1ZUTA

Crystal structure of mutant k8dp9sr58k of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
b'NSVRDAYIADSHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIKVPGKCH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural basis for the voltage-gated Na+ channel selectivity of the scorpion alpha-like toxin BmK M1
pubmed doi rcsb
source organism Mesobuthus martensii
molecule tags Toxin
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1zutA00
1T7BA 2N2RA 1T1TA 2LJ7A 2LY5A 2YC1C 2ASCA 1WT7A 1T0ZA 1PX9A 2B68A 1SEGA 2KSKA 1NRAA 1VNAA 2N66A 2I61A 1FH3A 1OMYA 1SN1A 2SN3A 2LR3A 1GPTA 1SNBA 4CQKA 1ZUTA 1DJTA 1ZFUA 2LKBA 1OZZA 1LQIA 1ZYWA 2MZ0A 1BK8A 1CN2A 1WMTA 2ATBA 1LQHA 3E7RL 1GPSA 1BMRA 4V1DC 1I6FA 2E0HA 2KBJA 1ZVEA 2N69A 1C56A 1T7EA 4KYPA 1NPIA 1CHZA 2KBHA 1I6GA 1PE4A 5KK4A 1VNBA 1LQQA 1MR4A 5CY0A 1B3CA 1JZBA 1ZVGA 2GL1A 4AEIA 2LT8A 1BRZA 4UJ0A 2M8BB 1B7DA 2KGQA 3E7UX 1AHOA 4HHFA 3PSMA 1ZU3A 4AB0A 1NRBA 4HE7A 1NE5A 2KBKA 1TI5A 2NY8X 2YBRC 4AAZA 1I2VA 1JKZA 2KJAA 1MYNA 2A7TA 2LY6A 1L4VA 1PTXA 1NH5A 1P0AA 1SN4A 1WWNA 2YEOA 1C55A 1AYJA 1ZYVA 2LI7A 1N4NA 1JZAA 2BRZA 2KYQA 1I2UA 1DQ7A 2E3FA 2N2QA 1JXCA 1KV0A 2NY9X 2LJMA 1ICAA 1P00A 2B3CA 1BCGA 1T7AA 2E3GA 2KPYA
chains in the Genus database with same CATH superfamily
1T7BA 2N2RA 3CW4A 1T1TA 1NGHA 2QWLA 3L56A 2GMOA 3AY9A 4FL9A 3KP0A 2LJ7A 1KAYA 2LY5A 2YC1C 3KHWA 2ASCA 1NGEA 5AQNA 1UGLA 1WT7A 5F2RA 4UAFE 1T0ZA 5AQQA 1PX9A 2QXLA 2B68A 3FZHA 3KC6A 4UAEF 1SEGA 5AQZA 3KOWA 1QQOA 1YUWA 2KSKA 1NRAA 1VNAA 2N66A 2YIPA 3D2EA 2I61A 5AQKA 1FH3A 5BPNA 3KVGA 2JDQD 1OMYA 1SN1A 2SN3A 2LR3A 3L4IA 1GPTA 1SNBA 2E2FA 2E8AA 4CQKA 1ZUTA 1DJTA 3D2FB 3IUCA 3LDPA 1NGGA 3I33A 5FPDA 1ZFUA 3QI7A 2LKBA 1OZZA 3M3ZA 3LDNA 1LQIA 1DKGD 2QWOA 1ZYWA 4GNIA 4IO8A 5EVZA 1ATRA 2MZ0A 1BK8A 5F0XA 3QMLA 3LDLA 3ATUA 1CN2A 1NGJA 1NGAA 1WMTA 2ATBA 2QWNA 3JXUA 1NGFA 3FZLA 5BPLA 3HSCA 3KOXA 3LDQA 5AQLA 1LQHA 3E7RL 4KBOA 4HWIA 5FPNA 3GKUA 1BMRA 1GPSA 3ATVA 3A8YA 4V1DC 1I6FA 2E0HA 2LN8A 2E88A 5AQPA 2KBJA 1ZVEA 2N69A 1C56A 1T7EA 2QWPA 4KYPA 1HPMA 1KAZA 1NPIA 4H5NA 3FZKA 5FPMA 5AQHA 1CHZA 2KBHA 1I6GA 1PE4A 2MN5A 5AQUA 5KK4A 1VNBA 1LQQA 1MR4A 2QW9A 3FZFA 1XRSB 5CY0A 1B3CA 1JZBA 1ZVGA 3R2VA 5AQXA 2GL1A 2YIOA 2QWQA 3C7NA 2LT8A 3GDQA 4AEIA 5AQJA 1BRZA 3KOZA 1POIA 5AQFA 2D56A 2KHOA 1QQNA 4H5VA 1HX1A 4UJ0A 2M8BB 1KAXA 3D2EB 1K8BA 1B7DA 2KGQA 3E7UX 5EX5A 1AHOA 3GL1A 4HHFA 5AQSA 4H5RA 5EXWA 1BUPA 3LDOA 3FE1A 3PSMA 4H5TA 5AQMA 1ZU3A 1QQMA 5AQIA 5AQRA 1BA1A 4H5WA 5AR0A 4AB0A 1NRBA 1ATSA 1NGBA 5BN9A 4HE7A 3BK3C 2VY6A 1S3XA 5AQYA 1NE5A 2KBKA 3QFPA 1TI5A 2NY8X 5F1XA 1NGIA 4UADE 2YBRC 4AAZA 1NGDA 1I2VA 2MBKA 2QWRA 2QWMA 5FPEA 2KJAA 1MYNA 1JKZA 2A7TA 2LY6A 1L4VA 1PTXA 3KP1A 1NH5A 1P0AA 1SN4A 1WWNA 3CQXA 3D2FA 5BN8A 2YEOA 1C55A 1AYJA 3FZMA 3QFUA 1ZYVA 5AQTA 2LI7A 1N4NA 1JZAA 2BRZA 5AQVA 3SF4D 2KYQA 2YILA 1I2UA 1DQ7A 5AQOA 2E3FA 3C7NB 2N2QA 2K35A 1NGCA 2G2KA 3KOYA 3L6QA 1JXCA 1KV0A 2NY9X 4FSVA 2LJMA 1ICAA 1BA0A 5AQGA 2BUPA 2V7ZA 5AQWA 5BPMA 1P00A 1HJOA 1BCGA 2B3CA 1T7AA 5EY4A 2E3GA 2KPYA
chains in the Genus database with same CATH topology
1T7BA 2N2RA 1T1TA 2LJ7A 2LY5A 2YC1C 2ASCA 1WT7A 1T0ZA 1PX9A 2B68A 1SEGA 2KSKA 1NRAA 1VNAA 2N66A 2I61A 1FH3A 1OMYA 1SN1A 2SN3A 2LR3A 1GPTA 1SNBA 4CQKA 1ZUTA 1DJTA 1ZFUA 2LKBA 1OZZA 1LQIA 1ZYWA 2MZ0A 1BK8A 1CN2A 1WMTA 2ATBA 1LQHA 3E7RL 1GPSA 1BMRA 4V1DC 1I6FA 2E0HA 2KBJA 1ZVEA 2N69A 1C56A 1T7EA 4KYPA 1NPIA 1CHZA 2KBHA 1I6GA 1PE4A 5KK4A 1VNBA 1LQQA 1MR4A 5CY0A 1B3CA 1JZBA 1ZVGA 2GL1A 4AEIA 2LT8A 1BRZA 4UJ0A 2M8BB 1B7DA 2KGQA 3E7UX 1AHOA 4HHFA 3PSMA 1ZU3A 4AB0A 1NRBA 4HE7A 1NE5A 2KBKA 1TI5A 2NY8X 2YBRC 4AAZA 1I2VA 1JKZA 2KJAA 1MYNA 2A7TA 2LY6A 1L4VA 1PTXA 1NH5A 1P0AA 1SN4A 1WWNA 2YEOA 1C55A 1AYJA 1ZYVA 2LI7A 1N4NA 1JZAA 2BRZA 2KYQA 1I2UA 1DQ7A 2E3FA 2N2QA 1JXCA 1KV0A 2NY9X 2LJMA 1ICAA 1P00A 2B3CA 1BCGA 1T7AA 2E3GA 2KPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7B A;  2N2R A;  1T1T A;  2LJ7 A;  2LY5 A;  2YC1 C;  2ASC A;  1WT7 A;  1T0Z A;  1PX9 A;  2B68 A;  1SEG A;  2KSK A;  1NRA A;  1VNA A;  2N66 A;  2I61 A;  1FH3 A;  1OMY A;  1SN1 A;  2SN3 A;  2LR3 A;  1GPT A;  1SNB A;  4CQK A;  1ZUT A;  1DJT A;  1ZFU A;  2LKB A;  1OZZ A;  1LQI A;  1ZYW A;  2MZ0 A;  1BK8 A;  1CN2 A;  1WMT A;  2ATB A;  1LQH A;  3E7R L;  1GPS A;  1BMR A;  4V1D C;  1I6F A;  2E0H A;  2KBJ A;  1ZVE A;  2N69 A;  1C56 A;  1T7E A;  4KYP A;  1NPI A;  1CHZ A;  2KBH A;  1I6G A;  1PE4 A;  5KK4 A;  1VNB A;  1LQQ A;  1MR4 A;  5CY0 A;  1B3C A;  1JZB A;  1ZVG A;  2GL1 A;  4AEI A;  2LT8 A;  1BRZ A;  4UJ0 A;  2M8B B;  1B7D A;  2KGQ A;  3E7U X;  1AHO A;  4HHF A;  3PSM A;  1ZU3 A;  4AB0 A;  1NRB A;  4HE7 A;  1NE5 A;  2KBK A;  1TI5 A;  2NY8 X;  2YBR C;  4AAZ A;  1I2V A;  1JKZ A;  2KJA A;  1MYN A;  2A7T A;  2LY6 A;  1L4V A;  1PTX A;  1NH5 A;  1P0A A;  1SN4 A;  1WWN A;  2YEO A;  1C55 A;  1AYJ A;  1ZYV A;  2LI7 A;  1N4N A;  1JZA A;  2BRZ A;  2KYQ A;  1I2U A;  1DQ7 A;  2E3F A;  2N2Q A;  1JXC A;  1KV0 A;  2NY9 X;  2LJM A;  1ICA A;  1P00 A;  2B3C A;  1BCG A;  1T7A A;  2E3G A;  2KPY A; 
#chains in the Genus database with same CATH topology
 1T7B A;  2N2R A;  3CW4 A;  1T1T A;  1NGH A;  2QWL A;  3L56 A;  2GMO A;  3AY9 A;  4FL9 A;  3KP0 A;  2LJ7 A;  1KAY A;  2LY5 A;  2YC1 C;  3KHW A;  2ASC A;  1NGE A;  5AQN A;  1UGL A;  1WT7 A;  5F2R A;  4UAF E;  1T0Z A;  5AQQ A;  1PX9 A;  2QXL A;  2B68 A;  3FZH A;  3KC6 A;  4UAE F;  1SEG A;  5AQZ A;  3KOW A;  1QQO A;  1YUW A;  2KSK A;  1NRA A;  1VNA A;  2N66 A;  2YIP A;  3D2E A;  2I61 A;  5AQK A;  1FH3 A;  5BPN A;  3KVG A;  2JDQ D;  1OMY A;  1SN1 A;  2SN3 A;  2LR3 A;  3L4I A;  1GPT A;  1SNB A;  2E2F A;  2E8A A;  4CQK A;  1ZUT A;  1DJT A;  3D2F B;  3IUC A;  3LDP A;  1NGG A;  3I33 A;  5FPD A;  1ZFU A;  3QI7 A;  2LKB A;  1OZZ A;  3M3Z A;  3LDN A;  1LQI A;  1DKG D;  2QWO A;  1ZYW A;  4GNI A;  4IO8 A;  5EVZ A;  1ATR A;  2MZ0 A;  1BK8 A;  5F0X A;  3QML A;  3LDL A;  3ATU A;  1CN2 A;  1NGJ A;  1NGA A;  1WMT A;  2ATB A;  2QWN A;  3JXU A;  1NGF A;  3FZL A;  5BPL A;  3HSC A;  3KOX A;  3LDQ A;  5AQL A;  1LQH A;  3E7R L;  4KBO A;  4HWI A;  5FPN A;  3GKU A;  1BMR A;  1GPS A;  3ATV A;  3A8Y A;  4V1D C;  1I6F A;  2E0H A;  2LN8 A;  2E88 A;  5AQP A;  2KBJ A;  1ZVE A;  2N69 A;  1C56 A;  1T7E A;  2QWP A;  4KYP A;  1HPM A;  1KAZ A;  1NPI A;  4H5N A;  3FZK A;  5FPM A;  5AQH A;  1CHZ A;  2KBH A;  1I6G A;  1PE4 A;  2MN5 A;  5AQU A;  5KK4 A;  1VNB A;  1LQQ A;  1MR4 A;  2QW9 A;  3FZF A;  1XRS B;  5CY0 A;  1B3C A;  1JZB A;  1ZVG A;  3R2V A;  5AQX A;  2GL1 A;  2YIO A;  2QWQ A;  3C7N A;  2LT8 A;  3GDQ A;  4AEI A;  5AQJ A;  1BRZ A;  3KOZ A;  1POI A;  5AQF A;  2D56 A;  2KHO A;  1QQN A;  4H5V A;  1HX1 A;  4UJ0 A;  2M8B B;  1KAX A;  3D2E B;  1K8B A;  1B7D A;  2KGQ A;  3E7U X;  5EX5 A;  1AHO A;  3GL1 A;  4HHF A;  5AQS A;  4H5R A;  5EXW A;  1BUP A;  3LDO A;  3FE1 A;  3PSM A;  4H5T A;  5AQM A;  1ZU3 A;  1QQM A;  5AQI A;  5AQR A;  1BA1 A;  4H5W A;  5AR0 A;  4AB0 A;  1NRB A;  1ATS A;  1NGB A;  5BN9 A;  4HE7 A;  3BK3 C;  2VY6 A;  1S3X A;  5AQY A;  1NE5 A;  2KBK A;  3QFP A;  1TI5 A;  2NY8 X;  5F1X A;  1NGI A;  4UAD E;  2YBR C;  4AAZ A;  1NGD A;  1I2V A;  2MBK A;  2QWR A;  2QWM A;  5FPE A;  2KJA A;  1MYN A;  1JKZ A;  2A7T A;  2LY6 A;  1L4V A;  1PTX A;  3KP1 A;  1NH5 A;  1P0A A;  1SN4 A;  1WWN A;  3CQX A;  3D2F A;  5BN8 A;  2YEO A;  1C55 A;  1AYJ A;  3FZM A;  3QFU A;  1ZYV A;  5AQT A;  2LI7 A;  1N4N A;  1JZA A;  2BRZ A;  5AQV A;  3SF4 D;  2KYQ A;  2YIL A;  1I2U A;  1DQ7 A;  5AQO A;  2E3F A;  3C7N B;  2N2Q A;  2K35 A;  1NGC A;  2G2K A;  3KOY A;  3L6Q A;  1JXC A;  1KV0 A;  2NY9 X;  4FSV A;  2LJM A;  1ICA A;  1BA0 A;  5AQG A;  2BUP A;  2V7Z A;  5AQW A;  5BPM A;  1P00 A;  1HJO A;  1BCG A;  2B3C A;  1T7A A;  5EY4 A;  2E3G A;  2KPY A; 
#chains in the Genus database with same CATH homology
 1T7B A;  2N2R A;  1T1T A;  2LJ7 A;  2LY5 A;  2YC1 C;  2ASC A;  1WT7 A;  1T0Z A;  1PX9 A;  2B68 A;  1SEG A;  2KSK A;  1NRA A;  1VNA A;  2N66 A;  2I61 A;  1FH3 A;  1OMY A;  1SN1 A;  2SN3 A;  2LR3 A;  1GPT A;  1SNB A;  4CQK A;  1ZUT A;  1DJT A;  1ZFU A;  2LKB A;  1OZZ A;  1LQI A;  1ZYW A;  2MZ0 A;  1BK8 A;  1CN2 A;  1WMT A;  2ATB A;  1LQH A;  3E7R L;  1GPS A;  1BMR A;  4V1D C;  1I6F A;  2E0H A;  2KBJ A;  1ZVE A;  2N69 A;  1C56 A;  1T7E A;  4KYP A;  1NPI A;  1CHZ A;  2KBH A;  1I6G A;  1PE4 A;  5KK4 A;  1VNB A;  1LQQ A;  1MR4 A;  5CY0 A;  1B3C A;  1JZB A;  1ZVG A;  2GL1 A;  4AEI A;  2LT8 A;  1BRZ A;  4UJ0 A;  2M8B B;  1B7D A;  2KGQ A;  3E7U X;  1AHO A;  4HHF A;  3PSM A;  1ZU3 A;  4AB0 A;  1NRB A;  4HE7 A;  1NE5 A;  2KBK A;  1TI5 A;  2NY8 X;  2YBR C;  4AAZ A;  1I2V A;  1JKZ A;  2KJA A;  1MYN A;  2A7T A;  2LY6 A;  1L4V A;  1PTX A;  1NH5 A;  1P0A A;  1SN4 A;  1WWN A;  2YEO A;  1C55 A;  1AYJ A;  1ZYV A;  2LI7 A;  1N4N A;  1JZA A;  2BRZ A;  2KYQ A;  1I2U A;  1DQ7 A;  2E3F A;  2N2Q A;  1JXC A;  1KV0 A;  2NY9 X;  2LJM A;  1ICA A;  1P00 A;  2B3C A;  1BCG A;  1T7A A;  2E3G A;  2KPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...