA 3LDNA 1NGHA 1I6FA 3AY9A 5AQVA 1BK8A 2N2QA 5BN8A 4KBOA 3QFPA 2KBKA 2I61A 3IUCA 1I2VA 1UGLA 3JXUA 3FZLA 1B3CA 1ZVEA 5FPNA 2QWMA 3GDQA 1NGAA 1LQQA 1OZZA 3R2VA 1KV0A 3A8YA 3FZHA 1MYNA 2E8AA 1QQMA 1GPSA 2E3FA 2QXLA 2QWOA 1NGDA 5FPEA 1QQOA 1S3XA 3KHWA 5EY4A 1P0AA 1T0ZA 4H5NA 4AB0A 1C56A 2N66A 2QWQA 5BN9A 1AYJA 2BUPA 2ASCA 1KAXA 3GL1A 1ICAA 5BPNA 1HJOA 4V1DC 1MR4A 2E0HA 2GL1A 2QW9A 2KGQA 4GNIA 5EXWA 5AQZA 3SF4D 5AQUA 1GPTA 3ATUA 1JKZA 2KJAA 2YBRC 2V7ZA 1NGBA 1NGCA 3FZKA
chains in the Genus database with same CATH topology
5CY0A 2N2RA 1NPIA 2B68A 4AEIA 2KYQA 1I6GA 1DJTA 1JZAA 2KSKA 2NY9X 1ZYWA 1BCGA 2BRZA 2KBHA 1CHZA 2ATBA 1NRAA 4UJ0A 1T1TA 1WT7A 1B7DA 2B3CA 4AAZA 3PSMA 2LY6A 1SN1A 3E7RL 1PTXA 2MZ0A 1NH5A 1SEGA 1PX9A 1VNAA 1T7EA 2A7TA 1T7BA 2LI7A 1JZBA 1L4VA 2YEOA 1ZYVA 2LT8A 2LJMA 1WMTA 2LJ7A 1T7AA 1VNBA 4HHFA 4HE7A 1JXCA 1N4NA 1LQIA 1PE4A 2E3GA 1TI5A 1WWNA 3E7UX 1ZFUA 1C55A 2LY5A 2NY8X 1I2UA 2M8BB 1BRZA 2LKBA 4CQKA 1NE5A 1NRBA 2LR3A 2YC1C 1CN2A 1SN4A 1BMRA 1OMYA 1LQHA 2KBJA 2SN3A 1DQ7A 2N69A 4KYPA 1ZVGA 5KK4A 1FH3A 1ZUTA 1P00A 1ZU3A 1SNBA 1AHOA 2KPYA 1I6FA 1BK8A 2N2QA 2KBKA 2I61A 1I2VA 1B3CA 1ZVEA 1LQQA 1OZZA 1KV0A 1MYNA 1GPSA 2E3FA 4AB0A 1AYJA 1P0AA 1T0ZA 1C56A 2N66A 2ASCA 1ICAA 4V1DC 1MR4A 2E0HA 2GL1A 2KGQA 1GPTA 1JKZA 2KJAA 2YBRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CY0 A;  2N2R A;  1NPI A;  2B68 A;  4AEI A;  2KYQ A;  1I6G A;  1DJT A;  1JZA A;  2KSK A;  2NY9 X;  1ZYW A;  1BCG A;  2BRZ A;  2KBH A;  1CHZ A;  2ATB A;  1NRA A;  4UJ0 A;  1T1T A;  1WT7 A;  1B7D A;  2B3C A;  4AAZ A;  3PSM A;  2LY6 A;  1SN1 A;  3E7R L;  1PTX A;  2MZ0 A;  1NH5 A;  1SEG A;  1PX9 A;  1VNA A;  1T7E A;  2A7T A;  1T7B A;  2LI7 A;  1JZB A;  1L4V A;  2YEO A;  1ZYV A;  2LT8 A;  2LJM A;  1WMT A;  2LJ7 A;  1T7A A;  1VNB A;  4HHF A;  4HE7 A;  1JXC A;  1N4N A;  1LQI A;  1PE4 A;  2E3G A;  1TI5 A;  1WWN A;  3E7U X;  1ZFU A;  1C55 A;  2LY5 A;  2NY8 X;  1I2U A;  2M8B B;  1BRZ A;  2LKB A;  4CQK A;  1NE5 A;  1NRB A;  2LR3 A;  2YC1 C;  1CN2 A;  1SN4 A;  1BMR A;  1OMY A;  1LQH A;  2KBJ A;  2SN3 A;  1DQ7 A;  2N69 A;  4KYP A;  1ZVG A;  5KK4 A;  1FH3 A;  1ZUT A;  1P00 A;  1ZU3 A;  1SNB A;  1AHO A;  2KPY A;  1I6F A;  1BK8 A;  2N2Q A;  2KBK A;  2I61 A;  1I2V A;  1B3C A;  1ZVE A;  1LQQ A;  1OZZ A;  1KV0 A;  1MYN A;  1GPS A;  2E3F A;  4AB0 A;  1AYJ A;  1P0A A;  1T0Z A;  1C56 A;  2N66 A;  2ASC A;  1ICA A;  4V1D C;  1MR4 A;  2E0H A;  2GL1 A;  2KGQ A;  1GPT A;  1JKZ A;  2KJA A;  2YBR C; 
#chains in the Genus database with same CATH topology
 5EX5 A;  5F2R A;  5CY0 A;  2MN5 A;  2N2R A;  1NPI A;  2B68 A;  2KHO A;  5AQY A;  1BUP A;  2KYQ A;  4AEI A;  1BA1 A;  1DJT A;  1I6G A;  1JZA A;  2YIL A;  3QFU A;  2MBK A;  2KSK A;  3HSC A;  5AQT A;  2NY9 X;  1ZYW A;  4UAF E;  5F1X A;  1KAZ A;  3M3Z A;  3KOW A;  2VY6 A;  1BCG A;  2BRZ A;  5AQK A;  2LN8 A;  2KBH A;  1CHZ A;  1ATS A;  2G2K A;  3C7N A;  3KC6 A;  5AQL A;  2ATB A;  5AQO A;  1NGF A;  1NGI A;  3D2E B;  3KOZ A;  1NRA A;  4UJ0 A;  1T1T A;  1POI A;  2YIO A;  4UAD E;  2GMO A;  3C7N B;  1WT7 A;  2QWP A;  1B7D A;  3LDO A;  5BPL A;  2B3C A;  3QML A;  4AAZ A;  3PSM A;  4H5R A;  2LY6 A;  1SN1 A;  3L6Q A;  3KOY A;  5AQP A;  3E7R L;  3FZM A;  3KVG A;  2YIP A;  2E2F A;  3I33 A;  3KP0 A;  3LDP A;  3FZF A;  1PTX A;  2MZ0 A;  1NH5 A;  1NGE A;  1HPM A;  1SEG A;  1PX9 A;  3L4I A;  4HWI A;  5BPM A;  1YUW A;  3FE1 A;  1NGJ A;  1K8B A;  1VNA A;  5AQI A;  3BK3 C;  5FPM A;  1T7E A;  2A7T A;  1T7B A;  2LI7 A;  3D2F A;  1JZB A;  1L4V A;  2YEO A;  1ZYV A;  3D2E A;  3LDL A;  2D56 A;  4UAE F;  2LT8 A;  2LJM A;  1WMT A;  3CQX A;  1BA0 A;  3D2F B;  5AQM A;  2LJ7 A;  1T7A A;  1VNB A;  4HHF A;  5AQQ A;  3ATV A;  3GKU A;  5AQW A;  1DKG D;  4HE7 A;  1JXC A;  1N4N A;  1NGG A;  1LQI A;  1PE4 A;  2E3G A;  1TI5 A;  1WWN A;  3E7U X;  1ZFU A;  5AQS A;  5AR0 A;  1C55 A;  2LY5 A;  2NY8 X;  1I2U A;  2M8B B;  1BRZ A;  2LKB A;  4FL9 A;  4CQK A;  2QWR A;  1NE5 A;  1NRB A;  4H5T A;  4H5V A;  2E88 A;  5AQH A;  2LR3 A;  2YC1 C;  3KOX A;  4H5W A;  2QWN A;  1CN2 A;  5AQG A;  5F0X A;  4IO8 A;  1SN4 A;  1BMR A;  5EVZ A;  5FPD A;  3L56 A;  5AQR A;  1QQN A;  1HX1 A;  5AQJ A;  1KAY A;  3CW4 A;  2K35 A;  3KP1 A;  1OMY A;  3LDQ A;  5AQF A;  1LQH A;  2KBJ A;  1XRS B;  1ATR A;  1DQ7 A;  2SN3 A;  5AQX A;  2JDQ D;  2N69 A;  5AQN A;  2QWL A;  4KYP A;  3QI7 A;  1ZVG A;  5KK4 A;  1FH3 A;  1ZUT A;  1P00 A;  1ZU3 A;  1SNB A;  4FSV A;  1AHO A;  2KPY A;  3LDN A;  1NGH A;  1I6F A;  3AY9 A;  5AQV A;  1BK8 A;  2N2Q A;  5BN8 A;  4KBO A;  3QFP A;  2KBK A;  2I61 A;  3IUC A;  1I2V A;  1UGL A;  3JXU A;  3FZL A;  1B3C A;  1ZVE A;  5FPN A;  2QWM A;  3GDQ A;  1NGA A;  1LQQ A;  1OZZ A;  3R2V A;  1KV0 A;  3A8Y A;  3FZH A;  1MYN A;  2E8A A;  1QQM A;  1GPS A;  2E3F A;  2QXL A;  2QWO A;  1NGD A;  5FPE A;  1QQO A;  1S3X A;  3KHW A;  5EY4 A;  1P0A A;  1T0Z A;  4H5N A;  4AB0 A;  1C56 A;  2N66 A;  2QWQ A;  5BN9 A;  1AYJ A;  2BUP A;  2ASC A;  1KAX A;  3GL1 A;  1ICA A;  5BPN A;  1HJO A;  4V1D C;  1MR4 A;  2E0H A;  2GL1 A;  2QW9 A;  2KGQ A;  4GNI A;  5EXW A;  5AQZ A;  3SF4 D;  5AQU A;  1GPT A;  3ATU A;  1JKZ A;  2KJA A;  2YBR C;  2V7Z A;  1NGB A;  1NGC A;  3FZK A; 
#chains in the Genus database with same CATH homology
 5CY0 A;  2N2R A;  1NPI A;  2B68 A;  4AEI A;  2KYQ A;  1I6G A;  1DJT A;  1JZA A;  2KSK A;  2NY9 X;  1ZYW A;  1BCG A;  2BRZ A;  2KBH A;  1CHZ A;  2ATB A;  1NRA A;  4UJ0 A;  1T1T A;  1WT7 A;  1B7D A;  2B3C A;  4AAZ A;  3PSM A;  2LY6 A;  1SN1 A;  3E7R L;  1PTX A;  2MZ0 A;  1NH5 A;  1SEG A;  1PX9 A;  1VNA A;  1T7E A;  2A7T A;  1T7B A;  2LI7 A;  1JZB A;  1L4V A;  2YEO A;  1ZYV A;  2LT8 A;  2LJM A;  1WMT A;  2LJ7 A;  1T7A A;  1VNB A;  4HHF A;  4HE7 A;  1JXC A;  1N4N A;  1LQI A;  1PE4 A;  2E3G A;  1TI5 A;  1WWN A;  3E7U X;  1ZFU A;  1C55 A;  2LY5 A;  2NY8 X;  1I2U A;  2M8B B;  1BRZ A;  2LKB A;  4CQK A;  1NE5 A;  1NRB A;  2LR3 A;  2YC1 C;  1CN2 A;  1SN4 A;  1BMR A;  1OMY A;  1LQH A;  2KBJ A;  2SN3 A;  1DQ7 A;  2N69 A;  4KYP A;  1ZVG A;  5KK4 A;  1FH3 A;  1ZUT A;  1P00 A;  1ZU3 A;  1SNB A;  1AHO A;  2KPY A;  1I6F A;  1BK8 A;  2N2Q A;  2KBK A;  2I61 A;  1I2V A;  1B3C A;  1ZVE A;  1LQQ A;  1OZZ A;  1KV0 A;  1MYN A;  1GPS A;  2E3F A;  4AB0 A;  1AYJ A;  1P0A A;  1T0Z A;  1C56 A;  2N66 A;  2ASC A;  1ICA A;  4V1D C;  1MR4 A;  2E0H A;  2GL1 A;  2KGQ A;  1GPT A;  1JKZ A;  2KJA A;  2YBR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...