1ZUTA

Crystal structure of mutant k8dp9sr58k of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
NSVRDAYIADSHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIKVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural basis for the voltage-gated Na+ channel selectivity of the scorpion alpha-like toxin BmK M1
pubmed doi rcsb
source organism Mesobuthus martensii
molecule tags Toxin
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1zutA00
1T1TA 1P00A 4AB0A 2E0HA 2GL1A 2KJAA 1T0ZA 1BMRA 1AYJA 2NY9X 1WMTA 1I2UA 2KBKA 2LY6A 1CHZA 1JKZA 2BRZA 1NH5A 4HHFA 4UJ0A 2YBRC 2YEOA 1JXCA 2E3GA 2B68A 2ASCA 1SN4A 2N66A 1ZUTA 1LQHA 1VNBA 1GPTA 1L4VA 2LR3A 1FH3A 2N69A 1BRZA 1ZYWA 1BCGA 4HE7A 1NE5A 2LY5A 1MYNA 1AHOA 2SN3A 1ZVGA 2YC1C 4V1DC 3E7RL 1VNAA 1KV0A 1NPIA 4AAZA 1DJTA 1PX9A 1JZAA 4CQKA 1MR4A 1N4NA 1ZYVA 1PE4A 1GPSA 1PTXA 1B7DA 2LI7A 2LJMA 1ZFUA 1NRAA 2ATBA 1LQQA 3E7UX 5CY0A 1T7EA 2LJ7A 2N2RA 3PSMA 1NRBA 1OZZA 1TI5A 2M8BB 2NY8X 1ZU3A 1ICAA 2KSKA 2E3FA 1SN1A 1WT7A 1BK8A 1CN2A 1C56A 2A7TA 4AEIA 1OMYA 1P0AA 1T7BA 1C55A 1SNBA 2KBJA 2KGQA 1ZVEA 2LKBA 5KK4A 4KYPA 2KBHA 1B3CA 1I6GA 1SEGA 2I61A 1I6FA 1JZBA 2KPYA 2KYQA 1LQIA 1WWNA 2MZ0A 2N2QA 1DQ7A 1I2VA 2B3CA 2LT8A 1T7AA
chains in the Genus database with same CATH superfamily
1T1TA 1P00A 3FZMA 3AY9A 3LDNA 4HWIA 4AB0A 2E0HA 2GL1A 2KJAA 1ATSA 3ATVA 1HJOA 2VY6A 1T0ZA 2YIPA 3GL1A 1BMRA 3KOYA 5BPLA 3QFUA 1AYJA 5FPDA 2NY9X 3FZHA 1WMTA 3LDQA 5AQPA 5BN9A 2QWQA 3GKUA 1I2UA 2KBKA 3D2FA 1XRSB 2LY6A 5AQGA 2GMOA 1CHZA 2QWNA 5AQJA 2E8AA 1JKZA 4H5VA 5FPMA 2BRZA 1NH5A 4HHFA 1NGEA 4UJ0A 5FPEA 2YBRC 2YEOA 1JXCA 1NGGA 5AQOA 2E3GA 2QWLA 2B68A 5BPMA 2ASCA 4FSVA 1SN4A 2N66A 1ZUTA 1ATRA 1LQHA 4UADE 1VNBA 1POIA 3FZLA 1GPTA 1L4VA 5EY4A 3CW4A 2V7ZA 2LR3A 1FH3A 1QQOA 5EVZA 2N69A 3ATUA 3KVGA 4FL9A 1BRZA 1ZYWA 1BCGA 4HE7A 3FZKA 3KC6A 4H5WA 1BA0A 1NE5A 2E88A 2LY5A 5AR0A 3KP0A 5BPNA 3D2FB 4H5TA 1MYNA 1AHOA 2SN3A 2QWMA 1HX1A 3C7NA 1ZVGA 3FZFA 3HSCA 3KOWA 5F1XA 2QWOA 4UAEF 2YC1C 3QMLA 4V1DC 5AQIA 5AQXA 3LDLA 1NGHA 2G2KA 1KAZA 3E7RL 3SF4D 1VNAA 3L4IA 2E2FA 1KV0A 1NPIA 1NGJA 5AQFA 4AAZA 3FE1A 1DJTA 1DKGD 3IUCA 5AQVA 1PX9A 4H5RA 1JZAA 5F2RA 1QQMA 2QWPA 5AQTA 4CQKA 3KHWA 1MR4A 3D2EA 5AQKA 5AQUA 3LDOA 1N4NA 2D56A 4UAFE 2MN5A 1ZYVA 1PE4A 3LDPA 5AQSA 1GPSA 1PTXA 1B7DA 2LI7A 2YIOA 3C7NB 1NGCA 2LJMA 2MBKA 4KBOA 1NGAA 1ZFUA 1YUWA 3I33A 3KOZA 5AQMA 4IO8A 1NRAA 3GDQA 2ATBA 1LQQA 3KOXA 3E7UX 5CY0A 1T7EA 2LJ7A 2N2RA 2QWRA 1S3XA 2LN8A 2JDQD 1NRBA 2QW9A 2YILA 3PSMA 4GNIA 5EXWA 5AQWA 2QXLA 1OZZA 1TI5A 2M8BB 2NY8X 1BUPA 1ZU3A 1HPMA 1ICAA 3R2VA 1NGIA 2KSKA 2BUPA 1SN1A 2E3FA 3A8YA 5AQQA 1NGFA 5AQNA 1WT7A 1NGDA 1BK8A 2KHOA 1CN2A 1BA1A 1C56A 5F0XA 1KAXA 2A7TA 5FPNA 4AEIA 1OMYA 1P0AA 1T7BA 3KP1A 3QFPA 1C55A 1SNBA 2KBJA 2KGQA 1ZVEA 1NGBA 2LKBA 5KK4A 4KYPA 2KBHA 5AQHA 5AQLA 5EX5A 5AQZA 1B3CA 1K8BA 1I6GA 1KAYA 1SEGA 2I61A 1I6FA 5AQRA 1JZBA 2KPYA 2KYQA 3BK3C 3D2EB 3JXUA 1LQIA 1WWNA 3L56A 5BN8A 2K35A 3QI7A 2MZ0A 4H5NA 3CQXA 2N2QA 3M3ZA 1DQ7A 3L6QA 1UGLA 1I2VA 5AQYA 2B3CA 1QQNA 2LT8A 1T7AA
chains in the Genus database with same CATH topology
1T1TA 1P00A 4AB0A 2E0HA 2GL1A 2KJAA 1T0ZA 1BMRA 1AYJA 2NY9X 1WMTA 1I2UA 2KBKA 2LY6A 1CHZA 1JKZA 2BRZA 1NH5A 4HHFA 4UJ0A 2YBRC 2YEOA 1JXCA 2E3GA 2B68A 2ASCA 1SN4A 2N66A 1ZUTA 1LQHA 1VNBA 1GPTA 1L4VA 2LR3A 1FH3A 2N69A 1BRZA 1ZYWA 1BCGA 4HE7A 1NE5A 2LY5A 1MYNA 1AHOA 2SN3A 1ZVGA 2YC1C 4V1DC 3E7RL 1VNAA 1KV0A 1NPIA 4AAZA 1DJTA 1PX9A 1JZAA 4CQKA 1MR4A 1N4NA 1ZYVA 1PE4A 1GPSA 1PTXA 1B7DA 2LI7A 2LJMA 1ZFUA 1NRAA 2ATBA 1LQQA 3E7UX 5CY0A 1T7EA 2LJ7A 2N2RA 3PSMA 1NRBA 1OZZA 1TI5A 2M8BB 2NY8X 1ZU3A 1ICAA 2KSKA 2E3FA 1SN1A 1WT7A 1BK8A 1CN2A 1C56A 2A7TA 4AEIA 1OMYA 1P0AA 1T7BA 1C55A 1SNBA 2KBJA 2KGQA 1ZVEA 2LKBA 5KK4A 4KYPA 2KBHA 1B3CA 1I6GA 1SEGA 2I61A 1I6FA 1JZBA 2KPYA 2KYQA 1LQIA 1WWNA 2MZ0A 2N2QA 1DQ7A 1I2VA 2B3CA 2LT8A 1T7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1T A;  1P00 A;  4AB0 A;  2E0H A;  2GL1 A;  2KJA A;  1T0Z A;  1BMR A;  1AYJ A;  2NY9 X;  1WMT A;  1I2U A;  2KBK A;  2LY6 A;  1CHZ A;  1JKZ A;  2BRZ A;  1NH5 A;  4HHF A;  4UJ0 A;  2YBR C;  2YEO A;  1JXC A;  2E3G A;  2B68 A;  2ASC A;  1SN4 A;  2N66 A;  1ZUT A;  1LQH A;  1VNB A;  1GPT A;  1L4V A;  2LR3 A;  1FH3 A;  2N69 A;  1BRZ A;  1ZYW A;  1BCG A;  4HE7 A;  1NE5 A;  2LY5 A;  1MYN A;  1AHO A;  2SN3 A;  1ZVG A;  2YC1 C;  4V1D C;  3E7R L;  1VNA A;  1KV0 A;  1NPI A;  4AAZ A;  1DJT A;  1PX9 A;  1JZA A;  4CQK A;  1MR4 A;  1N4N A;  1ZYV A;  1PE4 A;  1GPS A;  1PTX A;  1B7D A;  2LI7 A;  2LJM A;  1ZFU A;  1NRA A;  2ATB A;  1LQQ A;  3E7U X;  5CY0 A;  1T7E A;  2LJ7 A;  2N2R A;  3PSM A;  1NRB A;  1OZZ A;  1TI5 A;  2M8B B;  2NY8 X;  1ZU3 A;  1ICA A;  2KSK A;  2E3F A;  1SN1 A;  1WT7 A;  1BK8 A;  1CN2 A;  1C56 A;  2A7T A;  4AEI A;  1OMY A;  1P0A A;  1T7B A;  1C55 A;  1SNB A;  2KBJ A;  2KGQ A;  1ZVE A;  2LKB A;  5KK4 A;  4KYP A;  2KBH A;  1B3C A;  1I6G A;  1SEG A;  2I61 A;  1I6F A;  1JZB A;  2KPY A;  2KYQ A;  1LQI A;  1WWN A;  2MZ0 A;  2N2Q A;  1DQ7 A;  1I2V A;  2B3C A;  2LT8 A;  1T7A A; 
#chains in the Genus database with same CATH topology
 1T1T A;  1P00 A;  3FZM A;  3AY9 A;  3LDN A;  4HWI A;  4AB0 A;  2E0H A;  2GL1 A;  2KJA A;  1ATS A;  3ATV A;  1HJO A;  2VY6 A;  1T0Z A;  2YIP A;  3GL1 A;  1BMR A;  3KOY A;  5BPL A;  3QFU A;  1AYJ A;  5FPD A;  2NY9 X;  3FZH A;  1WMT A;  3LDQ A;  5AQP A;  5BN9 A;  2QWQ A;  3GKU A;  1I2U A;  2KBK A;  3D2F A;  1XRS B;  2LY6 A;  5AQG A;  2GMO A;  1CHZ A;  2QWN A;  5AQJ A;  2E8A A;  1JKZ A;  4H5V A;  5FPM A;  2BRZ A;  1NH5 A;  4HHF A;  1NGE A;  4UJ0 A;  5FPE A;  2YBR C;  2YEO A;  1JXC A;  1NGG A;  5AQO A;  2E3G A;  2QWL A;  2B68 A;  5BPM A;  2ASC A;  4FSV A;  1SN4 A;  2N66 A;  1ZUT A;  1ATR A;  1LQH A;  4UAD E;  1VNB A;  1POI A;  3FZL A;  1GPT A;  1L4V A;  5EY4 A;  3CW4 A;  2V7Z A;  2LR3 A;  1FH3 A;  1QQO A;  5EVZ A;  2N69 A;  3ATU A;  3KVG A;  4FL9 A;  1BRZ A;  1ZYW A;  1BCG A;  4HE7 A;  3FZK A;  3KC6 A;  4H5W A;  1BA0 A;  1NE5 A;  2E88 A;  2LY5 A;  5AR0 A;  3KP0 A;  5BPN A;  3D2F B;  4H5T A;  1MYN A;  1AHO A;  2SN3 A;  2QWM A;  1HX1 A;  3C7N A;  1ZVG A;  3FZF A;  3HSC A;  3KOW A;  5F1X A;  2QWO A;  4UAE F;  2YC1 C;  3QML A;  4V1D C;  5AQI A;  5AQX A;  3LDL A;  1NGH A;  2G2K A;  1KAZ A;  3E7R L;  3SF4 D;  1VNA A;  3L4I A;  2E2F A;  1KV0 A;  1NPI A;  1NGJ A;  5AQF A;  4AAZ A;  3FE1 A;  1DJT A;  1DKG D;  3IUC A;  5AQV A;  1PX9 A;  4H5R A;  1JZA A;  5F2R A;  1QQM A;  2QWP A;  5AQT A;  4CQK A;  3KHW A;  1MR4 A;  3D2E A;  5AQK A;  5AQU A;  3LDO A;  1N4N A;  2D56 A;  4UAF E;  2MN5 A;  1ZYV A;  1PE4 A;  3LDP A;  5AQS A;  1GPS A;  1PTX A;  1B7D A;  2LI7 A;  2YIO A;  3C7N B;  1NGC A;  2LJM A;  2MBK A;  4KBO A;  1NGA A;  1ZFU A;  1YUW A;  3I33 A;  3KOZ A;  5AQM A;  4IO8 A;  1NRA A;  3GDQ A;  2ATB A;  1LQQ A;  3KOX A;  3E7U X;  5CY0 A;  1T7E A;  2LJ7 A;  2N2R A;  2QWR A;  1S3X A;  2LN8 A;  2JDQ D;  1NRB A;  2QW9 A;  2YIL A;  3PSM A;  4GNI A;  5EXW A;  5AQW A;  2QXL A;  1OZZ A;  1TI5 A;  2M8B B;  2NY8 X;  1BUP A;  1ZU3 A;  1HPM A;  1ICA A;  3R2V A;  1NGI A;  2KSK A;  2BUP A;  1SN1 A;  2E3F A;  3A8Y A;  5AQQ A;  1NGF A;  5AQN A;  1WT7 A;  1NGD A;  1BK8 A;  2KHO A;  1CN2 A;  1BA1 A;  1C56 A;  5F0X A;  1KAX A;  2A7T A;  5FPN A;  4AEI A;  1OMY A;  1P0A A;  1T7B A;  3KP1 A;  3QFP A;  1C55 A;  1SNB A;  2KBJ A;  2KGQ A;  1ZVE A;  1NGB A;  2LKB A;  5KK4 A;  4KYP A;  2KBH A;  5AQH A;  5AQL A;  5EX5 A;  5AQZ A;  1B3C A;  1K8B A;  1I6G A;  1KAY A;  1SEG A;  2I61 A;  1I6F A;  5AQR A;  1JZB A;  2KPY A;  2KYQ A;  3BK3 C;  3D2E B;  3JXU A;  1LQI A;  1WWN A;  3L56 A;  5BN8 A;  2K35 A;  3QI7 A;  2MZ0 A;  4H5N A;  3CQX A;  2N2Q A;  3M3Z A;  1DQ7 A;  3L6Q A;  1UGL A;  1I2V A;  5AQY A;  2B3C A;  1QQN A;  2LT8 A;  1T7A A; 
#chains in the Genus database with same CATH homology
 1T1T A;  1P00 A;  4AB0 A;  2E0H A;  2GL1 A;  2KJA A;  1T0Z A;  1BMR A;  1AYJ A;  2NY9 X;  1WMT A;  1I2U A;  2KBK A;  2LY6 A;  1CHZ A;  1JKZ A;  2BRZ A;  1NH5 A;  4HHF A;  4UJ0 A;  2YBR C;  2YEO A;  1JXC A;  2E3G A;  2B68 A;  2ASC A;  1SN4 A;  2N66 A;  1ZUT A;  1LQH A;  1VNB A;  1GPT A;  1L4V A;  2LR3 A;  1FH3 A;  2N69 A;  1BRZ A;  1ZYW A;  1BCG A;  4HE7 A;  1NE5 A;  2LY5 A;  1MYN A;  1AHO A;  2SN3 A;  1ZVG A;  2YC1 C;  4V1D C;  3E7R L;  1VNA A;  1KV0 A;  1NPI A;  4AAZ A;  1DJT A;  1PX9 A;  1JZA A;  4CQK A;  1MR4 A;  1N4N A;  1ZYV A;  1PE4 A;  1GPS A;  1PTX A;  1B7D A;  2LI7 A;  2LJM A;  1ZFU A;  1NRA A;  2ATB A;  1LQQ A;  3E7U X;  5CY0 A;  1T7E A;  2LJ7 A;  2N2R A;  3PSM A;  1NRB A;  1OZZ A;  1TI5 A;  2M8B B;  2NY8 X;  1ZU3 A;  1ICA A;  2KSK A;  2E3F A;  1SN1 A;  1WT7 A;  1BK8 A;  1CN2 A;  1C56 A;  2A7T A;  4AEI A;  1OMY A;  1P0A A;  1T7B A;  1C55 A;  1SNB A;  2KBJ A;  2KGQ A;  1ZVE A;  2LKB A;  5KK4 A;  4KYP A;  2KBH A;  1B3C A;  1I6G A;  1SEG A;  2I61 A;  1I6F A;  1JZB A;  2KPY A;  2KYQ A;  1LQI A;  1WWN A;  2MZ0 A;  2N2Q A;  1DQ7 A;  1I2V A;  2B3C A;  2LT8 A;  1T7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...