1VNAA

Proton nuclear magnetic resonance and distance geometry(slash)simulated annealing studies on the variant-1 neurotoxin from the new world scorpion centruroides sculpturatus ewing
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
KEGYLVKKSDGCKYDCFWLGKNEHCNTECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN
publication title Proton nuclear magnetic resonance and distance geometry/simulated annealing studies on the variant-1 neurotoxin from the New World scorpion Centruroides sculpturatus Ewing.
pubmed doi rcsb
source organism Centruroides sculpturatus
molecule tags Neurotoxin
total genus 5
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1vnaA00
4V1DC 1NPIA 2LY5A 2N2QA 1T7BA 2LJMA 1NH5A 2YC1C 1WWNA 2NY8X 2NY9X 2KJAA 1ZUTA 1ICAA 1MR4A 4CQKA 2LI7A 1ZU3A 4HHFA 3E7UX 1WT7A 1T0ZA 1T7AA 1LQQA 2KGQA 1DQ7A 1I2UA 1ZYVA 2LT8A 1C55A 1CN2A 1BRZA 1N4NA 1GPSA 1P0AA 2LJ7A 4KYPA 1BK8A 4UJ0A 1FH3A 1JZBA 2KBHA 2B3CA 1OZZA 1PE4A 2YBRC 1NE5A 1NRBA 1T1TA 1BMRA 1SN1A 2KSKA 1L4VA 2ATBA 2KPYA 1ZFUA 2M8BB 3E7RL 2E0HA 2LR3A 2MZ0A 2KBKA 1WMTA 1P00A 2E3GA 1T7EA 2BRZA 4AB0A 2A7TA 2I61A 2GL1A 1AHOA 1GPTA 2LKBA 1ZVEA 3PSMA 1I2VA 1SN4A 1MYNA 1JXCA 4HE7A 1OMYA 1SEGA 1I6GA 2N2RA 1JZAA 1ZVGA 2N66A 2LY6A 1ZYWA 1BCGA 2E3FA 2KBJA 1C56A 1PTXA 4AEIA 1DJTA 2N69A 1AYJA 2B68A 1VNBA 1JKZA 1LQHA 1TI5A 1NRAA 2YEOA 2KYQA 2ASCA 1SNBA 1B7DA 2SN3A 5KK4A 1PX9A 1I6FA 1CHZA 1LQIA 1B3CA 1KV0A 1VNAA 5CY0A 4AAZA
chains in the Genus database with same CATH superfamily
3BK3C 4V1DC 5AQUA 1QQMA 1NPIA 2VY6A 2LY5A 1BA0A 2V7ZA 2QWNA 3GDQA 3D2EB 2N2QA 1T7BA 2LJMA 1NH5A 2YC1C 1WWNA 2NY8X 2NY9X 2KJAA 1ZUTA 5F1XA 3ATVA 1MR4A 4CQKA 1ICAA 2LI7A 3GL1A 3I33A 3KVGA 5AQTA 5AR0A 1ZU3A 2E8AA 1KAYA 3QFUA 4H5RA 5FPEA 3L6QA 3KP0A 4HHFA 5F0XA 3QMLA 3E7UX 1YUWA 1WT7A 3FZLA 1NGGA 1HX1A 1NGEA 2D56A 1T0ZA 1T7AA 1LQQA 1NGIA 1NGAA 2QWQA 3HSCA 5AQHA 2KGQA 1DQ7A 4IO8A 3LDPA 5FPNA 4UAEF 1I2UA 1ZYVA 2LT8A 3FZHA 3SF4D 1C55A 1BA1A 4H5NA 2QWRA 5AQQA 1CN2A 1NGCA 2YILA 1BRZA 2K35A 1N4NA 2YIOA 1P0AA 2LJ7A 4H5WA 4KYPA 5AQKA 5F2RA 4UJ0A 1BK8A 1FH3A 1JZBA 2KBHA 3D2FA 2QWLA 2B3CA 5AQPA 2QXLA 1OZZA 3FZMA 5AQRA 1PE4A 2YBRC 3QI7A 3CQXA 4KBOA 1NE5A 1DKGD 1NRBA 1T1TA 1BMRA 5AQYA 3IUCA 1SN1A 2KSKA 1UGLA 3LDQA 1L4VA 2ATBA 2KPYA 1ZFUA 4FL9A 2M8BB 1NGBA 3E7RL 2G2KA 3C7NA 2E0HA 2LR3A 2MZ0A 2KBKA 3LDOA 5AQFA 4GNIA 1WMTA 1P00A 2QW9A 1BUPA 4UAFE 3M3ZA 1K8BA 3LDLA 2E3GA 1T7EA 2BRZA 4FSVA 4AB0A 3A8YA 1HJOA 2A7TA 5AQMA 5EY4A 1GPSA 2I61A 2GL1A 1AHOA 1KAXA 1QQNA 1GPTA 3FZKA 2MBKA 2LKBA 3AY9A 4H5TA 1KAZA 5BPLA 3KOZA 5FPDA 4UADE 1ZVEA 5AQWA 3PSMA 2E2FA 3CW4A 1I2VA 1SN4A 2E88A 5AQVA 3KC6A 1MYNA 5EXWA 1JXCA 1NGFA 1S3XA 4HE7A 1OMYA 1SEGA 3D2EA 4HWIA 1I6GA 3GKUA 2N2RA 1JZAA 5BN9A 3LDNA 5AQLA 1NGHA 3D2FB 3ATUA 5AQNA 3L4IA 1ZVGA 5EVZA 2N66A 1HPMA 2QWPA 2LY6A 1ZYWA 5AQZA 5BPNA 5AQGA 5BN8A 1BCGA 3KHWA 2E3FA 1POIA 2KBJA 1ATRA 1C56A 2QWMA 1PTXA 5EX5A 3FE1A 1NGJA 1DJTA 4AEIA 1NGDA 2YIPA 5AQJA 2N69A 1AYJA 2B68A 1VNBA 3L56A 1JKZA 1ATSA 1LQHA 1TI5A 1NRAA 3C7NB 2YEOA 5BPMA 5FPMA 2KYQA 2GMOA 3QFPA 2ASCA 5AQXA 1QQOA 1SNBA 5AQOA 3FZFA 3KOXA 1B7DA 3KP1A 2SN3A 2MN5A 2QWOA 4H5VA 1PX9A 1I6FA 5KK4A 3JXUA 1CHZA 2JDQD 3KOYA 1LQIA 3R2VA 2LN8A 1KV0A 2KHOA 3KOWA 1XRSB 2BUPA 5AQIA 1B3CA 1VNAA 5CY0A 5AQSA 4AAZA
chains in the Genus database with same CATH topology
4V1DC 1NPIA 2LY5A 2N2QA 1T7BA 2LJMA 1NH5A 2YC1C 1WWNA 2NY8X 2NY9X 2KJAA 1ZUTA 1ICAA 1MR4A 4CQKA 2LI7A 1ZU3A 4HHFA 3E7UX 1WT7A 1T0ZA 1T7AA 1LQQA 2KGQA 1DQ7A 1I2UA 1ZYVA 2LT8A 1C55A 1CN2A 1BRZA 1N4NA 1GPSA 1P0AA 2LJ7A 4KYPA 1BK8A 4UJ0A 1FH3A 1JZBA 2KBHA 2B3CA 1OZZA 1PE4A 2YBRC 1NE5A 1NRBA 1T1TA 1BMRA 1SN1A 2KSKA 1L4VA 2ATBA 2KPYA 1ZFUA 2M8BB 3E7RL 2E0HA 2LR3A 2MZ0A 2KBKA 1WMTA 1P00A 2E3GA 1T7EA 2BRZA 4AB0A 2A7TA 2I61A 2GL1A 1AHOA 1GPTA 2LKBA 1ZVEA 3PSMA 1I2VA 1SN4A 1MYNA 1JXCA 4HE7A 1OMYA 1SEGA 1I6GA 2N2RA 1JZAA 1ZVGA 2N66A 2LY6A 1ZYWA 1BCGA 2E3FA 2KBJA 1C56A 1PTXA 4AEIA 1DJTA 2N69A 1AYJA 2B68A 1VNBA 1JKZA 1LQHA 1TI5A 1NRAA 2YEOA 2KYQA 2ASCA 1SNBA 1B7DA 2SN3A 5KK4A 1PX9A 1I6FA 1CHZA 1LQIA 1B3CA 1KV0A 1VNAA 5CY0A 4AAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V1D C;  1NPI A;  2LY5 A;  2N2Q A;  1T7B A;  2LJM A;  1NH5 A;  2YC1 C;  1WWN A;  2NY8 X;  2NY9 X;  2KJA A;  1ZUT A;  1ICA A;  1MR4 A;  4CQK A;  2LI7 A;  1ZU3 A;  4HHF A;  3E7U X;  1WT7 A;  1T0Z A;  1T7A A;  1LQQ A;  2KGQ A;  1DQ7 A;  1I2U A;  1ZYV A;  2LT8 A;  1C55 A;  1CN2 A;  1BRZ A;  1N4N A;  1GPS A;  1P0A A;  2LJ7 A;  4KYP A;  1BK8 A;  4UJ0 A;  1FH3 A;  1JZB A;  2KBH A;  2B3C A;  1OZZ A;  1PE4 A;  2YBR C;  1NE5 A;  1NRB A;  1T1T A;  1BMR A;  1SN1 A;  2KSK A;  1L4V A;  2ATB A;  2KPY A;  1ZFU A;  2M8B B;  3E7R L;  2E0H A;  2LR3 A;  2MZ0 A;  2KBK A;  1WMT A;  1P00 A;  2E3G A;  1T7E A;  2BRZ A;  4AB0 A;  2A7T A;  2I61 A;  2GL1 A;  1AHO A;  1GPT A;  2LKB A;  1ZVE A;  3PSM A;  1I2V A;  1SN4 A;  1MYN A;  1JXC A;  4HE7 A;  1OMY A;  1SEG A;  1I6G A;  2N2R A;  1JZA A;  1ZVG A;  2N66 A;  2LY6 A;  1ZYW A;  1BCG A;  2E3F A;  2KBJ A;  1C56 A;  1PTX A;  4AEI A;  1DJT A;  2N69 A;  1AYJ A;  2B68 A;  1VNB A;  1JKZ A;  1LQH A;  1TI5 A;  1NRA A;  2YEO A;  2KYQ A;  2ASC A;  1SNB A;  1B7D A;  2SN3 A;  5KK4 A;  1PX9 A;  1I6F A;  1CHZ A;  1LQI A;  1B3C A;  1KV0 A;  1VNA A;  5CY0 A;  4AAZ A; 
#chains in the Genus database with same CATH topology
 3BK3 C;  4V1D C;  5AQU A;  1QQM A;  1NPI A;  2VY6 A;  2LY5 A;  1BA0 A;  2V7Z A;  2QWN A;  3GDQ A;  3D2E B;  2N2Q A;  1T7B A;  2LJM A;  1NH5 A;  2YC1 C;  1WWN A;  2NY8 X;  2NY9 X;  2KJA A;  1ZUT A;  5F1X A;  3ATV A;  1MR4 A;  4CQK A;  1ICA A;  2LI7 A;  3GL1 A;  3I33 A;  3KVG A;  5AQT A;  5AR0 A;  1ZU3 A;  2E8A A;  1KAY A;  3QFU A;  4H5R A;  5FPE A;  3L6Q A;  3KP0 A;  4HHF A;  5F0X A;  3QML A;  3E7U X;  1YUW A;  1WT7 A;  3FZL A;  1NGG A;  1HX1 A;  1NGE A;  2D56 A;  1T0Z A;  1T7A A;  1LQQ A;  1NGI A;  1NGA A;  2QWQ A;  3HSC A;  5AQH A;  2KGQ A;  1DQ7 A;  4IO8 A;  3LDP A;  5FPN A;  4UAE F;  1I2U A;  1ZYV A;  2LT8 A;  3FZH A;  3SF4 D;  1C55 A;  1BA1 A;  4H5N A;  2QWR A;  5AQQ A;  1CN2 A;  1NGC A;  2YIL A;  1BRZ A;  2K35 A;  1N4N A;  2YIO A;  1P0A A;  2LJ7 A;  4H5W A;  4KYP A;  5AQK A;  5F2R A;  4UJ0 A;  1BK8 A;  1FH3 A;  1JZB A;  2KBH A;  3D2F A;  2QWL A;  2B3C A;  5AQP A;  2QXL A;  1OZZ A;  3FZM A;  5AQR A;  1PE4 A;  2YBR C;  3QI7 A;  3CQX A;  4KBO A;  1NE5 A;  1DKG D;  1NRB A;  1T1T A;  1BMR A;  5AQY A;  3IUC A;  1SN1 A;  2KSK A;  1UGL A;  3LDQ A;  1L4V A;  2ATB A;  2KPY A;  1ZFU A;  4FL9 A;  2M8B B;  1NGB A;  3E7R L;  2G2K A;  3C7N A;  2E0H A;  2LR3 A;  2MZ0 A;  2KBK A;  3LDO A;  5AQF A;  4GNI A;  1WMT A;  1P00 A;  2QW9 A;  1BUP A;  4UAF E;  3M3Z A;  1K8B A;  3LDL A;  2E3G A;  1T7E A;  2BRZ A;  4FSV A;  4AB0 A;  3A8Y A;  1HJO A;  2A7T A;  5AQM A;  5EY4 A;  1GPS A;  2I61 A;  2GL1 A;  1AHO A;  1KAX A;  1QQN A;  1GPT A;  3FZK A;  2MBK A;  2LKB A;  3AY9 A;  4H5T A;  1KAZ A;  5BPL A;  3KOZ A;  5FPD A;  4UAD E;  1ZVE A;  5AQW A;  3PSM A;  2E2F A;  3CW4 A;  1I2V A;  1SN4 A;  2E88 A;  5AQV A;  3KC6 A;  1MYN A;  5EXW A;  1JXC A;  1NGF A;  1S3X A;  4HE7 A;  1OMY A;  1SEG A;  3D2E A;  4HWI A;  1I6G A;  3GKU A;  2N2R A;  1JZA A;  5BN9 A;  3LDN A;  5AQL A;  1NGH A;  3D2F B;  3ATU A;  5AQN A;  3L4I A;  1ZVG A;  5EVZ A;  2N66 A;  1HPM A;  2QWP A;  2LY6 A;  1ZYW A;  5AQZ A;  5BPN A;  5AQG A;  5BN8 A;  1BCG A;  3KHW A;  2E3F A;  1POI A;  2KBJ A;  1ATR A;  1C56 A;  2QWM A;  1PTX A;  5EX5 A;  3FE1 A;  1NGJ A;  1DJT A;  4AEI A;  1NGD A;  2YIP A;  5AQJ A;  2N69 A;  1AYJ A;  2B68 A;  1VNB A;  3L56 A;  1JKZ A;  1ATS A;  1LQH A;  1TI5 A;  1NRA A;  3C7N B;  2YEO A;  5BPM A;  5FPM A;  2KYQ A;  2GMO A;  3QFP A;  2ASC A;  5AQX A;  1QQO A;  1SNB A;  5AQO A;  3FZF A;  3KOX A;  1B7D A;  3KP1 A;  2SN3 A;  2MN5 A;  2QWO A;  4H5V A;  1PX9 A;  1I6F A;  5KK4 A;  3JXU A;  1CHZ A;  2JDQ D;  3KOY A;  1LQI A;  3R2V A;  2LN8 A;  1KV0 A;  2KHO A;  3KOW A;  1XRS B;  2BUP A;  5AQI A;  1B3C A;  1VNA A;  5CY0 A;  5AQS A;  4AAZ A; 
#chains in the Genus database with same CATH homology
 4V1D C;  1NPI A;  2LY5 A;  2N2Q A;  1T7B A;  2LJM A;  1NH5 A;  2YC1 C;  1WWN A;  2NY8 X;  2NY9 X;  2KJA A;  1ZUT A;  1ICA A;  1MR4 A;  4CQK A;  2LI7 A;  1ZU3 A;  4HHF A;  3E7U X;  1WT7 A;  1T0Z A;  1T7A A;  1LQQ A;  2KGQ A;  1DQ7 A;  1I2U A;  1ZYV A;  2LT8 A;  1C55 A;  1CN2 A;  1BRZ A;  1N4N A;  1GPS A;  1P0A A;  2LJ7 A;  4KYP A;  1BK8 A;  4UJ0 A;  1FH3 A;  1JZB A;  2KBH A;  2B3C A;  1OZZ A;  1PE4 A;  2YBR C;  1NE5 A;  1NRB A;  1T1T A;  1BMR A;  1SN1 A;  2KSK A;  1L4V A;  2ATB A;  2KPY A;  1ZFU A;  2M8B B;  3E7R L;  2E0H A;  2LR3 A;  2MZ0 A;  2KBK A;  1WMT A;  1P00 A;  2E3G A;  1T7E A;  2BRZ A;  4AB0 A;  2A7T A;  2I61 A;  2GL1 A;  1AHO A;  1GPT A;  2LKB A;  1ZVE A;  3PSM A;  1I2V A;  1SN4 A;  1MYN A;  1JXC A;  4HE7 A;  1OMY A;  1SEG A;  1I6G A;  2N2R A;  1JZA A;  1ZVG A;  2N66 A;  2LY6 A;  1ZYW A;  1BCG A;  2E3F A;  2KBJ A;  1C56 A;  1PTX A;  4AEI A;  1DJT A;  2N69 A;  1AYJ A;  2B68 A;  1VNB A;  1JKZ A;  1LQH A;  1TI5 A;  1NRA A;  2YEO A;  2KYQ A;  2ASC A;  1SNB A;  1B7D A;  2SN3 A;  5KK4 A;  1PX9 A;  1I6F A;  1CHZ A;  1LQI A;  1B3C A;  1KV0 A;  1VNA A;  5CY0 A;  4AAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...