1VNAA

Proton nuclear magnetic resonance and distance geometry(slash)simulated annealing studies on the variant-1 neurotoxin from the new world scorpion centruroides sculpturatus ewing
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
b'KEGYLVKKSDGCKYDCFWLGKNEHCNTECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN
publication title Proton nuclear magnetic resonance and distance geometry/simulated annealing studies on the variant-1 neurotoxin from the New World scorpion Centruroides sculpturatus Ewing.
pubmed doi rcsb
source organism Centruroides sculpturatus
molecule tags Neurotoxin
total genus 5
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1vnaA00
3PSMA 1T7AA 2KBKA 1C55A 1CHZA 1T7EA 1CN2A 2LR3A 4AB0A 1MR4A 1ICAA 1GPSA 1NRBA 1PTXA 1I2VA 1ZYVA 2SN3A 1DQ7A 1I2UA 1OMYA 1ZVEA 1AYJA 1WMTA 1LQQA 1SN4A 4AEIA 1NPIA 1OZZA 2GL1A 2LY6A 1L4VA 2LKBA 2BRZA 1JXCA 4KYPA 2E0HA 1KV0A 1MYNA 1PX9A 2NY9X 1JZBA 1NRAA 1I6FA 5KK4A 4UJ0A 1ZVGA 2KBJA 1B3CA 2LT8A 2KGQA 2ATBA 1TI5A 1SEGA 2MZ0A 4HE7A 1T1TA 2N2QA 2M8BB 1NE5A 2B3CA 2N69A 4AAZA 2LJ7A 1I6GA 2YC1C 1T7BA 2I61A 2KYQA 1ZYWA 1ZFUA 1N4NA 3E7UX 1BRZA 4V1DC 2KPYA 1BCGA 2N2RA 1BMRA 1SNBA 1B7DA 2ASCA 4CQKA 1FH3A 1LQHA 1WT7A 2LJMA 1DJTA 1LQIA 2YEOA 2KSKA 1C56A 1SN1A 2LY5A 1BK8A 2NY8X 1AHOA 1JKZA 1ZU3A 1P0AA 2KBHA 3E7RL 2E3FA 1VNAA 2YBRC 1ZUTA 1NH5A 2B68A 1WWNA 5CY0A 2KJAA 1JZAA 1P00A 2E3GA 4HHFA 1T0ZA 1VNBA 2A7TA 2N66A 2LI7A 1GPTA 1PE4A
chains in the Genus database with same CATH superfamily
2VY6A 5F2RA 5FPNA 5AQOA 2E2FA 1NGGA 5AQJA 2BUPA 3KP0A 1DKGD 3PSMA 3KVGA 2K35A 1BA0A 1T7AA 2KBKA 5AQLA 1C55A 5AQRA 1HX1A 5AR0A 5AQYA 1ATRA 1CHZA 1T7EA 2G2KA 3QI7A 4H5VA 5BN8A 1CN2A 2LR3A 5AQVA 4AB0A 5EXWA 1KAXA 1MR4A 1BUPA 1GPSA 1ICAA 1NRBA 1PTXA 1QQOA 3ATVA 3R2VA 3QFPA 5AQKA 5F1XA 1I2VA 1ZYVA 2SN3A 1DQ7A 2E88A 4H5WA 4GNIA 1OMYA 1ZVEA 1I2UA 1AYJA 1WMTA 1LQQA 1SN4A 4AEIA 1NPIA 1YUWA 3IUCA 1OZZA 3FZLA 2GL1A 2LY6A 1L4VA 2LKBA 2BRZA 1JXCA 2LN8A 3QFUA 2QWOA 4KYPA 2E0HA 1KV0A 1MYNA 1NGHA 1PX9A 2JDQD 5AQIA 5AQHA 3KOZA 3KOWA 4UAFE 2NY9X 4UADE 1JZBA 5AQNA 1NRAA 2YIPA 1I6FA 5AQPA 3HSCA 5KK4A 5AQUA 4UJ0A 3FZFA 4H5RA 1BA1A 2QWNA 1ZVGA 2KBJA 2QWRA 1QQNA 1B3CA 4H5TA 2LT8A 3L6QA 2KGQA 1NGCA 1POIA 3ATUA 3FZMA 3L56A 5AQMA 2YIOA 3CW4A 4FSVA 2ATBA 3GDQA 1TI5A 1SEGA 2MZ0A 4HE7A 1XRSB 1T1TA 3KHWA 5EVZA 2N2QA 4IO8A 2M8BB 1NE5A 2B3CA 5AQSA 2N69A 5AQGA 4AAZA 1NGDA 1NGFA 3GL1A 2LJ7A 5AQZA 4UAEF 1I6GA 2YC1C 1KAZA 3FE1A 1T7BA 1UGLA 3LDPA 2I61A 4HWIA 2KYQA 3KOXA 3AY9A 2MBKA 1ZYWA 1ZFUA 5BPNA 1N4NA 3E7UX 1BRZA 4V1DC 2KPYA 1BCGA 2N2RA 3SF4D 1BMRA 1K8BA 1SNBA 1B7DA 5EY4A 1S3XA 2KHOA 3LDQA 3L4IA 2ASCA 3I33A 5FPEA 5BPMA 5EX5A 4CQKA 2QWLA 1HPMA 1FH3A 5AQFA 3JXUA 1LQHA 1WT7A 2LJMA 1DJTA 1KAYA 1LQIA 2YEOA 2KSKA 5AQXA 1C56A 3QMLA 1SN1A 2LY5A 5F0XA 1BK8A 1NGJA 3GKUA 2NY8X 1AHOA 5AQTA 2QW9A 4KBOA 2V7ZA 1JKZA 1ATSA 1ZU3A 1NGEA 1NGAA 3M3ZA 1P0AA 2KBHA 2D56A 2YILA 3E7RL 2E3FA 3D2FB 3C7NB 3FZKA 1HJOA 3FZHA 3LDNA 4H5NA 3BK3C 3CQXA 3KOYA 2QWPA 3C7NA 2QWMA 1VNAA 2YBRC 3D2FA 5FPMA 1ZUTA 5BPLA 2GMOA 1NH5A 2B68A 1WWNA 5CY0A 4FL9A 2KJAA 3A8YA 2MN5A 2QWQA 1JZAA 1P00A 3LDLA 2E3GA 4HHFA 1T0ZA 3KP1A 5AQQA 1QQMA 3D2EB 5BN9A 5AQWA 1VNBA 2A7TA 2N66A 3KC6A 1NGIA 2E8AA 2LI7A 3D2EA 5FPDA 1GPTA 1NGBA 2QXLA 3LDOA 1PE4A
chains in the Genus database with same CATH topology
3PSMA 1T7AA 2KBKA 1C55A 1CHZA 1T7EA 1CN2A 2LR3A 4AB0A 1MR4A 1ICAA 1GPSA 1NRBA 1PTXA 1I2VA 1ZYVA 2SN3A 1DQ7A 1I2UA 1OMYA 1ZVEA 1AYJA 1WMTA 1LQQA 1SN4A 4AEIA 1NPIA 1OZZA 2GL1A 2LY6A 1L4VA 2LKBA 2BRZA 1JXCA 4KYPA 2E0HA 1KV0A 1MYNA 1PX9A 2NY9X 1JZBA 1NRAA 1I6FA 5KK4A 4UJ0A 1ZVGA 2KBJA 1B3CA 2LT8A 2KGQA 2ATBA 1TI5A 1SEGA 2MZ0A 4HE7A 1T1TA 2N2QA 2M8BB 1NE5A 2B3CA 2N69A 4AAZA 2LJ7A 1I6GA 2YC1C 1T7BA 2I61A 2KYQA 1ZYWA 1ZFUA 1N4NA 3E7UX 1BRZA 4V1DC 2KPYA 1BCGA 2N2RA 1BMRA 1SNBA 1B7DA 2ASCA 4CQKA 1FH3A 1LQHA 1WT7A 2LJMA 1DJTA 1LQIA 2YEOA 2KSKA 1C56A 1SN1A 2LY5A 1BK8A 2NY8X 1AHOA 1JKZA 1ZU3A 1P0AA 2KBHA 3E7RL 2E3FA 1VNAA 2YBRC 1ZUTA 1NH5A 2B68A 1WWNA 5CY0A 2KJAA 1JZAA 1P00A 2E3GA 4HHFA 1T0ZA 1VNBA 2A7TA 2N66A 2LI7A 1GPTA 1PE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSM A;  1T7A A;  2KBK A;  1C55 A;  1CHZ A;  1T7E A;  1CN2 A;  2LR3 A;  4AB0 A;  1MR4 A;  1ICA A;  1GPS A;  1NRB A;  1PTX A;  1I2V A;  1ZYV A;  2SN3 A;  1DQ7 A;  1I2U A;  1OMY A;  1ZVE A;  1AYJ A;  1WMT A;  1LQQ A;  1SN4 A;  4AEI A;  1NPI A;  1OZZ A;  2GL1 A;  2LY6 A;  1L4V A;  2LKB A;  2BRZ A;  1JXC A;  4KYP A;  2E0H A;  1KV0 A;  1MYN A;  1PX9 A;  2NY9 X;  1JZB A;  1NRA A;  1I6F A;  5KK4 A;  4UJ0 A;  1ZVG A;  2KBJ A;  1B3C A;  2LT8 A;  2KGQ A;  2ATB A;  1TI5 A;  1SEG A;  2MZ0 A;  4HE7 A;  1T1T A;  2N2Q A;  2M8B B;  1NE5 A;  2B3C A;  2N69 A;  4AAZ A;  2LJ7 A;  1I6G A;  2YC1 C;  1T7B A;  2I61 A;  2KYQ A;  1ZYW A;  1ZFU A;  1N4N A;  3E7U X;  1BRZ A;  4V1D C;  2KPY A;  1BCG A;  2N2R A;  1BMR A;  1SNB A;  1B7D A;  2ASC A;  4CQK A;  1FH3 A;  1LQH A;  1WT7 A;  2LJM A;  1DJT A;  1LQI A;  2YEO A;  2KSK A;  1C56 A;  1SN1 A;  2LY5 A;  1BK8 A;  2NY8 X;  1AHO A;  1JKZ A;  1ZU3 A;  1P0A A;  2KBH A;  3E7R L;  2E3F A;  1VNA A;  2YBR C;  1ZUT A;  1NH5 A;  2B68 A;  1WWN A;  5CY0 A;  2KJA A;  1JZA A;  1P00 A;  2E3G A;  4HHF A;  1T0Z A;  1VNB A;  2A7T A;  2N66 A;  2LI7 A;  1GPT A;  1PE4 A; 
#chains in the Genus database with same CATH topology
 2VY6 A;  5F2R A;  5FPN A;  5AQO A;  2E2F A;  1NGG A;  5AQJ A;  2BUP A;  3KP0 A;  1DKG D;  3PSM A;  3KVG A;  2K35 A;  1BA0 A;  1T7A A;  2KBK A;  5AQL A;  1C55 A;  5AQR A;  1HX1 A;  5AR0 A;  5AQY A;  1ATR A;  1CHZ A;  1T7E A;  2G2K A;  3QI7 A;  4H5V A;  5BN8 A;  1CN2 A;  2LR3 A;  5AQV A;  4AB0 A;  5EXW A;  1KAX A;  1MR4 A;  1BUP A;  1GPS A;  1ICA A;  1NRB A;  1PTX A;  1QQO A;  3ATV A;  3R2V A;  3QFP A;  5AQK A;  5F1X A;  1I2V A;  1ZYV A;  2SN3 A;  1DQ7 A;  2E88 A;  4H5W A;  4GNI A;  1OMY A;  1ZVE A;  1I2U A;  1AYJ A;  1WMT A;  1LQQ A;  1SN4 A;  4AEI A;  1NPI A;  1YUW A;  3IUC A;  1OZZ A;  3FZL A;  2GL1 A;  2LY6 A;  1L4V A;  2LKB A;  2BRZ A;  1JXC A;  2LN8 A;  3QFU A;  2QWO A;  4KYP A;  2E0H A;  1KV0 A;  1MYN A;  1NGH A;  1PX9 A;  2JDQ D;  5AQI A;  5AQH A;  3KOZ A;  3KOW A;  4UAF E;  2NY9 X;  4UAD E;  1JZB A;  5AQN A;  1NRA A;  2YIP A;  1I6F A;  5AQP A;  3HSC A;  5KK4 A;  5AQU A;  4UJ0 A;  3FZF A;  4H5R A;  1BA1 A;  2QWN A;  1ZVG A;  2KBJ A;  2QWR A;  1QQN A;  1B3C A;  4H5T A;  2LT8 A;  3L6Q A;  2KGQ A;  1NGC A;  1POI A;  3ATU A;  3FZM A;  3L56 A;  5AQM A;  2YIO A;  3CW4 A;  4FSV A;  2ATB A;  3GDQ A;  1TI5 A;  1SEG A;  2MZ0 A;  4HE7 A;  1XRS B;  1T1T A;  3KHW A;  5EVZ A;  2N2Q A;  4IO8 A;  2M8B B;  1NE5 A;  2B3C A;  5AQS A;  2N69 A;  5AQG A;  4AAZ A;  1NGD A;  1NGF A;  3GL1 A;  2LJ7 A;  5AQZ A;  4UAE F;  1I6G A;  2YC1 C;  1KAZ A;  3FE1 A;  1T7B A;  1UGL A;  3LDP A;  2I61 A;  4HWI A;  2KYQ A;  3KOX A;  3AY9 A;  2MBK A;  1ZYW A;  1ZFU A;  5BPN A;  1N4N A;  3E7U X;  1BRZ A;  4V1D C;  2KPY A;  1BCG A;  2N2R A;  3SF4 D;  1BMR A;  1K8B A;  1SNB A;  1B7D A;  5EY4 A;  1S3X A;  2KHO A;  3LDQ A;  3L4I A;  2ASC A;  3I33 A;  5FPE A;  5BPM A;  5EX5 A;  4CQK A;  2QWL A;  1HPM A;  1FH3 A;  5AQF A;  3JXU A;  1LQH A;  1WT7 A;  2LJM A;  1DJT A;  1KAY A;  1LQI A;  2YEO A;  2KSK A;  5AQX A;  1C56 A;  3QML A;  1SN1 A;  2LY5 A;  5F0X A;  1BK8 A;  1NGJ A;  3GKU A;  2NY8 X;  1AHO A;  5AQT A;  2QW9 A;  4KBO A;  2V7Z A;  1JKZ A;  1ATS A;  1ZU3 A;  1NGE A;  1NGA A;  3M3Z A;  1P0A A;  2KBH A;  2D56 A;  2YIL A;  3E7R L;  2E3F A;  3D2F B;  3C7N B;  3FZK A;  1HJO A;  3FZH A;  3LDN A;  4H5N A;  3BK3 C;  3CQX A;  3KOY A;  2QWP A;  3C7N A;  2QWM A;  1VNA A;  2YBR C;  3D2F A;  5FPM A;  1ZUT A;  5BPL A;  2GMO A;  1NH5 A;  2B68 A;  1WWN A;  5CY0 A;  4FL9 A;  2KJA A;  3A8Y A;  2MN5 A;  2QWQ A;  1JZA A;  1P00 A;  3LDL A;  2E3G A;  4HHF A;  1T0Z A;  3KP1 A;  5AQQ A;  1QQM A;  3D2E B;  5BN9 A;  5AQW A;  1VNB A;  2A7T A;  2N66 A;  3KC6 A;  1NGI A;  2E8A A;  2LI7 A;  3D2E A;  5FPD A;  1GPT A;  1NGB A;  2QXL A;  3LDO A;  1PE4 A; 
#chains in the Genus database with same CATH homology
 3PSM A;  1T7A A;  2KBK A;  1C55 A;  1CHZ A;  1T7E A;  1CN2 A;  2LR3 A;  4AB0 A;  1MR4 A;  1ICA A;  1GPS A;  1NRB A;  1PTX A;  1I2V A;  1ZYV A;  2SN3 A;  1DQ7 A;  1I2U A;  1OMY A;  1ZVE A;  1AYJ A;  1WMT A;  1LQQ A;  1SN4 A;  4AEI A;  1NPI A;  1OZZ A;  2GL1 A;  2LY6 A;  1L4V A;  2LKB A;  2BRZ A;  1JXC A;  4KYP A;  2E0H A;  1KV0 A;  1MYN A;  1PX9 A;  2NY9 X;  1JZB A;  1NRA A;  1I6F A;  5KK4 A;  4UJ0 A;  1ZVG A;  2KBJ A;  1B3C A;  2LT8 A;  2KGQ A;  2ATB A;  1TI5 A;  1SEG A;  2MZ0 A;  4HE7 A;  1T1T A;  2N2Q A;  2M8B B;  1NE5 A;  2B3C A;  2N69 A;  4AAZ A;  2LJ7 A;  1I6G A;  2YC1 C;  1T7B A;  2I61 A;  2KYQ A;  1ZYW A;  1ZFU A;  1N4N A;  3E7U X;  1BRZ A;  4V1D C;  2KPY A;  1BCG A;  2N2R A;  1BMR A;  1SNB A;  1B7D A;  2ASC A;  4CQK A;  1FH3 A;  1LQH A;  1WT7 A;  2LJM A;  1DJT A;  1LQI A;  2YEO A;  2KSK A;  1C56 A;  1SN1 A;  2LY5 A;  1BK8 A;  2NY8 X;  1AHO A;  1JKZ A;  1ZU3 A;  1P0A A;  2KBH A;  3E7R L;  2E3F A;  1VNA A;  2YBR C;  1ZUT A;  1NH5 A;  2B68 A;  1WWN A;  5CY0 A;  2KJA A;  1JZA A;  1P00 A;  2E3G A;  4HHF A;  1T0Z A;  1VNB A;  2A7T A;  2N66 A;  2LI7 A;  1GPT A;  1PE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...