1BRZA

Solution structure of the sweet protein brazzein, nmr, 43 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
EDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sweet protein
molecule keywords BRAZZEIN
publication title Solution structure of the thermostable sweet-tasting protein brazzein.
pubmed doi rcsb
total genus 7
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1998-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1brzA00
2N2RA 1AYJA 2E0HA 2N66A 2N69A 1B3CA 4UJ0A 1P0AA 4HE7A 1TI5A 1JKZA 2LI7A 1WWNA 1SEGA 1KV0A 1ZVGA 1DQ7A 1T7EA 2LY5A 1T1TA 4AAZA 1T7BA 2A7TA 2B3CA 1L4VA 4HHFA 1LQHA 2SN3A 2E3FA 4CQKA 2E3GA 4AB0A 1AHOA 5CY0A 1ZYVA 1ZVEA 2LKBA 1C56A 1NH5A 1BCGA 1MYNA 1LQQA 1N4NA 2LY6A 1JZAA 1OZZA 1WT7A 1SN4A 2YEOA 3E7UX 2LJ7A 2M8BB 2KPYA 2I61A 2MZ0A 2BRZA 1BMRA 1ICAA 1NE5A 1NRAA 1JXCA 2KBHA 2GL1A 1ZU3A 1I2VA 1I2UA 1ZUTA 4AEIA 2KGQA 1P00A 2KSKA 2ASCA 1GPTA 2KYQA 1PX9A 4V1DC 1CN2A 1NPIA 2NY9X 1OMYA 1BRZA 3PSMA 1PE4A 1WMTA 1SNBA 1VNAA 2B68A 1T0ZA 2LJMA 1GPSA 2YBRC 1I6GA 1ZFUA 1PTXA 2YC1C 2N2QA 2ATBA 4KYPA 1T7AA 2NY8X 2KJAA 1JZBA 1ZYWA 1B7DA 1NRBA 2LR3A 3E7RL 5KK4A 2KBJA 1C55A 1CHZA 1FH3A 1LQIA 1MR4A 1I6FA 2LT8A 1BK8A 1VNBA 2KBKA 1SN1A 1DJTA
chains in the Genus database with same CATH superfamily
1HJOA 1NGGA 2N2RA 3QFPA 3KC6A 5EY4A 5FPEA 2E0HA 1NGIA 2YIPA 2N66A 2N69A 2YILA 3A8YA 3FZLA 4H5VA 1P0AA 4UJ0A 1B3CA 5AQPA 2VY6A 1QQMA 4HE7A 1TI5A 3KOZA 2QW9A 1QQOA 1JKZA 2LI7A 1WWNA 1SEGA 1KV0A 1ZVGA 3GKUA 1NGHA 5AQRA 5AQMA 5BN9A 1DQ7A 5EX5A 1HX1A 3LDOA 1T7EA 3QMLA 2E88A 2LY5A 1T1TA 4IO8A 4AAZA 5AQQA 1T7BA 2A7TA 2B3CA 3CQXA 5F2RA 1L4VA 5AQXA 4HHFA 1LQHA 4FSVA 2SN3A 2E3FA 5BN8A 4CQKA 5AQOA 2E3GA 4AB0A 1AHOA 5CY0A 5F0XA 1ZYVA 5AQJA 3L6QA 4H5WA 1ATRA 1ZVEA 2LKBA 2MBKA 5AQZA 1C56A 1NH5A 3D2EB 1BCGA 5AQGA 5FPMA 1MYNA 1LQQA 1N4NA 2LY6A 5EXWA 2YIOA 1JZAA 1OZZA 4KBOA 1WT7A 2QWPA 5BPNA 3D2FA 1SN4A 2YEOA 3E7UX 3HSCA 1NGFA 2LJ7A 3JXUA 2KHOA 3LDQA 4H5RA 5AQKA 2M8BB 2KPYA 5FPNA 2I61A 2MZ0A 1AYJA 3M3ZA 3KHWA 2BRZA 3FZMA 1BMRA 1ICAA 1NGBA 1NE5A 1NRAA 2QWRA 3SF4D 1JXCA 1BA1A 2GL1A 2KBHA 2LN8A 1DKGD 5AQUA 1ZU3A 3KP0A 2JDQD 5AQWA 2D56A 1I2VA 1HPMA 3FZKA 1I2UA 1ZUTA 2QXLA 2V7ZA 5AQNA 5AQTA 4AEIA 3L4IA 5AQHA 5FPDA 3KVGA 2KGQA 1QQNA 1XRSB 3BK3C 1P00A 4FL9A 5F1XA 2KSKA 1S3XA 2MN5A 3L56A 2ASCA 5BPMA 1KAXA 3KOYA 2KYQA 5AQIA 1GPTA 1PX9A 5AQLA 4V1DC 3KOWA 1CN2A 1NGDA 4GNIA 1NPIA 1NGCA 2NY9X 1OMYA 1BRZA 3ATUA 2E2FA 3GL1A 3I33A 3PSMA 1PE4A 2GMOA 1WMTA 1SNBA 1KAZA 1VNAA 2B68A 1T0ZA 3D2EA 1YUWA 2LJMA 2YBRC 4HWIA 1ZFUA 5AR0A 3R2VA 1PTXA 1GPSA 2YC1C 3ATVA 3QFUA 2N2QA 2E8AA 3GDQA 3C7NB 2ATBA 1UGLA 4KYPA 3QI7A 4H5TA 4UAEF 2K35A 1I6GA 5EVZA 1T7AA 2QWLA 2QWNA 3FZFA 5AQYA 2NY8X 2KJAA 3LDNA 1BUPA 1JZBA 1ZYWA 1B7DA 1KAYA 1NGAA 1NRBA 3CW4A 3LDLA 2LR3A 3E7RL 4UAFE 5BPLA 5KK4A 1NGEA 3C7NA 4H5NA 1ATSA 2KBJA 1C55A 3FE1A 1CHZA 3FZHA 1FH3A 3IUCA 1LQIA 1MR4A 1I6FA 1BA0A 2LT8A 2QWQA 3AY9A 3KP1A 4UADE 3LDPA 1NGJA 5AQVA 3KOXA 1VNBA 2G2KA 2KBKA 2QWMA 3D2FB 1BK8A 2BUPA 2QWOA 1K8BA 5AQFA 5AQSA 1SN1A 1DJTA 1POIA
chains in the Genus database with same CATH topology
2N2RA 1AYJA 2E0HA 2N66A 2N69A 1B3CA 4UJ0A 1P0AA 4HE7A 1TI5A 1JKZA 2LI7A 1WWNA 1SEGA 1KV0A 1ZVGA 1DQ7A 1T7EA 2LY5A 1T1TA 4AAZA 1T7BA 2A7TA 2B3CA 1L4VA 4HHFA 1LQHA 2SN3A 2E3FA 4CQKA 2E3GA 4AB0A 1AHOA 5CY0A 1ZYVA 1ZVEA 2LKBA 1C56A 1NH5A 1BCGA 1MYNA 1LQQA 1N4NA 2LY6A 1JZAA 1OZZA 1WT7A 1SN4A 2YEOA 3E7UX 2LJ7A 2M8BB 2KPYA 2I61A 2MZ0A 2BRZA 1BMRA 1ICAA 1NE5A 1NRAA 1JXCA 2KBHA 2GL1A 1ZU3A 1I2VA 1I2UA 1ZUTA 4AEIA 2KGQA 1P00A 2KSKA 2ASCA 1GPTA 2KYQA 1PX9A 4V1DC 1CN2A 1NPIA 2NY9X 1OMYA 1BRZA 3PSMA 1PE4A 1WMTA 1SNBA 1VNAA 2B68A 1T0ZA 2LJMA 1GPSA 2YBRC 1I6GA 1ZFUA 1PTXA 2YC1C 2N2QA 2ATBA 4KYPA 1T7AA 2NY8X 2KJAA 1JZBA 1ZYWA 1B7DA 1NRBA 2LR3A 3E7RL 5KK4A 2KBJA 1C55A 1CHZA 1FH3A 1LQIA 1MR4A 1I6FA 2LT8A 1BK8A 1VNBA 2KBKA 1SN1A 1DJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2R A;  1AYJ A;  2E0H A;  2N66 A;  2N69 A;  1B3C A;  4UJ0 A;  1P0A A;  4HE7 A;  1TI5 A;  1JKZ A;  2LI7 A;  1WWN A;  1SEG A;  1KV0 A;  1ZVG A;  1DQ7 A;  1T7E A;  2LY5 A;  1T1T A;  4AAZ A;  1T7B A;  2A7T A;  2B3C A;  1L4V A;  4HHF A;  1LQH A;  2SN3 A;  2E3F A;  4CQK A;  2E3G A;  4AB0 A;  1AHO A;  5CY0 A;  1ZYV A;  1ZVE A;  2LKB A;  1C56 A;  1NH5 A;  1BCG A;  1MYN A;  1LQQ A;  1N4N A;  2LY6 A;  1JZA A;  1OZZ A;  1WT7 A;  1SN4 A;  2YEO A;  3E7U X;  2LJ7 A;  2M8B B;  2KPY A;  2I61 A;  2MZ0 A;  2BRZ A;  1BMR A;  1ICA A;  1NE5 A;  1NRA A;  1JXC A;  2KBH A;  2GL1 A;  1ZU3 A;  1I2V A;  1I2U A;  1ZUT A;  4AEI A;  2KGQ A;  1P00 A;  2KSK A;  2ASC A;  1GPT A;  2KYQ A;  1PX9 A;  4V1D C;  1CN2 A;  1NPI A;  2NY9 X;  1OMY A;  1BRZ A;  3PSM A;  1PE4 A;  1WMT A;  1SNB A;  1VNA A;  2B68 A;  1T0Z A;  2LJM A;  1GPS A;  2YBR C;  1I6G A;  1ZFU A;  1PTX A;  2YC1 C;  2N2Q A;  2ATB A;  4KYP A;  1T7A A;  2NY8 X;  2KJA A;  1JZB A;  1ZYW A;  1B7D A;  1NRB A;  2LR3 A;  3E7R L;  5KK4 A;  2KBJ A;  1C55 A;  1CHZ A;  1FH3 A;  1LQI A;  1MR4 A;  1I6F A;  2LT8 A;  1BK8 A;  1VNB A;  2KBK A;  1SN1 A;  1DJT A; 
#chains in the Genus database with same CATH topology
 1HJO A;  1NGG A;  2N2R A;  3QFP A;  3KC6 A;  5EY4 A;  5FPE A;  2E0H A;  1NGI A;  2YIP A;  2N66 A;  2N69 A;  2YIL A;  3A8Y A;  3FZL A;  4H5V A;  1P0A A;  4UJ0 A;  1B3C A;  5AQP A;  2VY6 A;  1QQM A;  4HE7 A;  1TI5 A;  3KOZ A;  2QW9 A;  1QQO A;  1JKZ A;  2LI7 A;  1WWN A;  1SEG A;  1KV0 A;  1ZVG A;  3GKU A;  1NGH A;  5AQR A;  5AQM A;  5BN9 A;  1DQ7 A;  5EX5 A;  1HX1 A;  3LDO A;  1T7E A;  3QML A;  2E88 A;  2LY5 A;  1T1T A;  4IO8 A;  4AAZ A;  5AQQ A;  1T7B A;  2A7T A;  2B3C A;  3CQX A;  5F2R A;  1L4V A;  5AQX A;  4HHF A;  1LQH A;  4FSV A;  2SN3 A;  2E3F A;  5BN8 A;  4CQK A;  5AQO A;  2E3G A;  4AB0 A;  1AHO A;  5CY0 A;  5F0X A;  1ZYV A;  5AQJ A;  3L6Q A;  4H5W A;  1ATR A;  1ZVE A;  2LKB A;  2MBK A;  5AQZ A;  1C56 A;  1NH5 A;  3D2E B;  1BCG A;  5AQG A;  5FPM A;  1MYN A;  1LQQ A;  1N4N A;  2LY6 A;  5EXW A;  2YIO A;  1JZA A;  1OZZ A;  4KBO A;  1WT7 A;  2QWP A;  5BPN A;  3D2F A;  1SN4 A;  2YEO A;  3E7U X;  3HSC A;  1NGF A;  2LJ7 A;  3JXU A;  2KHO A;  3LDQ A;  4H5R A;  5AQK A;  2M8B B;  2KPY A;  5FPN A;  2I61 A;  2MZ0 A;  1AYJ A;  3M3Z A;  3KHW A;  2BRZ A;  3FZM A;  1BMR A;  1ICA A;  1NGB A;  1NE5 A;  1NRA A;  2QWR A;  3SF4 D;  1JXC A;  1BA1 A;  2GL1 A;  2KBH A;  2LN8 A;  1DKG D;  5AQU A;  1ZU3 A;  3KP0 A;  2JDQ D;  5AQW A;  2D56 A;  1I2V A;  1HPM A;  3FZK A;  1I2U A;  1ZUT A;  2QXL A;  2V7Z A;  5AQN A;  5AQT A;  4AEI A;  3L4I A;  5AQH A;  5FPD A;  3KVG A;  2KGQ A;  1QQN A;  1XRS B;  3BK3 C;  1P00 A;  4FL9 A;  5F1X A;  2KSK A;  1S3X A;  2MN5 A;  3L56 A;  2ASC A;  5BPM A;  1KAX A;  3KOY A;  2KYQ A;  5AQI A;  1GPT A;  1PX9 A;  5AQL A;  4V1D C;  3KOW A;  1CN2 A;  1NGD A;  4GNI A;  1NPI A;  1NGC A;  2NY9 X;  1OMY A;  1BRZ A;  3ATU A;  2E2F A;  3GL1 A;  3I33 A;  3PSM A;  1PE4 A;  2GMO A;  1WMT A;  1SNB A;  1KAZ A;  1VNA A;  2B68 A;  1T0Z A;  3D2E A;  1YUW A;  2LJM A;  2YBR C;  4HWI A;  1ZFU A;  5AR0 A;  3R2V A;  1PTX A;  1GPS A;  2YC1 C;  3ATV A;  3QFU A;  2N2Q A;  2E8A A;  3GDQ A;  3C7N B;  2ATB A;  1UGL A;  4KYP A;  3QI7 A;  4H5T A;  4UAE F;  2K35 A;  1I6G A;  5EVZ A;  1T7A A;  2QWL A;  2QWN A;  3FZF A;  5AQY A;  2NY8 X;  2KJA A;  3LDN A;  1BUP A;  1JZB A;  1ZYW A;  1B7D A;  1KAY A;  1NGA A;  1NRB A;  3CW4 A;  3LDL A;  2LR3 A;  3E7R L;  4UAF E;  5BPL A;  5KK4 A;  1NGE A;  3C7N A;  4H5N A;  1ATS A;  2KBJ A;  1C55 A;  3FE1 A;  1CHZ A;  3FZH A;  1FH3 A;  3IUC A;  1LQI A;  1MR4 A;  1I6F A;  1BA0 A;  2LT8 A;  2QWQ A;  3AY9 A;  3KP1 A;  4UAD E;  3LDP A;  1NGJ A;  5AQV A;  3KOX A;  1VNB A;  2G2K A;  2KBK A;  2QWM A;  3D2F B;  1BK8 A;  2BUP A;  2QWO A;  1K8B A;  5AQF A;  5AQS A;  1SN1 A;  1DJT A;  1POI A; 
#chains in the Genus database with same CATH homology
 2N2R A;  1AYJ A;  2E0H A;  2N66 A;  2N69 A;  1B3C A;  4UJ0 A;  1P0A A;  4HE7 A;  1TI5 A;  1JKZ A;  2LI7 A;  1WWN A;  1SEG A;  1KV0 A;  1ZVG A;  1DQ7 A;  1T7E A;  2LY5 A;  1T1T A;  4AAZ A;  1T7B A;  2A7T A;  2B3C A;  1L4V A;  4HHF A;  1LQH A;  2SN3 A;  2E3F A;  4CQK A;  2E3G A;  4AB0 A;  1AHO A;  5CY0 A;  1ZYV A;  1ZVE A;  2LKB A;  1C56 A;  1NH5 A;  1BCG A;  1MYN A;  1LQQ A;  1N4N A;  2LY6 A;  1JZA A;  1OZZ A;  1WT7 A;  1SN4 A;  2YEO A;  3E7U X;  2LJ7 A;  2M8B B;  2KPY A;  2I61 A;  2MZ0 A;  2BRZ A;  1BMR A;  1ICA A;  1NE5 A;  1NRA A;  1JXC A;  2KBH A;  2GL1 A;  1ZU3 A;  1I2V A;  1I2U A;  1ZUT A;  4AEI A;  2KGQ A;  1P00 A;  2KSK A;  2ASC A;  1GPT A;  2KYQ A;  1PX9 A;  4V1D C;  1CN2 A;  1NPI A;  2NY9 X;  1OMY A;  1BRZ A;  3PSM A;  1PE4 A;  1WMT A;  1SNB A;  1VNA A;  2B68 A;  1T0Z A;  2LJM A;  1GPS A;  2YBR C;  1I6G A;  1ZFU A;  1PTX A;  2YC1 C;  2N2Q A;  2ATB A;  4KYP A;  1T7A A;  2NY8 X;  2KJA A;  1JZB A;  1ZYW A;  1B7D A;  1NRB A;  2LR3 A;  3E7R L;  5KK4 A;  2KBJ A;  1C55 A;  1CHZ A;  1FH3 A;  1LQI A;  1MR4 A;  1I6F A;  2LT8 A;  1BK8 A;  1VNB A;  2KBK A;  1SN1 A;  1DJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...