1KV0A

Cis/trans isomerization of non-prolyl peptide bond observed in crystal structure of an scorpion toxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
b'VRDGYIALPHNCAYGCLNNEYCNNLCTKDGAKIGYCNIVGKYGNACWCIQLPDNVPIRVPGRCHPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism governing cis and trans isomeric states and an intramolecular switch for cis/trans isomerization of a non-proline peptide bond observed in crystal structures of scorpion toxins.
pubmed doi rcsb
molecule keywords Alpha-like toxin BmK-M7
molecule tags Toxin
total genus 15
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1kv0A00
1NRBA 1T0ZA 2ASCA 2KPYA 2KBKA 3E7UX 2E0HA 2N69A 1NE5A 2N2RA 2NY9X 1SNBA 5KK4A 2N66A 2LJMA 2GL1A 1I2UA 1NPIA 1AHOA 4HHFA 1P0AA 1ICAA 1I6GA 1VNAA 1PTXA 4AAZA 2B3CA 2LT8A 2E3GA 1T7AA 4HE7A 1B3CA 1JZBA 1AYJA 2BRZA 1ZVEA 1JKZA 1L4VA 2N2QA 4UJ0A 2E3FA 1ZFUA 1B7DA 4AB0A 4CQKA 2MZ0A 1ZYVA 2ATBA 1KV0A 1TI5A 2YC1C 2I61A 1ZUTA 1N4NA 1SN4A 1WWNA 4V1DC 1PX9A 1I6FA 1WMTA 2LY5A 2YBRC 1PE4A 1I2VA 2LY6A 1C55A 1BCGA 2YEOA 2B68A 1NH5A 2SN3A 4KYPA 1GPSA 2M8BB 2LJ7A 1MR4A 2LKBA 1CHZA 1NRAA 1DJTA 4AEIA 1LQQA 2KYQA 1ZU3A 1VNBA 1DQ7A 3PSMA 1BMRA 3E7RL 1T7EA 1JZAA 1T1TA 1C56A 1CN2A 1LQHA 5CY0A 2KJAA 1OZZA 1SN1A 1P00A 1BK8A 2LI7A 2KGQA 2KBHA 1JXCA 1OMYA 2A7TA 1FH3A 2LR3A 1WT7A 1BRZA 2NY8X 2KSKA 1ZYWA 2KBJA 1LQIA 1T7BA 1MYNA 1ZVGA 1GPTA 1SEGA
chains in the Genus database with same CATH superfamily
4UAEF 1NRBA 1T0ZA 2ASCA 2KPYA 2KBKA 5FPDA 3E7UX 5AQLA 5EXWA 2E0HA 3ATVA 2N69A 1NE5A 2N2RA 2NY9X 5AQXA 3L56A 3M3ZA 2MBKA 4KBOA 2QW9A 1SNBA 5KK4A 1NGEA 2N66A 3KP1A 2LJMA 2YIOA 3L4IA 5F1XA 2MN5A 2GL1A 1I2UA 3CQXA 5AQSA 5F0XA 4IO8A 4GNIA 5AQUA 1S3XA 3D2EB 1NPIA 3QFPA 1AHOA 3KOYA 3LDQA 2QWLA 1NGHA 3QFUA 4HHFA 5AQWA 5BPMA 1P0AA 2JDQD 4H5VA 1ICAA 1I6GA 1VNAA 1PTXA 2E88A 4AAZA 2B3CA 2LT8A 2E3GA 1T7AA 4HE7A 3AY9A 1ATRA 5AQTA 1B3CA 3D2FB 1JZBA 1AYJA 2BRZA 1ZVEA 2QWOA 3QMLA 1JKZA 1L4VA 5AQFA 1NGJA 2N2QA 5EX5A 4UJ0A 2E3FA 1NGAA 1ZFUA 5EVZA 3HSCA 1B7DA 4AB0A 5BN8A 2V7ZA 1K8BA 4CQKA 3LDLA 3GKUA 2MZ0A 3CW4A 1ZYVA 3FZKA 2ATBA 1KV0A 1HJOA 1TI5A 2YC1C 5AQVA 1BUPA 1YUWA 2I61A 2VY6A 3I33A 1ZUTA 1N4NA 4HWIA 1SN4A 3BK3C 3KC6A 5AQQA 2BUPA 1WWNA 2E2FA 1NGBA 4FSVA 4V1DC 1NGGA 5AR0A 4UAFE 1PX9A 1I6FA 1WMTA 2LY5A 2YBRC 3KVGA 5AQYA 3JXUA 1PE4A 1UGLA 3FZFA 3SF4D 1I2VA 2QWRA 2LY6A 1C55A 2QXLA 3QI7A 1BCGA 2YEOA 1NGIA 2B68A 1NH5A 1HPMA 2GMOA 5BN9A 5FPEA 2SN3A 1BA0A 3KOWA 2K35A 1KAZA 3C7NA 4KYPA 5AQRA 1GPSA 2QWMA 5FPNA 2YILA 5AQIA 5AQNA 5BPLA 2M8BB 2G2KA 2LJ7A 3LDOA 5F2RA 1MR4A 3D2FA 4UADE 3FZHA 5AQJA 2LKBA 2E8AA 1NGFA 5AQKA 3FZMA 5AQGA 2QWQA 4H5RA 5EY4A 1CHZA 4FL9A 2QWNA 3IUCA 3A8YA 3KP0A 5FPMA 1NRAA 1DJTA 4AEIA 2KHOA 1LQQA 3FE1A 2KYQA 1ZU3A 1VNBA 1DQ7A 3PSMA 1QQMA 2LN8A 1BMRA 3KOZA 4H5TA 1BA1A 3E7RL 1T7EA 1JZAA 1KAXA 1T1TA 3ATUA 1C56A 4H5WA 1CN2A 1LQHA 5CY0A 3FZLA 1QQNA 3R2VA 2KJAA 1OZZA 1SN1A 1ATSA 3D2EA 1P00A 3LDNA 1XRSB 1BK8A 5AQOA 3L6QA 2LI7A 2KGQA 2KBHA 1KAYA 1JXCA 3GDQA 3GL1A 1OMYA 1NGDA 3LDPA 5AQZA 2A7TA 1FH3A 5AQHA 1DKGD 2LR3A 2D56A 1WT7A 2QWPA 3KHWA 2NY8X 1HX1A 1BRZA 2KSKA 4H5NA 5AQMA 1ZYWA 1POIA 3C7NB 5BPNA 1QQOA 2KBJA 1LQIA 1T7BA 3KOXA 1NGCA 1MYNA 1ZVGA 2YIPA 1GPTA 1SEGA 5AQPA
chains in the Genus database with same CATH topology
1NRBA 1T0ZA 2ASCA 2KPYA 2KBKA 3E7UX 2E0HA 2N69A 1NE5A 2N2RA 2NY9X 1SNBA 5KK4A 2N66A 2LJMA 2GL1A 1I2UA 1NPIA 1AHOA 4HHFA 1P0AA 1ICAA 1I6GA 1VNAA 1PTXA 4AAZA 2B3CA 2LT8A 2E3GA 1T7AA 4HE7A 1B3CA 1JZBA 1AYJA 2BRZA 1ZVEA 1JKZA 1L4VA 2N2QA 4UJ0A 2E3FA 1ZFUA 1B7DA 4AB0A 4CQKA 2MZ0A 1ZYVA 2ATBA 1KV0A 1TI5A 2YC1C 2I61A 1ZUTA 1N4NA 1SN4A 1WWNA 4V1DC 1PX9A 1I6FA 1WMTA 2LY5A 2YBRC 1PE4A 1I2VA 2LY6A 1C55A 1BCGA 2YEOA 2B68A 1NH5A 2SN3A 4KYPA 1GPSA 2M8BB 2LJ7A 1MR4A 2LKBA 1CHZA 1NRAA 1DJTA 4AEIA 1LQQA 2KYQA 1ZU3A 1VNBA 1DQ7A 3PSMA 1BMRA 3E7RL 1T7EA 1JZAA 1T1TA 1C56A 1CN2A 1LQHA 5CY0A 2KJAA 1OZZA 1SN1A 1P00A 1BK8A 2LI7A 2KGQA 2KBHA 1JXCA 1OMYA 2A7TA 1FH3A 2LR3A 1WT7A 1BRZA 2NY8X 2KSKA 1ZYWA 2KBJA 1LQIA 1T7BA 1MYNA 1ZVGA 1GPTA 1SEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NRB A;  1T0Z A;  2ASC A;  2KPY A;  2KBK A;  3E7U X;  2E0H A;  2N69 A;  1NE5 A;  2N2R A;  2NY9 X;  1SNB A;  5KK4 A;  2N66 A;  2LJM A;  2GL1 A;  1I2U A;  1NPI A;  1AHO A;  4HHF A;  1P0A A;  1ICA A;  1I6G A;  1VNA A;  1PTX A;  4AAZ A;  2B3C A;  2LT8 A;  2E3G A;  1T7A A;  4HE7 A;  1B3C A;  1JZB A;  1AYJ A;  2BRZ A;  1ZVE A;  1JKZ A;  1L4V A;  2N2Q A;  4UJ0 A;  2E3F A;  1ZFU A;  1B7D A;  4AB0 A;  4CQK A;  2MZ0 A;  1ZYV A;  2ATB A;  1KV0 A;  1TI5 A;  2YC1 C;  2I61 A;  1ZUT A;  1N4N A;  1SN4 A;  1WWN A;  4V1D C;  1PX9 A;  1I6F A;  1WMT A;  2LY5 A;  2YBR C;  1PE4 A;  1I2V A;  2LY6 A;  1C55 A;  1BCG A;  2YEO A;  2B68 A;  1NH5 A;  2SN3 A;  4KYP A;  1GPS A;  2M8B B;  2LJ7 A;  1MR4 A;  2LKB A;  1CHZ A;  1NRA A;  1DJT A;  4AEI A;  1LQQ A;  2KYQ A;  1ZU3 A;  1VNB A;  1DQ7 A;  3PSM A;  1BMR A;  3E7R L;  1T7E A;  1JZA A;  1T1T A;  1C56 A;  1CN2 A;  1LQH A;  5CY0 A;  2KJA A;  1OZZ A;  1SN1 A;  1P00 A;  1BK8 A;  2LI7 A;  2KGQ A;  2KBH A;  1JXC A;  1OMY A;  2A7T A;  1FH3 A;  2LR3 A;  1WT7 A;  1BRZ A;  2NY8 X;  2KSK A;  1ZYW A;  2KBJ A;  1LQI A;  1T7B A;  1MYN A;  1ZVG A;  1GPT A;  1SEG A; 
#chains in the Genus database with same CATH topology
 4UAE F;  1NRB A;  1T0Z A;  2ASC A;  2KPY A;  2KBK A;  5FPD A;  3E7U X;  5AQL A;  5EXW A;  2E0H A;  3ATV A;  2N69 A;  1NE5 A;  2N2R A;  2NY9 X;  5AQX A;  3L56 A;  3M3Z A;  2MBK A;  4KBO A;  2QW9 A;  1SNB A;  5KK4 A;  1NGE A;  2N66 A;  3KP1 A;  2LJM A;  2YIO A;  3L4I A;  5F1X A;  2MN5 A;  2GL1 A;  1I2U A;  3CQX A;  5AQS A;  5F0X A;  4IO8 A;  4GNI A;  5AQU A;  1S3X A;  3D2E B;  1NPI A;  3QFP A;  1AHO A;  3KOY A;  3LDQ A;  2QWL A;  1NGH A;  3QFU A;  4HHF A;  5AQW A;  5BPM A;  1P0A A;  2JDQ D;  4H5V A;  1ICA A;  1I6G A;  1VNA A;  1PTX A;  2E88 A;  4AAZ A;  2B3C A;  2LT8 A;  2E3G A;  1T7A A;  4HE7 A;  3AY9 A;  1ATR A;  5AQT A;  1B3C A;  3D2F B;  1JZB A;  1AYJ A;  2BRZ A;  1ZVE A;  2QWO A;  3QML A;  1JKZ A;  1L4V A;  5AQF A;  1NGJ A;  2N2Q A;  5EX5 A;  4UJ0 A;  2E3F A;  1NGA A;  1ZFU A;  5EVZ A;  3HSC A;  1B7D A;  4AB0 A;  5BN8 A;  2V7Z A;  1K8B A;  4CQK A;  3LDL A;  3GKU A;  2MZ0 A;  3CW4 A;  1ZYV A;  3FZK A;  2ATB A;  1KV0 A;  1HJO A;  1TI5 A;  2YC1 C;  5AQV A;  1BUP A;  1YUW A;  2I61 A;  2VY6 A;  3I33 A;  1ZUT A;  1N4N A;  4HWI A;  1SN4 A;  3BK3 C;  3KC6 A;  5AQQ A;  2BUP A;  1WWN A;  2E2F A;  1NGB A;  4FSV A;  4V1D C;  1NGG A;  5AR0 A;  4UAF E;  1PX9 A;  1I6F A;  1WMT A;  2LY5 A;  2YBR C;  3KVG A;  5AQY A;  3JXU A;  1PE4 A;  1UGL A;  3FZF A;  3SF4 D;  1I2V A;  2QWR A;  2LY6 A;  1C55 A;  2QXL A;  3QI7 A;  1BCG A;  2YEO A;  1NGI A;  2B68 A;  1NH5 A;  1HPM A;  2GMO A;  5BN9 A;  5FPE A;  2SN3 A;  1BA0 A;  3KOW A;  2K35 A;  1KAZ A;  3C7N A;  4KYP A;  5AQR A;  1GPS A;  2QWM A;  5FPN A;  2YIL A;  5AQI A;  5AQN A;  5BPL A;  2M8B B;  2G2K A;  2LJ7 A;  3LDO A;  5F2R A;  1MR4 A;  3D2F A;  4UAD E;  3FZH A;  5AQJ A;  2LKB A;  2E8A A;  1NGF A;  5AQK A;  3FZM A;  5AQG A;  2QWQ A;  4H5R A;  5EY4 A;  1CHZ A;  4FL9 A;  2QWN A;  3IUC A;  3A8Y A;  3KP0 A;  5FPM A;  1NRA A;  1DJT A;  4AEI A;  2KHO A;  1LQQ A;  3FE1 A;  2KYQ A;  1ZU3 A;  1VNB A;  1DQ7 A;  3PSM A;  1QQM A;  2LN8 A;  1BMR A;  3KOZ A;  4H5T A;  1BA1 A;  3E7R L;  1T7E A;  1JZA A;  1KAX A;  1T1T A;  3ATU A;  1C56 A;  4H5W A;  1CN2 A;  1LQH A;  5CY0 A;  3FZL A;  1QQN A;  3R2V A;  2KJA A;  1OZZ A;  1SN1 A;  1ATS A;  3D2E A;  1P00 A;  3LDN A;  1XRS B;  1BK8 A;  5AQO A;  3L6Q A;  2LI7 A;  2KGQ A;  2KBH A;  1KAY A;  1JXC A;  3GDQ A;  3GL1 A;  1OMY A;  1NGD A;  3LDP A;  5AQZ A;  2A7T A;  1FH3 A;  5AQH A;  1DKG D;  2LR3 A;  2D56 A;  1WT7 A;  2QWP A;  3KHW A;  2NY8 X;  1HX1 A;  1BRZ A;  2KSK A;  4H5N A;  5AQM A;  1ZYW A;  1POI A;  3C7N B;  5BPN A;  1QQO A;  2KBJ A;  1LQI A;  1T7B A;  3KOX A;  1NGC A;  1MYN A;  1ZVG A;  2YIP A;  1GPT A;  1SEG A;  5AQP A; 
#chains in the Genus database with same CATH homology
 1NRB A;  1T0Z A;  2ASC A;  2KPY A;  2KBK A;  3E7U X;  2E0H A;  2N69 A;  1NE5 A;  2N2R A;  2NY9 X;  1SNB A;  5KK4 A;  2N66 A;  2LJM A;  2GL1 A;  1I2U A;  1NPI A;  1AHO A;  4HHF A;  1P0A A;  1ICA A;  1I6G A;  1VNA A;  1PTX A;  4AAZ A;  2B3C A;  2LT8 A;  2E3G A;  1T7A A;  4HE7 A;  1B3C A;  1JZB A;  1AYJ A;  2BRZ A;  1ZVE A;  1JKZ A;  1L4V A;  2N2Q A;  4UJ0 A;  2E3F A;  1ZFU A;  1B7D A;  4AB0 A;  4CQK A;  2MZ0 A;  1ZYV A;  2ATB A;  1KV0 A;  1TI5 A;  2YC1 C;  2I61 A;  1ZUT A;  1N4N A;  1SN4 A;  1WWN A;  4V1D C;  1PX9 A;  1I6F A;  1WMT A;  2LY5 A;  2YBR C;  1PE4 A;  1I2V A;  2LY6 A;  1C55 A;  1BCG A;  2YEO A;  2B68 A;  1NH5 A;  2SN3 A;  4KYP A;  1GPS A;  2M8B B;  2LJ7 A;  1MR4 A;  2LKB A;  1CHZ A;  1NRA A;  1DJT A;  4AEI A;  1LQQ A;  2KYQ A;  1ZU3 A;  1VNB A;  1DQ7 A;  3PSM A;  1BMR A;  3E7R L;  1T7E A;  1JZA A;  1T1T A;  1C56 A;  1CN2 A;  1LQH A;  5CY0 A;  2KJA A;  1OZZ A;  1SN1 A;  1P00 A;  1BK8 A;  2LI7 A;  2KGQ A;  2KBH A;  1JXC A;  1OMY A;  2A7T A;  1FH3 A;  2LR3 A;  1WT7 A;  1BRZ A;  2NY8 X;  2KSK A;  1ZYW A;  2KBJ A;  1LQI A;  1T7B A;  1MYN A;  1ZVG A;  1GPT A;  1SEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...