1AYJA

Determination of the three-dimensional solution structure of raphanus sativus antifungal protein 1 (rs-afp1) by 1h nmr, 20 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
51
structure length
51
Chain Sequence
EKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIFUNGAL PROTEIN 1
publication title Determination of the three-dimensional solution structure of Raphanus sativus antifungal protein 1 by 1H NMR.
pubmed doi rcsb
molecule tags Fungicide
total genus 17
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ayjA00
5CY0A 2E3FA 1P00A 4V1DC 2N2QA 2LJMA 1AHOA 1ZUTA 1VNAA 1SNBA 1ZVGA 2A7TA 1I6GA 1C55A 1PX9A 2N66A 1I2VA 4HHFA 4AB0A 2SN3A 1ICAA 1ZFUA 1ZU3A 1T0ZA 1T7EA 1BMRA 1NPIA 2KBHA 2KSKA 1ZYVA 3PSMA 1N4NA 1LQIA 1CN2A 1LQHA 2NY9X 2LT8A 1LQQA 2KYQA 2YEOA 1JXCA 1GPTA 4AAZA 1I2UA 1FH3A 1P0AA 2LKBA 1JKZA 2KPYA 2KJAA 1C56A 1B7DA 2B68A 2ASCA 1B3CA 1CHZA 2LJ7A 2ATBA 1L4VA 1TI5A 1ZYWA 2LI7A 1PTXA 1T7AA 1NRBA 1SN4A 1NE5A 1BCGA 1OZZA 5KK4A 1OMYA 2LY6A 2E0HA 2N69A 3E7RL 1NH5A 1T7BA 1DJTA 1GPSA 4HE7A 1BK8A 1SEGA 2B3CA 1DQ7A 1PE4A 2YC1C 2I61A 2LY5A 1WWNA 1SN1A 4KYPA 1WT7A 1MYNA 4CQKA 2GL1A 2KGQA 4UJ0A 1ZVEA 2BRZA 2NY8X 2KBJA 1VNBA 1MR4A 2LR3A 1WMTA 2E3GA 4AEIA 1T1TA 2MZ0A 1AYJA 2KBKA 1BRZA 1I6FA 2N2RA 3E7UX 2YBRC 1JZAA 1NRAA 1JZBA 1KV0A 2M8BB
chains in the Genus database with same CATH superfamily
5CY0A 3QFPA 5BN8A 2E3FA 4GNIA 5BN9A 1P00A 4V1DC 2N2QA 5AQRA 2LJMA 5AQXA 2G2KA 5AQUA 3SF4D 1AHOA 3JXUA 1ZUTA 1VNAA 3FZKA 1SNBA 3D2EA 1ZVGA 2A7TA 1I6GA 5AQWA 1C55A 1KAYA 2KHOA 4HWIA 1PX9A 2N66A 3CQXA 2BUPA 1I2VA 5AQFA 4HHFA 4AB0A 5F2RA 2SN3A 1ICAA 3A8YA 4KBOA 1NGCA 1ZFUA 1ZU3A 3KHWA 4UADE 5EX5A 1T0ZA 1NGDA 1T7EA 2QWOA 3QFUA 4H5WA 1BMRA 1NPIA 2KBHA 1QQNA 2KSKA 2LN8A 1ZYVA 3LDOA 1N4NA 3PSMA 3M3ZA 1LQIA 1CN2A 1LQHA 1QQMA 2NY9X 4H5VA 1NGFA 3GL1A 5AQKA 2LT8A 2QWQA 5FPEA 1LQQA 2KYQA 1BUPA 2YEOA 3QI7A 1JXCA 1GPTA 5AQGA 1NGGA 5AQVA 3C7NA 4AAZA 2VY6A 1I2UA 1FH3A 1P0AA 2E8AA 3I33A 3FZLA 1KAXA 5AQYA 1K8BA 1NGJA 2LKBA 2YIOA 3D2EB 1DKGD 1JKZA 2KPYA 3D2FA 2KJAA 1C56A 1B7DA 2B68A 4IO8A 2ASCA 3LDNA 1B3CA 1UGLA 1CHZA 2GMOA 1HJOA 2LJ7A 2QXLA 3LDQA 1NGHA 2ATBA 1L4VA 5BPMA 1YUWA 1TI5A 1ZYWA 1HX1A 1ATRA 2LI7A 2QW9A 3KC6A 4UAFE 1PTXA 2JDQD 5AQPA 1NGAA 3KOYA 5AQOA 3FZHA 2MN5A 3QMLA 1T7AA 1NRBA 1NGBA 1SN4A 5AQJA 5AQMA 5F0XA 1NE5A 1QQOA 1BCGA 1OZZA 5AQLA 5KK4A 1OMYA 4UAEF 2LY6A 3FZFA 2E0HA 2N69A 3E7RL 3GDQA 3KOXA 1NH5A 1T7BA 1DJTA 1NGEA 3AY9A 3KP1A 1GPSA 4HE7A 1BK8A 3FE1A 5AR0A 1SEGA 5EVZA 1XRSB 1BA1A 5AQHA 3GKUA 2QWMA 2B3CA 4FSVA 2QWNA 3LDPA 5AQQA 1DQ7A 1PE4A 3IUCA 2YIPA 2YC1C 2I61A 3KOZA 1KAZA 2LY5A 3R2VA 5EXWA 5BPNA 1WWNA 4H5TA 2V7ZA 3L4IA 1SN1A 4KYPA 5AQIA 1WT7A 3L6QA 1MYNA 4CQKA 2GL1A 2KGQA 4UJ0A 1ZVEA 3FZMA 2BRZA 4H5NA 5AQSA 5F1XA 2E88A 2NY8X 2KBJA 2QWPA 5AQNA 2MBKA 2QWLA 5BPLA 3BK3C 5AQTA 1VNBA 3C7NB 1POIA 1MR4A 2YILA 3CW4A 2LR3A 3KVGA 3L56A 3LDLA 5AQZA 1WMTA 2E3GA 5FPMA 4AEIA 4FL9A 1T1TA 1ATSA 3ATUA 2K35A 3D2FB 2MZ0A 1AYJA 2KBKA 1BRZA 5FPNA 1I6FA 4H5RA 1NGIA 2D56A 1BA0A 1HPMA 2N2RA 2YBRC 3E7UX 1S3XA 2E2FA 1JZAA 1NRAA 3KOWA 3ATVA 5FPDA 1JZBA 2QWRA 3HSCA 1KV0A 2M8BB 3KP0A 5EY4A
chains in the Genus database with same CATH topology
5CY0A 2E3FA 1P00A 4V1DC 2N2QA 2LJMA 1AHOA 1ZUTA 1VNAA 1SNBA 1ZVGA 2A7TA 1I6GA 1C55A 1PX9A 2N66A 1I2VA 4HHFA 4AB0A 2SN3A 1ICAA 1ZFUA 1ZU3A 1T0ZA 1T7EA 1BMRA 1NPIA 2KBHA 2KSKA 1ZYVA 3PSMA 1N4NA 1LQIA 1CN2A 1LQHA 2NY9X 2LT8A 1LQQA 2KYQA 2YEOA 1JXCA 1GPTA 4AAZA 1I2UA 1FH3A 1P0AA 2LKBA 1JKZA 2KPYA 2KJAA 1C56A 1B7DA 2B68A 2ASCA 1B3CA 1CHZA 2LJ7A 2ATBA 1L4VA 1TI5A 1ZYWA 2LI7A 1PTXA 1T7AA 1NRBA 1SN4A 1NE5A 1BCGA 1OZZA 5KK4A 1OMYA 2LY6A 2E0HA 2N69A 3E7RL 1NH5A 1T7BA 1DJTA 1GPSA 4HE7A 1BK8A 1SEGA 2B3CA 1DQ7A 1PE4A 2YC1C 2I61A 2LY5A 1WWNA 1SN1A 4KYPA 1WT7A 1MYNA 4CQKA 2GL1A 2KGQA 4UJ0A 1ZVEA 2BRZA 2NY8X 2KBJA 1VNBA 1MR4A 2LR3A 1WMTA 2E3GA 4AEIA 1T1TA 2MZ0A 1AYJA 2KBKA 1BRZA 1I6FA 2N2RA 3E7UX 2YBRC 1JZAA 1NRAA 1JZBA 1KV0A 2M8BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CY0 A;  2E3F A;  1P00 A;  4V1D C;  2N2Q A;  2LJM A;  1AHO A;  1ZUT A;  1VNA A;  1SNB A;  1ZVG A;  2A7T A;  1I6G A;  1C55 A;  1PX9 A;  2N66 A;  1I2V A;  4HHF A;  4AB0 A;  2SN3 A;  1ICA A;  1ZFU A;  1ZU3 A;  1T0Z A;  1T7E A;  1BMR A;  1NPI A;  2KBH A;  2KSK A;  1ZYV A;  3PSM A;  1N4N A;  1LQI A;  1CN2 A;  1LQH A;  2NY9 X;  2LT8 A;  1LQQ A;  2KYQ A;  2YEO A;  1JXC A;  1GPT A;  4AAZ A;  1I2U A;  1FH3 A;  1P0A A;  2LKB A;  1JKZ A;  2KPY A;  2KJA A;  1C56 A;  1B7D A;  2B68 A;  2ASC A;  1B3C A;  1CHZ A;  2LJ7 A;  2ATB A;  1L4V A;  1TI5 A;  1ZYW A;  2LI7 A;  1PTX A;  1T7A A;  1NRB A;  1SN4 A;  1NE5 A;  1BCG A;  1OZZ A;  5KK4 A;  1OMY A;  2LY6 A;  2E0H A;  2N69 A;  3E7R L;  1NH5 A;  1T7B A;  1DJT A;  1GPS A;  4HE7 A;  1BK8 A;  1SEG A;  2B3C A;  1DQ7 A;  1PE4 A;  2YC1 C;  2I61 A;  2LY5 A;  1WWN A;  1SN1 A;  4KYP A;  1WT7 A;  1MYN A;  4CQK A;  2GL1 A;  2KGQ A;  4UJ0 A;  1ZVE A;  2BRZ A;  2NY8 X;  2KBJ A;  1VNB A;  1MR4 A;  2LR3 A;  1WMT A;  2E3G A;  4AEI A;  1T1T A;  2MZ0 A;  1AYJ A;  2KBK A;  1BRZ A;  1I6F A;  2N2R A;  3E7U X;  2YBR C;  1JZA A;  1NRA A;  1JZB A;  1KV0 A;  2M8B B; 
#chains in the Genus database with same CATH topology
 5CY0 A;  3QFP A;  5BN8 A;  2E3F A;  4GNI A;  5BN9 A;  1P00 A;  4V1D C;  2N2Q A;  5AQR A;  2LJM A;  5AQX A;  2G2K A;  5AQU A;  3SF4 D;  1AHO A;  3JXU A;  1ZUT A;  1VNA A;  3FZK A;  1SNB A;  3D2E A;  1ZVG A;  2A7T A;  1I6G A;  5AQW A;  1C55 A;  1KAY A;  2KHO A;  4HWI A;  1PX9 A;  2N66 A;  3CQX A;  2BUP A;  1I2V A;  5AQF A;  4HHF A;  4AB0 A;  5F2R A;  2SN3 A;  1ICA A;  3A8Y A;  4KBO A;  1NGC A;  1ZFU A;  1ZU3 A;  3KHW A;  4UAD E;  5EX5 A;  1T0Z A;  1NGD A;  1T7E A;  2QWO A;  3QFU A;  4H5W A;  1BMR A;  1NPI A;  2KBH A;  1QQN A;  2KSK A;  2LN8 A;  1ZYV A;  3LDO A;  1N4N A;  3PSM A;  3M3Z A;  1LQI A;  1CN2 A;  1LQH A;  1QQM A;  2NY9 X;  4H5V A;  1NGF A;  3GL1 A;  5AQK A;  2LT8 A;  2QWQ A;  5FPE A;  1LQQ A;  2KYQ A;  1BUP A;  2YEO A;  3QI7 A;  1JXC A;  1GPT A;  5AQG A;  1NGG A;  5AQV A;  3C7N A;  4AAZ A;  2VY6 A;  1I2U A;  1FH3 A;  1P0A A;  2E8A A;  3I33 A;  3FZL A;  1KAX A;  5AQY A;  1K8B A;  1NGJ A;  2LKB A;  2YIO A;  3D2E B;  1DKG D;  1JKZ A;  2KPY A;  3D2F A;  2KJA A;  1C56 A;  1B7D A;  2B68 A;  4IO8 A;  2ASC A;  3LDN A;  1B3C A;  1UGL A;  1CHZ A;  2GMO A;  1HJO A;  2LJ7 A;  2QXL A;  3LDQ A;  1NGH A;  2ATB A;  1L4V A;  5BPM A;  1YUW A;  1TI5 A;  1ZYW A;  1HX1 A;  1ATR A;  2LI7 A;  2QW9 A;  3KC6 A;  4UAF E;  1PTX A;  2JDQ D;  5AQP A;  1NGA A;  3KOY A;  5AQO A;  3FZH A;  2MN5 A;  3QML A;  1T7A A;  1NRB A;  1NGB A;  1SN4 A;  5AQJ A;  5AQM A;  5F0X A;  1NE5 A;  1QQO A;  1BCG A;  1OZZ A;  5AQL A;  5KK4 A;  1OMY A;  4UAE F;  2LY6 A;  3FZF A;  2E0H A;  2N69 A;  3E7R L;  3GDQ A;  3KOX A;  1NH5 A;  1T7B A;  1DJT A;  1NGE A;  3AY9 A;  3KP1 A;  1GPS A;  4HE7 A;  1BK8 A;  3FE1 A;  5AR0 A;  1SEG A;  5EVZ A;  1XRS B;  1BA1 A;  5AQH A;  3GKU A;  2QWM A;  2B3C A;  4FSV A;  2QWN A;  3LDP A;  5AQQ A;  1DQ7 A;  1PE4 A;  3IUC A;  2YIP A;  2YC1 C;  2I61 A;  3KOZ A;  1KAZ A;  2LY5 A;  3R2V A;  5EXW A;  5BPN A;  1WWN A;  4H5T A;  2V7Z A;  3L4I A;  1SN1 A;  4KYP A;  5AQI A;  1WT7 A;  3L6Q A;  1MYN A;  4CQK A;  2GL1 A;  2KGQ A;  4UJ0 A;  1ZVE A;  3FZM A;  2BRZ A;  4H5N A;  5AQS A;  5F1X A;  2E88 A;  2NY8 X;  2KBJ A;  2QWP A;  5AQN A;  2MBK A;  2QWL A;  5BPL A;  3BK3 C;  5AQT A;  1VNB A;  3C7N B;  1POI A;  1MR4 A;  2YIL A;  3CW4 A;  2LR3 A;  3KVG A;  3L56 A;  3LDL A;  5AQZ A;  1WMT A;  2E3G A;  5FPM A;  4AEI A;  4FL9 A;  1T1T A;  1ATS A;  3ATU A;  2K35 A;  3D2F B;  2MZ0 A;  1AYJ A;  2KBK A;  1BRZ A;  5FPN A;  1I6F A;  4H5R A;  1NGI A;  2D56 A;  1BA0 A;  1HPM A;  2N2R A;  2YBR C;  3E7U X;  1S3X A;  2E2F A;  1JZA A;  1NRA A;  3KOW A;  3ATV A;  5FPD A;  1JZB A;  2QWR A;  3HSC A;  1KV0 A;  2M8B B;  3KP0 A;  5EY4 A; 
#chains in the Genus database with same CATH homology
 5CY0 A;  2E3F A;  1P00 A;  4V1D C;  2N2Q A;  2LJM A;  1AHO A;  1ZUT A;  1VNA A;  1SNB A;  1ZVG A;  2A7T A;  1I6G A;  1C55 A;  1PX9 A;  2N66 A;  1I2V A;  4HHF A;  4AB0 A;  2SN3 A;  1ICA A;  1ZFU A;  1ZU3 A;  1T0Z A;  1T7E A;  1BMR A;  1NPI A;  2KBH A;  2KSK A;  1ZYV A;  3PSM A;  1N4N A;  1LQI A;  1CN2 A;  1LQH A;  2NY9 X;  2LT8 A;  1LQQ A;  2KYQ A;  2YEO A;  1JXC A;  1GPT A;  4AAZ A;  1I2U A;  1FH3 A;  1P0A A;  2LKB A;  1JKZ A;  2KPY A;  2KJA A;  1C56 A;  1B7D A;  2B68 A;  2ASC A;  1B3C A;  1CHZ A;  2LJ7 A;  2ATB A;  1L4V A;  1TI5 A;  1ZYW A;  2LI7 A;  1PTX A;  1T7A A;  1NRB A;  1SN4 A;  1NE5 A;  1BCG A;  1OZZ A;  5KK4 A;  1OMY A;  2LY6 A;  2E0H A;  2N69 A;  3E7R L;  1NH5 A;  1T7B A;  1DJT A;  1GPS A;  4HE7 A;  1BK8 A;  1SEG A;  2B3C A;  1DQ7 A;  1PE4 A;  2YC1 C;  2I61 A;  2LY5 A;  1WWN A;  1SN1 A;  4KYP A;  1WT7 A;  1MYN A;  4CQK A;  2GL1 A;  2KGQ A;  4UJ0 A;  1ZVE A;  2BRZ A;  2NY8 X;  2KBJ A;  1VNB A;  1MR4 A;  2LR3 A;  1WMT A;  2E3G A;  4AEI A;  1T1T A;  2MZ0 A;  1AYJ A;  2KBK A;  1BRZ A;  1I6F A;  2N2R A;  3E7U X;  2YBR C;  1JZA A;  1NRA A;  1JZB A;  1KV0 A;  2M8B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...