2K35A

Hydramacin-1: structure and antibacterial activity of a peptide from the basal metazoan hydra
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
60
structure length
60
Chain Sequence
QIVDCWETWSRCTKWSQGGTGTLWKSCNDRCKELGRKRGQCEEKPSRCPLSKKAWTCICY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hydramacin-1
publication title Hydramacin-1, structure and antibacterial activity of a protein from the Basal metazoan hydra.
pubmed doi rcsb
source organism Hydra
molecule tags Antimicrobial protein
total genus 21
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14865 Macin Macin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.100 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2k35A00
2LN8A 2K35A
chains in the Genus database with same CATH superfamily
1NGJA 1OZZA 1K8BA 3E7UX 2ASCA 2VY6A 3L6QA 2E2FA 1AYJA 2LJ7A 1JZAA 3AY9A 2YILA 2QWNA 1QQMA 3FE1A 5EXWA 2E3GA 1NGFA 4HE7A 2QXLA 5AQXA 2QWQA 3QFPA 1NGDA 5BPLA 3M3ZA 3C7NA 3L56A 3SF4D 1NH5A 1MR4A 2LR3A 1BRZA 3LDPA 3ATVA 3KOXA 2SN3A 3QI7A 4KYPA 2A7TA 2YC1C 3CW4A 5AQNA 1ZYVA 2KBJA 4H5VA 5AQVA 3R2VA 1ZVGA 1BCGA 1NGAA 5AQFA 2YBRC 2YIPA 1YUWA 1SEGA 2D56A 3CQXA 1NGCA 3KOWA 5F0XA 1ZFUA 1AHOA 1HPMA 1ZVEA 1ZUTA 3FZHA 5AQOA 3GDQA 1T0ZA 3D2EA 5AQKA 1GPTA 2QW9A 1ICAA 2E3FA 1NE5A 3C7NB 3PSMA 2GMOA 1WWNA 5AQYA 3GL1A 2LT8A 1DKGD 2QWMA 1POIA 1LQHA 2YEOA 3LDNA 1NGGA 5AQTA 1DQ7A 1HX1A 2QWLA 2LN8A 3HSCA 4H5RA 1PX9A 2MZ0A 5AQLA 1I6GA 2MN5A 2G2KA 3KHWA 5AQIA 1I2UA 2E0HA 1T1TA 3LDLA 3LDQA 2B68A 5BPNA 2LKBA 3KVGA 2KJAA 5F2RA 1BK8A 5AQZA 3A8YA 3D2EB 2QWRA 3L4IA 1BA0A 5EY4A 1L4VA 1C55A 1CN2A 1KAYA 3KP0A 1B3CA 4HWIA 1NRAA 2E8AA 4H5TA 4UAFE 5KK4A 1P00A 2KBHA 1TI5A 1OMYA 1XRSB 2KHOA 5AQGA 1UGLA 5AQQA 5FPDA 4H5NA 2B3CA 3KC6A 2KGQA 4H5WA 3ATUA 1NRBA 2KPYA 1WMTA 1LQIA 1ZU3A 2N2RA 3D2FA 1ATRA 1FH3A 1VNBA 2YIOA 3JXUA 5AR0A 1N4NA 3FZMA 2MBKA 2NY8X 3FZFA 4IO8A 5AQPA 1ATSA 4AEIA 1BMRA 2N2QA 4UJ0A 1BA1A 2KBKA 1ZYWA 3QFUA 5BN8A 1VNAA 5FPEA 2I61A 2LJMA 1CHZA 2N69A 3KOZA 4KBOA 5AQJA 5EX5A 1C56A 1NGBA 3FZLA 2JDQD 3KP1A 5AQMA 1DJTA 5FPNA 3GKUA 2QWOA 2NY9X 3I33A 1JZBA 3BK3C 1HJOA 1QQOA 4FSVA 1JXCA 3D2FB 5F1XA 1LQQA 1KAXA 5FPMA 4AAZA 1WT7A 3IUCA 2GL1A 2KSKA 1GPSA 1NGEA 1I2VA 1NGIA 1SN1A 1T7AA 4UAEF 2KYQA 2BRZA 5AQUA 4GNIA 5EVZA 3KOYA 2N66A 4V1DC 5AQRA 4UADE 5BN9A 1QQNA 2V7ZA 5AQSA 1SN4A 2BUPA 4HHFA 2LI7A 2M8BB 1KAZA 1NGHA 5AQHA 2LY5A 2QWPA 1JKZA 2LY6A 4CQKA 5AQWA 1S3XA 2ATBA 4AB0A 1B7DA 5CY0A 1PTXA 4FL9A 1MYNA 1P0AA 1NPIA 1PE4A 3LDOA 3QMLA 1T7EA 3FZKA 1SNBA 1T7BA 5BPMA 1BUPA 1KV0A 1I6FA 3E7RL 2K35A 2E88A
chains in the Genus database with same CATH topology
1NGJA 2VY6A 3L6QA 2E2FA 3AY9A 2YILA 2QWNA 1QQMA 3FE1A 5EXWA 1NGFA 2QXLA 5AQXA 2QWQA 3QFPA 1NGDA 5BPLA 3M3ZA 3C7NA 3L56A 3SF4D 3LDPA 3ATVA 3QI7A 5AQNA 3CW4A 4H5VA 5AQVA 3R2VA 1NGAA 5AQFA 2YIPA 1YUWA 3CQXA 2D56A 5F0XA 1NGCA 1HPMA 3FZHA 5AQOA 3GDQA 3D2EA 5AQKA 2QW9A 3C7NB 2GMOA 5AQYA 3GL1A 2QWMA 1DKGD 1POIA 3LDNA 1NGGA 5AQTA 1HX1A 3HSCA 2LN8A 4H5RA 5AQLA 2MN5A 3KHWA 5AQIA 3LDLA 3LDQA 5BPNA 3KVGA 5F2RA 5AQZA 3A8YA 3D2EB 2QWRA 3L4IA 1BA0A 5EY4A 1KAYA 4HWIA 2E8AA 4H5TA 4UAFE 2KHOA 5AQGA 5AQQA 5FPDA 4H5NA 3KC6A 4H5WA 3ATUA 3D2FA 1ATRA 2YIOA 3JXUA 5AR0A 3FZMA 2MBKA 3FZFA 4IO8A 5AQPA 1ATSA 1BA1A 3QFUA 5BN8A 5FPEA 4KBOA 5AQJA 5EX5A 3FZLA 1NGBA 2JDQD 5AQMA 5FPNA 2QWOA 3I33A 3BK3C 1HJOA 1QQOA 4FSVA 3D2FB 5F1XA 1KAXA 5FPMA 3IUCA 1NGEA 1NGIA 4UAEF 5AQUA 4GNIA 5EVZA 5AQRA 5BN9A 4UADE 1QQNA 2V7ZA 5AQSA 2BUPA 1KAZA 1NGHA 5AQHA 2QWPA 5AQWA 1S3XA 4FL9A 3LDOA 3QMLA 3FZKA 5BPMA 1BUPA 2QWLA 2K35A 2E88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LN8 A;  2K35 A; 
#chains in the Genus database with same CATH topology
 1NGJ A;  1OZZ A;  1K8B A;  3E7U X;  2ASC A;  2VY6 A;  3L6Q A;  2E2F A;  1AYJ A;  2LJ7 A;  1JZA A;  3AY9 A;  2YIL A;  2QWN A;  1QQM A;  3FE1 A;  5EXW A;  2E3G A;  1NGF A;  4HE7 A;  2QXL A;  5AQX A;  2QWQ A;  3QFP A;  1NGD A;  5BPL A;  3M3Z A;  3C7N A;  3L56 A;  3SF4 D;  1NH5 A;  1MR4 A;  2LR3 A;  1BRZ A;  3LDP A;  3ATV A;  3KOX A;  2SN3 A;  3QI7 A;  4KYP A;  2A7T A;  2YC1 C;  3CW4 A;  5AQN A;  1ZYV A;  2KBJ A;  4H5V A;  5AQV A;  3R2V A;  1ZVG A;  1BCG A;  1NGA A;  5AQF A;  2YBR C;  2YIP A;  1YUW A;  1SEG A;  2D56 A;  3CQX A;  1NGC A;  3KOW A;  5F0X A;  1ZFU A;  1AHO A;  1HPM A;  1ZVE A;  1ZUT A;  3FZH A;  5AQO A;  3GDQ A;  1T0Z A;  3D2E A;  5AQK A;  1GPT A;  2QW9 A;  1ICA A;  2E3F A;  1NE5 A;  3C7N B;  3PSM A;  2GMO A;  1WWN A;  5AQY A;  3GL1 A;  2LT8 A;  1DKG D;  2QWM A;  1POI A;  1LQH A;  2YEO A;  3LDN A;  1NGG A;  5AQT A;  1DQ7 A;  1HX1 A;  2QWL A;  2LN8 A;  3HSC A;  4H5R A;  1PX9 A;  2MZ0 A;  5AQL A;  1I6G A;  2MN5 A;  2G2K A;  3KHW A;  5AQI A;  1I2U A;  2E0H A;  1T1T A;  3LDL A;  3LDQ A;  2B68 A;  5BPN A;  2LKB A;  3KVG A;  2KJA A;  5F2R A;  1BK8 A;  5AQZ A;  3A8Y A;  3D2E B;  2QWR A;  3L4I A;  1BA0 A;  5EY4 A;  1L4V A;  1C55 A;  1CN2 A;  1KAY A;  3KP0 A;  1B3C A;  4HWI A;  1NRA A;  2E8A A;  4H5T A;  4UAF E;  5KK4 A;  1P00 A;  2KBH A;  1TI5 A;  1OMY A;  1XRS B;  2KHO A;  5AQG A;  1UGL A;  5AQQ A;  5FPD A;  4H5N A;  2B3C A;  3KC6 A;  2KGQ A;  4H5W A;  3ATU A;  1NRB A;  2KPY A;  1WMT A;  1LQI A;  1ZU3 A;  2N2R A;  3D2F A;  1ATR A;  1FH3 A;  1VNB A;  2YIO A;  3JXU A;  5AR0 A;  1N4N A;  3FZM A;  2MBK A;  2NY8 X;  3FZF A;  4IO8 A;  5AQP A;  1ATS A;  4AEI A;  1BMR A;  2N2Q A;  4UJ0 A;  1BA1 A;  2KBK A;  1ZYW A;  3QFU A;  5BN8 A;  1VNA A;  5FPE A;  2I61 A;  2LJM A;  1CHZ A;  2N69 A;  3KOZ A;  4KBO A;  5AQJ A;  5EX5 A;  1C56 A;  1NGB A;  3FZL A;  2JDQ D;  3KP1 A;  5AQM A;  1DJT A;  5FPN A;  3GKU A;  2QWO A;  2NY9 X;  3I33 A;  1JZB A;  3BK3 C;  1HJO A;  1QQO A;  4FSV A;  1JXC A;  3D2F B;  5F1X A;  1LQQ A;  1KAX A;  5FPM A;  4AAZ A;  1WT7 A;  3IUC A;  2GL1 A;  2KSK A;  1GPS A;  1NGE A;  1I2V A;  1NGI A;  1SN1 A;  1T7A A;  4UAE F;  2KYQ A;  2BRZ A;  5AQU A;  4GNI A;  5EVZ A;  3KOY A;  2N66 A;  4V1D C;  5AQR A;  4UAD E;  5BN9 A;  1QQN A;  2V7Z A;  5AQS A;  1SN4 A;  2BUP A;  4HHF A;  2LI7 A;  2M8B B;  1KAZ A;  1NGH A;  5AQH A;  2LY5 A;  2QWP A;  1JKZ A;  2LY6 A;  4CQK A;  5AQW A;  1S3X A;  2ATB A;  4AB0 A;  1B7D A;  5CY0 A;  1PTX A;  4FL9 A;  1MYN A;  1P0A A;  1NPI A;  1PE4 A;  3LDO A;  3QML A;  1T7E A;  3FZK A;  1SNB A;  1T7B A;  5BPM A;  1BUP A;  1KV0 A;  1I6F A;  3E7R L;  2K35 A;  2E88 A; 
#chains in the Genus database with same CATH homology
 1NGJ A;  2VY6 A;  3L6Q A;  2E2F A;  3AY9 A;  2YIL A;  2QWN A;  1QQM A;  3FE1 A;  5EXW A;  1NGF A;  2QXL A;  5AQX A;  2QWQ A;  3QFP A;  1NGD A;  5BPL A;  3M3Z A;  3C7N A;  3L56 A;  3SF4 D;  3LDP A;  3ATV A;  3QI7 A;  5AQN A;  3CW4 A;  4H5V A;  5AQV A;  3R2V A;  1NGA A;  5AQF A;  2YIP A;  1YUW A;  3CQX A;  2D56 A;  5F0X A;  1NGC A;  1HPM A;  3FZH A;  5AQO A;  3GDQ A;  3D2E A;  5AQK A;  2QW9 A;  3C7N B;  2GMO A;  5AQY A;  3GL1 A;  2QWM A;  1DKG D;  1POI A;  3LDN A;  1NGG A;  5AQT A;  1HX1 A;  3HSC A;  2LN8 A;  4H5R A;  5AQL A;  2MN5 A;  3KHW A;  5AQI A;  3LDL A;  3LDQ A;  5BPN A;  3KVG A;  5F2R A;  5AQZ A;  3A8Y A;  3D2E B;  2QWR A;  3L4I A;  1BA0 A;  5EY4 A;  1KAY A;  4HWI A;  2E8A A;  4H5T A;  4UAF E;  2KHO A;  5AQG A;  5AQQ A;  5FPD A;  4H5N A;  3KC6 A;  4H5W A;  3ATU A;  3D2F A;  1ATR A;  2YIO A;  3JXU A;  5AR0 A;  3FZM A;  2MBK A;  3FZF A;  4IO8 A;  5AQP A;  1ATS A;  1BA1 A;  3QFU A;  5BN8 A;  5FPE A;  4KBO A;  5AQJ A;  5EX5 A;  3FZL A;  1NGB A;  2JDQ D;  5AQM A;  5FPN A;  2QWO A;  3I33 A;  3BK3 C;  1HJO A;  1QQO A;  4FSV A;  3D2F B;  5F1X A;  1KAX A;  5FPM A;  3IUC A;  1NGE A;  1NGI A;  4UAE F;  5AQU A;  4GNI A;  5EVZ A;  5AQR A;  5BN9 A;  4UAD E;  1QQN A;  2V7Z A;  5AQS A;  2BUP A;  1KAZ A;  1NGH A;  5AQH A;  2QWP A;  5AQW A;  1S3X A;  4FL9 A;  3LDO A;  3QML A;  3FZK A;  5BPM A;  1BUP A;  2QWL A;  2K35 A;  2E88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...