1PX9A

Solution structure of the native cnerg1 ergtoxin, a highly specific inhibitor of herg channel
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
42
structure length
42
Chain Sequence
DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ergtoxin
publication title Exploring structural features of the interaction between the scorpion toxinCnErg1 and ERG K+ channels.
pubmed doi rcsb
total genus 13
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08086 Toxin_17 Ergtoxin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1px9A00
1P00A 1CHZA 2KBKA 1L4VA 1T7EA 2SN3A 1ZFUA 1I2VA 2NY8X 1PX9A 3E7UX 1JZBA 1SNBA 2LI7A 2KPYA 1DQ7A 2ATBA 4HHFA 1NRBA 1ZYWA 3PSMA 2E0HA 1I2UA 1T7AA 2YC1C 1MYNA 1KV0A 2YBRC 1VNAA 5CY0A 1ZYVA 2B68A 1NE5A 2LJ7A 1FH3A 1BK8A 5KK4A 1ZUTA 4AB0A 1JZAA 2A7TA 2I61A 2LY6A 1AHOA 1NPIA 2B3CA 4CQKA 1P0AA 2KSKA 2M8BB 1T0ZA 2YEOA 1B7DA 1WT7A 1WWNA 2E3GA 1LQQA 2KGQA 1BCGA 4V1DC 2LR3A 2GL1A 2KYQA 1PTXA 2KBHA 1SN1A 2N2QA 2KBJA 1NH5A 1LQHA 1MR4A 1N4NA 1ZU3A 1I6FA 2E3FA 1JKZA 1JXCA 1BRZA 2N66A 1LQIA 1GPTA 2BRZA 1C56A 2LY5A 2MZ0A 2KJAA 1T7BA 4UJ0A 1SEGA 1VNBA 1OMYA 1GPSA 2N2RA 2ASCA 1OZZA 2NY9X 1TI5A 2LKBA 4HE7A 1B3CA 1I6GA 1WMTA 1C55A 1ICAA 1PE4A 1T1TA 1DJTA 1SN4A 4KYPA 1ZVEA 1ZVGA 1BMRA 1NRAA 3E7RL 2N69A 1AYJA 4AEIA 1CN2A 2LJMA 4AAZA 2LT8A
chains in the Genus database with same CATH superfamily
1P00A 1CHZA 1NGBA 3D2FA 3GL1A 2KBKA 3QFUA 5AQKA 5EXWA 2QWRA 1L4VA 1NGDA 1T7EA 3L6QA 2SN3A 5AQXA 1ZFUA 3HSCA 3QMLA 1I2VA 3ATVA 2NY8X 5FPDA 2MBKA 3D2EB 5AQQA 5AQZA 1PX9A 3E7UX 3QI7A 1JZBA 1KAXA 1SNBA 2LI7A 5EVZA 3KOYA 3LDOA 2V7ZA 2KPYA 5FPNA 1DQ7A 2ATBA 5AQSA 5BPMA 1KAYA 1K8BA 3KC6A 3CW4A 4HHFA 2YILA 3CQXA 1NRBA 2GMOA 1ZYWA 5BN8A 1BA0A 3KHWA 3QFPA 5EY4A 5AQGA 5AR0A 4UAEF 3PSMA 2YIPA 2E0HA 3GKUA 1T7AA 2YC1C 2D56A 4FSVA 4FL9A 4H5TA 1I2UA 1MYNA 1KV0A 2YBRC 3LDLA 1VNAA 5CY0A 1ZYVA 1NGAA 1NE5A 2B68A 2LJ7A 3FE1A 2JDQD 5AQJA 1BK8A 1FH3A 5KK4A 1ZUTA 5FPMA 4AB0A 1ATRA 1JZAA 2A7TA 1NGFA 2I61A 2LY6A 2QWOA 2QXLA 4UADE 5AQUA 1AHOA 3LDPA 5AQTA 4IO8A 1NPIA 2B3CA 2E2FA 2VY6A 3C7NA 4CQKA 1P0AA 5FPEA 2KSKA 2M8BB 3BK3C 3AY9A 5AQVA 2QWQA 1T0ZA 2YEOA 1B7DA 1QQOA 5AQYA 1WT7A 1WWNA 2E3GA 2K35A 3M3ZA 1NGJA 1LQQA 3IUCA 3FZKA 3I33A 2QWMA 5F2RA 3LDNA 2KGQA 1BCGA 4H5WA 5BPNA 3D2EA 3L4IA 4UAFE 5F0XA 1KAZA 3JXUA 2LR3A 4V1DC 2GL1A 3FZMA 2KYQA 5AQHA 1PTXA 1S3XA 2KBHA 1SN1A 4H5NA 1XRSB 2N2QA 2KBJA 5BN9A 5AQIA 1NH5A 1LQHA 1MR4A 1N4NA 1ZU3A 1I6FA 2E3FA 2E8AA 3D2FB 3KP0A 3KVGA 5AQMA 1JKZA 2BUPA 1JXCA 1BRZA 3SF4D 4H5RA 2N66A 1QQMA 2QWNA 1HJOA 5AQFA 3KOZA 5BPLA 1LQIA 3LDQA 1GPTA 2QW9A 2BRZA 3KOWA 3L56A 1C56A 2LY5A 2MZ0A 2YIOA 1BUPA 2KJAA 1T7BA 4UJ0A 1DKGD 3KOXA 5F1XA 1NGGA 1SEGA 1VNBA 5AQNA 1POIA 3FZLA 4H5VA 1NGHA 1OMYA 2G2KA 2LN8A 2MN5A 3FZFA 1GPSA 2N2RA 1NGEA 1OZZA 2ASCA 3KP1A 2NY9X 1QQNA 1TI5A 2LKBA 4HE7A 5EX5A 1B3CA 1I6GA 1NGCA 1WMTA 1UGLA 1NGIA 4KBOA 1C55A 1ICAA 1PE4A 1T1TA 3GDQA 1DJTA 1SN4A 4KYPA 4HWIA 1BA1A 1ZVEA 5AQLA 1ZVGA 1BMRA 5AQWA 3A8YA 1NRAA 1YUWA 5AQOA 3R2VA 3E7RL 1HPMA 2N69A 1AYJA 2QWPA 4AEIA 3C7NB 5AQRA 1CN2A 2QWLA 4GNIA 3ATUA 1ATSA 1HX1A 2LJMA 3FZHA 5AQPA 2KHOA 4AAZA 2E88A 2LT8A
chains in the Genus database with same CATH topology
1P00A 1CHZA 2KBKA 1L4VA 1T7EA 2SN3A 1ZFUA 1I2VA 2NY8X 1PX9A 3E7UX 1JZBA 1SNBA 2LI7A 2KPYA 1DQ7A 2ATBA 4HHFA 1NRBA 1ZYWA 3PSMA 2E0HA 1I2UA 1T7AA 2YC1C 1MYNA 1KV0A 2YBRC 1VNAA 5CY0A 1ZYVA 2B68A 1NE5A 2LJ7A 1FH3A 1BK8A 5KK4A 1ZUTA 4AB0A 1JZAA 2A7TA 2I61A 2LY6A 1AHOA 1NPIA 2B3CA 4CQKA 1P0AA 2KSKA 2M8BB 1T0ZA 2YEOA 1B7DA 1WT7A 1WWNA 2E3GA 1LQQA 2KGQA 1BCGA 4V1DC 2LR3A 2GL1A 2KYQA 1PTXA 2KBHA 1SN1A 2N2QA 2KBJA 1NH5A 1LQHA 1MR4A 1N4NA 1ZU3A 1I6FA 2E3FA 1JKZA 1JXCA 1BRZA 2N66A 1LQIA 1GPTA 2BRZA 1C56A 2LY5A 2MZ0A 2KJAA 1T7BA 4UJ0A 1SEGA 1VNBA 1OMYA 1GPSA 2N2RA 2ASCA 1OZZA 2NY9X 1TI5A 2LKBA 4HE7A 1B3CA 1I6GA 1WMTA 1C55A 1ICAA 1PE4A 1T1TA 1DJTA 1SN4A 4KYPA 1ZVEA 1ZVGA 1BMRA 1NRAA 3E7RL 2N69A 1AYJA 4AEIA 1CN2A 2LJMA 4AAZA 2LT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P00 A;  1CHZ A;  2KBK A;  1L4V A;  1T7E A;  2SN3 A;  1ZFU A;  1I2V A;  2NY8 X;  1PX9 A;  3E7U X;  1JZB A;  1SNB A;  2LI7 A;  2KPY A;  1DQ7 A;  2ATB A;  4HHF A;  1NRB A;  1ZYW A;  3PSM A;  2E0H A;  1I2U A;  1T7A A;  2YC1 C;  1MYN A;  1KV0 A;  2YBR C;  1VNA A;  5CY0 A;  1ZYV A;  2B68 A;  1NE5 A;  2LJ7 A;  1FH3 A;  1BK8 A;  5KK4 A;  1ZUT A;  4AB0 A;  1JZA A;  2A7T A;  2I61 A;  2LY6 A;  1AHO A;  1NPI A;  2B3C A;  4CQK A;  1P0A A;  2KSK A;  2M8B B;  1T0Z A;  2YEO A;  1B7D A;  1WT7 A;  1WWN A;  2E3G A;  1LQQ A;  2KGQ A;  1BCG A;  4V1D C;  2LR3 A;  2GL1 A;  2KYQ A;  1PTX A;  2KBH A;  1SN1 A;  2N2Q A;  2KBJ A;  1NH5 A;  1LQH A;  1MR4 A;  1N4N A;  1ZU3 A;  1I6F A;  2E3F A;  1JKZ A;  1JXC A;  1BRZ A;  2N66 A;  1LQI A;  1GPT A;  2BRZ A;  1C56 A;  2LY5 A;  2MZ0 A;  2KJA A;  1T7B A;  4UJ0 A;  1SEG A;  1VNB A;  1OMY A;  1GPS A;  2N2R A;  2ASC A;  1OZZ A;  2NY9 X;  1TI5 A;  2LKB A;  4HE7 A;  1B3C A;  1I6G A;  1WMT A;  1C55 A;  1ICA A;  1PE4 A;  1T1T A;  1DJT A;  1SN4 A;  4KYP A;  1ZVE A;  1ZVG A;  1BMR A;  1NRA A;  3E7R L;  2N69 A;  1AYJ A;  4AEI A;  1CN2 A;  2LJM A;  4AAZ A;  2LT8 A; 
#chains in the Genus database with same CATH topology
 1P00 A;  1CHZ A;  1NGB A;  3D2F A;  3GL1 A;  2KBK A;  3QFU A;  5AQK A;  5EXW A;  2QWR A;  1L4V A;  1NGD A;  1T7E A;  3L6Q A;  2SN3 A;  5AQX A;  1ZFU A;  3HSC A;  3QML A;  1I2V A;  3ATV A;  2NY8 X;  5FPD A;  2MBK A;  3D2E B;  5AQQ A;  5AQZ A;  1PX9 A;  3E7U X;  3QI7 A;  1JZB A;  1KAX A;  1SNB A;  2LI7 A;  5EVZ A;  3KOY A;  3LDO A;  2V7Z A;  2KPY A;  5FPN A;  1DQ7 A;  2ATB A;  5AQS A;  5BPM A;  1KAY A;  1K8B A;  3KC6 A;  3CW4 A;  4HHF A;  2YIL A;  3CQX A;  1NRB A;  2GMO A;  1ZYW A;  5BN8 A;  1BA0 A;  3KHW A;  3QFP A;  5EY4 A;  5AQG A;  5AR0 A;  4UAE F;  3PSM A;  2YIP A;  2E0H A;  3GKU A;  1T7A A;  2YC1 C;  2D56 A;  4FSV A;  4FL9 A;  4H5T A;  1I2U A;  1MYN A;  1KV0 A;  2YBR C;  3LDL A;  1VNA A;  5CY0 A;  1ZYV A;  1NGA A;  1NE5 A;  2B68 A;  2LJ7 A;  3FE1 A;  2JDQ D;  5AQJ A;  1BK8 A;  1FH3 A;  5KK4 A;  1ZUT A;  5FPM A;  4AB0 A;  1ATR A;  1JZA A;  2A7T A;  1NGF A;  2I61 A;  2LY6 A;  2QWO A;  2QXL A;  4UAD E;  5AQU A;  1AHO A;  3LDP A;  5AQT A;  4IO8 A;  1NPI A;  2B3C A;  2E2F A;  2VY6 A;  3C7N A;  4CQK A;  1P0A A;  5FPE A;  2KSK A;  2M8B B;  3BK3 C;  3AY9 A;  5AQV A;  2QWQ A;  1T0Z A;  2YEO A;  1B7D A;  1QQO A;  5AQY A;  1WT7 A;  1WWN A;  2E3G A;  2K35 A;  3M3Z A;  1NGJ A;  1LQQ A;  3IUC A;  3FZK A;  3I33 A;  2QWM A;  5F2R A;  3LDN A;  2KGQ A;  1BCG A;  4H5W A;  5BPN A;  3D2E A;  3L4I A;  4UAF E;  5F0X A;  1KAZ A;  3JXU A;  2LR3 A;  4V1D C;  2GL1 A;  3FZM A;  2KYQ A;  5AQH A;  1PTX A;  1S3X A;  2KBH A;  1SN1 A;  4H5N A;  1XRS B;  2N2Q A;  2KBJ A;  5BN9 A;  5AQI A;  1NH5 A;  1LQH A;  1MR4 A;  1N4N A;  1ZU3 A;  1I6F A;  2E3F A;  2E8A A;  3D2F B;  3KP0 A;  3KVG A;  5AQM A;  1JKZ A;  2BUP A;  1JXC A;  1BRZ A;  3SF4 D;  4H5R A;  2N66 A;  1QQM A;  2QWN A;  1HJO A;  5AQF A;  3KOZ A;  5BPL A;  1LQI A;  3LDQ A;  1GPT A;  2QW9 A;  2BRZ A;  3KOW A;  3L56 A;  1C56 A;  2LY5 A;  2MZ0 A;  2YIO A;  1BUP A;  2KJA A;  1T7B A;  4UJ0 A;  1DKG D;  3KOX A;  5F1X A;  1NGG A;  1SEG A;  1VNB A;  5AQN A;  1POI A;  3FZL A;  4H5V A;  1NGH A;  1OMY A;  2G2K A;  2LN8 A;  2MN5 A;  3FZF A;  1GPS A;  2N2R A;  1NGE A;  1OZZ A;  2ASC A;  3KP1 A;  2NY9 X;  1QQN A;  1TI5 A;  2LKB A;  4HE7 A;  5EX5 A;  1B3C A;  1I6G A;  1NGC A;  1WMT A;  1UGL A;  1NGI A;  4KBO A;  1C55 A;  1ICA A;  1PE4 A;  1T1T A;  3GDQ A;  1DJT A;  1SN4 A;  4KYP A;  4HWI A;  1BA1 A;  1ZVE A;  5AQL A;  1ZVG A;  1BMR A;  5AQW A;  3A8Y A;  1NRA A;  1YUW A;  5AQO A;  3R2V A;  3E7R L;  1HPM A;  2N69 A;  1AYJ A;  2QWP A;  4AEI A;  3C7N B;  5AQR A;  1CN2 A;  2QWL A;  4GNI A;  3ATU A;  1ATS A;  1HX1 A;  2LJM A;  3FZH A;  5AQP A;  2KHO A;  4AAZ A;  2E88 A;  2LT8 A; 
#chains in the Genus database with same CATH homology
 1P00 A;  1CHZ A;  2KBK A;  1L4V A;  1T7E A;  2SN3 A;  1ZFU A;  1I2V A;  2NY8 X;  1PX9 A;  3E7U X;  1JZB A;  1SNB A;  2LI7 A;  2KPY A;  1DQ7 A;  2ATB A;  4HHF A;  1NRB A;  1ZYW A;  3PSM A;  2E0H A;  1I2U A;  1T7A A;  2YC1 C;  1MYN A;  1KV0 A;  2YBR C;  1VNA A;  5CY0 A;  1ZYV A;  2B68 A;  1NE5 A;  2LJ7 A;  1FH3 A;  1BK8 A;  5KK4 A;  1ZUT A;  4AB0 A;  1JZA A;  2A7T A;  2I61 A;  2LY6 A;  1AHO A;  1NPI A;  2B3C A;  4CQK A;  1P0A A;  2KSK A;  2M8B B;  1T0Z A;  2YEO A;  1B7D A;  1WT7 A;  1WWN A;  2E3G A;  1LQQ A;  2KGQ A;  1BCG A;  4V1D C;  2LR3 A;  2GL1 A;  2KYQ A;  1PTX A;  2KBH A;  1SN1 A;  2N2Q A;  2KBJ A;  1NH5 A;  1LQH A;  1MR4 A;  1N4N A;  1ZU3 A;  1I6F A;  2E3F A;  1JKZ A;  1JXC A;  1BRZ A;  2N66 A;  1LQI A;  1GPT A;  2BRZ A;  1C56 A;  2LY5 A;  2MZ0 A;  2KJA A;  1T7B A;  4UJ0 A;  1SEG A;  1VNB A;  1OMY A;  1GPS A;  2N2R A;  2ASC A;  1OZZ A;  2NY9 X;  1TI5 A;  2LKB A;  4HE7 A;  1B3C A;  1I6G A;  1WMT A;  1C55 A;  1ICA A;  1PE4 A;  1T1T A;  1DJT A;  1SN4 A;  4KYP A;  1ZVE A;  1ZVG A;  1BMR A;  1NRA A;  3E7R L;  2N69 A;  1AYJ A;  4AEI A;  1CN2 A;  2LJM A;  4AAZ A;  2LT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...