1AYJA

Determination of the three-dimensional solution structure of raphanus sativus antifungal protein 1 (rs-afp1) by 1h nmr, 20 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
51
structure length
51
Chain Sequence
b'EKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIFUNGAL PROTEIN 1
publication title Determination of the three-dimensional solution structure of Raphanus sativus antifungal protein 1 by 1H NMR.
pubmed doi rcsb
molecule tags Fungicide
total genus 17
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ayjA00
2ASCA 2KSKA 2KYQA 2B68A 1NPIA 1I2VA 3E7UX 1AHOA 2NY8X 1GPSA 2LY6A 1ZVGA 2KPYA 1ZUTA 2LT8A 1NRBA 1ZVEA 1JKZA 1T7BA 4V1DC 2N69A 2N2QA 2SN3A 3E7RL 1B7DA 4AB0A 1BK8A 3PSMA 2KGQA 1JXCA 1OMYA 1SN4A 1SNBA 1ZU3A 1I2UA 2LJ7A 4KYPA 1DQ7A 1T7AA 1TI5A 1PE4A 4AEIA 2E3GA 1SN1A 2I61A 1L4VA 4HE7A 2KBJA 1I6GA 1CHZA 1WT7A 2N2RA 4UJ0A 1C55A 1T1TA 1BCGA 1ZYVA 2ATBA 1MR4A 1CN2A 2KJAA 4AAZA 1NH5A 2BRZA 1AYJA 1OZZA 2LJMA 1FH3A 1P0AA 1MYNA 2LKBA 5CY0A 1KV0A 2YC1C 2A7TA 2M8BB 2KBKA 1N4NA 2YBRC 1T0ZA 2NY9X 1BMRA 1SEGA 1P00A 1B3CA 2LY5A 1T7EA 2E3FA 2LI7A 2LR3A 1LQIA 1NE5A 4HHFA 1WMTA 1ZFUA 2MZ0A 1VNAA 5KK4A 1NRAA 2GL1A 2KBHA 1LQHA 1WWNA 1BRZA 1VNBA 2YEOA 1ZYWA 1GPTA 2N66A 1C56A 1PTXA 1JZBA 4CQKA 1ICAA 1DJTA 1LQQA 1I6FA 2B3CA 2E0HA 1JZAA 1PX9A
chains in the Genus database with same CATH superfamily
3JXUA 2ASCA 2KSKA 5AQHA 1BA1A 1QQMA 4UAFE 2KYQA 2B68A 3LDOA 5AQQA 1NPIA 5AQXA 3D2FA 1I2VA 5BN9A 3KVGA 5BPMA 1NGFA 4H5RA 3FZMA 4UAEF 3KHWA 4FSVA 5AQSA 5FPMA 5AQIA 2E8AA 3E7UX 3KP1A 1AHOA 2QWMA 2KHOA 2NY8X 2G2KA 3QFUA 1GPSA 4FL9A 2LY6A 1ZVGA 2KPYA 1ZUTA 3KC6A 2LT8A 5AQPA 1NRBA 5AQNA 1ZVEA 5AQFA 1NGJA 1JKZA 1T7BA 4V1DC 2N69A 2N2QA 2SN3A 1NGAA 2QWNA 3E7RL 3GKUA 1B7DA 4AB0A 5AQTA 3FZKA 4HWIA 2E88A 1BK8A 1NGGA 3PSMA 1NGDA 2KGQA 1JXCA 2MBKA 3GDQA 3D2FB 1OMYA 1SN4A 3HSCA 3FZHA 1SNBA 1ZU3A 2MN5A 1HJOA 1I2UA 2LJ7A 4KYPA 1DQ7A 1T7AA 3AY9A 1TI5A 2QXLA 3I33A 4H5NA 1PE4A 3QFPA 2GMOA 1ATSA 1S3XA 2QWLA 2QWRA 3FE1A 4AEIA 2E3GA 1SN1A 2I61A 3LDQA 1UGLA 1L4VA 2LN8A 4HE7A 5EX5A 2KBJA 2QWQA 5AQGA 3FZLA 1I6GA 5F2RA 5AQOA 1CHZA 3R2VA 5BPNA 4IO8A 2QW9A 3IUCA 5AQZA 1WT7A 2N2RA 2YILA 4H5VA 4H5WA 1KAZA 5AQMA 1BA0A 3KOXA 5AQRA 4UJ0A 3L56A 5AQJA 1C55A 1T1TA 3GL1A 1NGBA 3QMLA 2VY6A 1BCGA 5AQKA 5BPLA 1XRSB 2QWOA 1ZYVA 5EXWA 2ATBA 1MR4A 1NGHA 3C7NA 2KJAA 3KP0A 1CN2A 1POIA 4AAZA 1K8BA 1NH5A 2BRZA 1AYJA 3LDNA 1OZZA 2LJMA 5FPNA 3ATVA 1HPMA 1FH3A 1P0AA 2K35A 1MYNA 1HX1A 2LKBA 5CY0A 1KV0A 1NGIA 3L4IA 2YC1C 4KBOA 2A7TA 2E2FA 3L6QA 1NGCA 5FPEA 5F1XA 2M8BB 3KOZA 2KBKA 1N4NA 2YBRC 3CQXA 3D2EA 1T0ZA 2NY9X 5AQUA 1BMRA 3KOYA 1SEGA 1DKGD 1P00A 1B3CA 2LY5A 5AQLA 3ATUA 1T7EA 1KAXA 2E3FA 2YIOA 2LI7A 2LR3A 1LQIA 1NE5A 4HHFA 1ATRA 3C7NB 5AQWA 1WMTA 1ZFUA 2MZ0A 1VNAA 3BK3C 5KK4A 1NRAA 1BRZA 3LDLA 1KAYA 2JDQD 1QQNA 1QQOA 3CW4A 5AR0A 2GL1A 1BUPA 2KBHA 1LQHA 4GNIA 1WWNA 5FPDA 1VNBA 5AQYA 1YUWA 2YEOA 2BUPA 1ZYWA 3A8YA 3FZFA 2QWPA 3QI7A 5F0XA 1NGEA 4H5TA 5EY4A 1GPTA 3KOWA 2N66A 5AQVA 1C56A 1PTXA 3D2EB 3SF4D 2V7ZA 1JZBA 3M3ZA 4CQKA 5BN8A 3LDPA 1ICAA 2D56A 1DJTA 5EVZA 1LQQA 1I6FA 4UADE 2B3CA 2E0HA 2YIPA 1JZAA 1PX9A
chains in the Genus database with same CATH topology
2ASCA 2KSKA 2KYQA 2B68A 1NPIA 1I2VA 3E7UX 1AHOA 2NY8X 1GPSA 2LY6A 1ZVGA 2KPYA 1ZUTA 2LT8A 1NRBA 1ZVEA 1JKZA 1T7BA 4V1DC 2N69A 2N2QA 2SN3A 3E7RL 1B7DA 4AB0A 1BK8A 3PSMA 2KGQA 1JXCA 1OMYA 1SN4A 1SNBA 1ZU3A 1I2UA 2LJ7A 4KYPA 1DQ7A 1T7AA 1TI5A 1PE4A 4AEIA 2E3GA 1SN1A 2I61A 1L4VA 4HE7A 2KBJA 1I6GA 1CHZA 1WT7A 2N2RA 4UJ0A 1C55A 1T1TA 1BCGA 1ZYVA 2ATBA 1MR4A 1CN2A 2KJAA 4AAZA 1NH5A 2BRZA 1AYJA 1OZZA 2LJMA 1FH3A 1P0AA 1MYNA 2LKBA 5CY0A 1KV0A 2YC1C 2A7TA 2M8BB 2KBKA 1N4NA 2YBRC 1T0ZA 2NY9X 1BMRA 1SEGA 1P00A 1B3CA 2LY5A 1T7EA 2E3FA 2LI7A 2LR3A 1LQIA 1NE5A 4HHFA 1WMTA 1ZFUA 2MZ0A 1VNAA 5KK4A 1NRAA 2GL1A 2KBHA 1LQHA 1WWNA 1BRZA 1VNBA 2YEOA 1ZYWA 1GPTA 2N66A 1C56A 1PTXA 1JZBA 4CQKA 1ICAA 1DJTA 1LQQA 1I6FA 2B3CA 2E0HA 1JZAA 1PX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ASC A;  2KSK A;  2KYQ A;  2B68 A;  1NPI A;  1I2V A;  3E7U X;  1AHO A;  2NY8 X;  1GPS A;  2LY6 A;  1ZVG A;  2KPY A;  1ZUT A;  2LT8 A;  1NRB A;  1ZVE A;  1JKZ A;  1T7B A;  4V1D C;  2N69 A;  2N2Q A;  2SN3 A;  3E7R L;  1B7D A;  4AB0 A;  1BK8 A;  3PSM A;  2KGQ A;  1JXC A;  1OMY A;  1SN4 A;  1SNB A;  1ZU3 A;  1I2U A;  2LJ7 A;  4KYP A;  1DQ7 A;  1T7A A;  1TI5 A;  1PE4 A;  4AEI A;  2E3G A;  1SN1 A;  2I61 A;  1L4V A;  4HE7 A;  2KBJ A;  1I6G A;  1CHZ A;  1WT7 A;  2N2R A;  4UJ0 A;  1C55 A;  1T1T A;  1BCG A;  1ZYV A;  2ATB A;  1MR4 A;  1CN2 A;  2KJA A;  4AAZ A;  1NH5 A;  2BRZ A;  1AYJ A;  1OZZ A;  2LJM A;  1FH3 A;  1P0A A;  1MYN A;  2LKB A;  5CY0 A;  1KV0 A;  2YC1 C;  2A7T A;  2M8B B;  2KBK A;  1N4N A;  2YBR C;  1T0Z A;  2NY9 X;  1BMR A;  1SEG A;  1P00 A;  1B3C A;  2LY5 A;  1T7E A;  2E3F A;  2LI7 A;  2LR3 A;  1LQI A;  1NE5 A;  4HHF A;  1WMT A;  1ZFU A;  2MZ0 A;  1VNA A;  5KK4 A;  1NRA A;  2GL1 A;  2KBH A;  1LQH A;  1WWN A;  1BRZ A;  1VNB A;  2YEO A;  1ZYW A;  1GPT A;  2N66 A;  1C56 A;  1PTX A;  1JZB A;  4CQK A;  1ICA A;  1DJT A;  1LQQ A;  1I6F A;  2B3C A;  2E0H A;  1JZA A;  1PX9 A; 
#chains in the Genus database with same CATH topology
 3JXU A;  2ASC A;  2KSK A;  5AQH A;  1BA1 A;  1QQM A;  4UAF E;  2KYQ A;  2B68 A;  3LDO A;  5AQQ A;  1NPI A;  5AQX A;  3D2F A;  1I2V A;  5BN9 A;  3KVG A;  5BPM A;  1NGF A;  4H5R A;  3FZM A;  4UAE F;  3KHW A;  4FSV A;  5AQS A;  5FPM A;  5AQI A;  2E8A A;  3E7U X;  3KP1 A;  1AHO A;  2QWM A;  2KHO A;  2NY8 X;  2G2K A;  3QFU A;  1GPS A;  4FL9 A;  2LY6 A;  1ZVG A;  2KPY A;  1ZUT A;  3KC6 A;  2LT8 A;  5AQP A;  1NRB A;  5AQN A;  1ZVE A;  5AQF A;  1NGJ A;  1JKZ A;  1T7B A;  4V1D C;  2N69 A;  2N2Q A;  2SN3 A;  1NGA A;  2QWN A;  3E7R L;  3GKU A;  1B7D A;  4AB0 A;  5AQT A;  3FZK A;  4HWI A;  2E88 A;  1BK8 A;  1NGG A;  3PSM A;  1NGD A;  2KGQ A;  1JXC A;  2MBK A;  3GDQ A;  3D2F B;  1OMY A;  1SN4 A;  3HSC A;  3FZH A;  1SNB A;  1ZU3 A;  2MN5 A;  1HJO A;  1I2U A;  2LJ7 A;  4KYP A;  1DQ7 A;  1T7A A;  3AY9 A;  1TI5 A;  2QXL A;  3I33 A;  4H5N A;  1PE4 A;  3QFP A;  2GMO A;  1ATS A;  1S3X A;  2QWL A;  2QWR A;  3FE1 A;  4AEI A;  2E3G A;  1SN1 A;  2I61 A;  3LDQ A;  1UGL A;  1L4V A;  2LN8 A;  4HE7 A;  5EX5 A;  2KBJ A;  2QWQ A;  5AQG A;  3FZL A;  1I6G A;  5F2R A;  5AQO A;  1CHZ A;  3R2V A;  5BPN A;  4IO8 A;  2QW9 A;  3IUC A;  5AQZ A;  1WT7 A;  2N2R A;  2YIL A;  4H5V A;  4H5W A;  1KAZ A;  5AQM A;  1BA0 A;  3KOX A;  5AQR A;  4UJ0 A;  3L56 A;  5AQJ A;  1C55 A;  1T1T A;  3GL1 A;  1NGB A;  3QML A;  2VY6 A;  1BCG A;  5AQK A;  5BPL A;  1XRS B;  2QWO A;  1ZYV A;  5EXW A;  2ATB A;  1MR4 A;  1NGH A;  3C7N A;  2KJA A;  3KP0 A;  1CN2 A;  1POI A;  4AAZ A;  1K8B A;  1NH5 A;  2BRZ A;  1AYJ A;  3LDN A;  1OZZ A;  2LJM A;  5FPN A;  3ATV A;  1HPM A;  1FH3 A;  1P0A A;  2K35 A;  1MYN A;  1HX1 A;  2LKB A;  5CY0 A;  1KV0 A;  1NGI A;  3L4I A;  2YC1 C;  4KBO A;  2A7T A;  2E2F A;  3L6Q A;  1NGC A;  5FPE A;  5F1X A;  2M8B B;  3KOZ A;  2KBK A;  1N4N A;  2YBR C;  3CQX A;  3D2E A;  1T0Z A;  2NY9 X;  5AQU A;  1BMR A;  3KOY A;  1SEG A;  1DKG D;  1P00 A;  1B3C A;  2LY5 A;  5AQL A;  3ATU A;  1T7E A;  1KAX A;  2E3F A;  2YIO A;  2LI7 A;  2LR3 A;  1LQI A;  1NE5 A;  4HHF A;  1ATR A;  3C7N B;  5AQW A;  1WMT A;  1ZFU A;  2MZ0 A;  1VNA A;  3BK3 C;  5KK4 A;  1NRA A;  1BRZ A;  3LDL A;  1KAY A;  2JDQ D;  1QQN A;  1QQO A;  3CW4 A;  5AR0 A;  2GL1 A;  1BUP A;  2KBH A;  1LQH A;  4GNI A;  1WWN A;  5FPD A;  1VNB A;  5AQY A;  1YUW A;  2YEO A;  2BUP A;  1ZYW A;  3A8Y A;  3FZF A;  2QWP A;  3QI7 A;  5F0X A;  1NGE A;  4H5T A;  5EY4 A;  1GPT A;  3KOW A;  2N66 A;  5AQV A;  1C56 A;  1PTX A;  3D2E B;  3SF4 D;  2V7Z A;  1JZB A;  3M3Z A;  4CQK A;  5BN8 A;  3LDP A;  1ICA A;  2D56 A;  1DJT A;  5EVZ A;  1LQQ A;  1I6F A;  4UAD E;  2B3C A;  2E0H A;  2YIP A;  1JZA A;  1PX9 A; 
#chains in the Genus database with same CATH homology
 2ASC A;  2KSK A;  2KYQ A;  2B68 A;  1NPI A;  1I2V A;  3E7U X;  1AHO A;  2NY8 X;  1GPS A;  2LY6 A;  1ZVG A;  2KPY A;  1ZUT A;  2LT8 A;  1NRB A;  1ZVE A;  1JKZ A;  1T7B A;  4V1D C;  2N69 A;  2N2Q A;  2SN3 A;  3E7R L;  1B7D A;  4AB0 A;  1BK8 A;  3PSM A;  2KGQ A;  1JXC A;  1OMY A;  1SN4 A;  1SNB A;  1ZU3 A;  1I2U A;  2LJ7 A;  4KYP A;  1DQ7 A;  1T7A A;  1TI5 A;  1PE4 A;  4AEI A;  2E3G A;  1SN1 A;  2I61 A;  1L4V A;  4HE7 A;  2KBJ A;  1I6G A;  1CHZ A;  1WT7 A;  2N2R A;  4UJ0 A;  1C55 A;  1T1T A;  1BCG A;  1ZYV A;  2ATB A;  1MR4 A;  1CN2 A;  2KJA A;  4AAZ A;  1NH5 A;  2BRZ A;  1AYJ A;  1OZZ A;  2LJM A;  1FH3 A;  1P0A A;  1MYN A;  2LKB A;  5CY0 A;  1KV0 A;  2YC1 C;  2A7T A;  2M8B B;  2KBK A;  1N4N A;  2YBR C;  1T0Z A;  2NY9 X;  1BMR A;  1SEG A;  1P00 A;  1B3C A;  2LY5 A;  1T7E A;  2E3F A;  2LI7 A;  2LR3 A;  1LQI A;  1NE5 A;  4HHF A;  1WMT A;  1ZFU A;  2MZ0 A;  1VNA A;  5KK4 A;  1NRA A;  2GL1 A;  2KBH A;  1LQH A;  1WWN A;  1BRZ A;  1VNB A;  2YEO A;  1ZYW A;  1GPT A;  2N66 A;  1C56 A;  1PTX A;  1JZB A;  4CQK A;  1ICA A;  1DJT A;  1LQQ A;  1I6F A;  2B3C A;  2E0H A;  1JZA A;  1PX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...