1JZBA

Crystal structure of variant 2 scorpion toxin from centruroides sculpturatus ewing
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
KEGYLVNKSTGCKYGCLKLGENEGCDKECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN 2
publication title Structure of variant 2 scorpion toxin from Centruroides sculpturatus Ewing.
pubmed doi rcsb
molecule tags Toxin
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2001-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1jzbA00
1T0ZA 1ZFUA 5CY0A 1VNBA 2MZ0A 2KPYA 1OZZA 1BCGA 1NRBA 2N2QA 2YC1C 1JXCA 2N69A 2NY9X 2LR3A 1NPIA 1ZU3A 4AAZA 2A7TA 1AYJA 1AHOA 1JZBA 1BMRA 2B68A 3E7UX 1FH3A 1VNAA 1CHZA 3E7RL 4HE7A 2KYQA 2B3CA 2N2RA 2KGQA 1WWNA 2E3GA 1ZVGA 2GL1A 4AB0A 1OMYA 2NY8X 1B3CA 4KYPA 1MYNA 2BRZA 1I2VA 1SEGA 2E0HA 2KBHA 1I6FA 1T7BA 3PSMA 4V1DC 1GPSA 1T7AA 1C55A 1L4VA 4AEIA 1P00A 2I61A 1DQ7A 2SN3A 1T1TA 2ASCA 1ZYWA 1B7DA 2KJAA 1PTXA 1JKZA 1JZAA 1TI5A 2KBJA 2N66A 2LI7A 4HHFA 1N4NA 1ZYVA 2ATBA 1BK8A 1DJTA 1NH5A 1T7EA 1I2UA 1NE5A 1WMTA 1NRAA 4UJ0A 1GPTA 1C56A 1WT7A 1SN1A 1SN4A 1P0AA 2LKBA 2LJ7A 1PX9A 1CN2A 2KSKA 2YBRC 1BRZA 2M8BB 2LT8A 2YEOA 2LY5A 1PE4A 1I6GA 1KV0A 1LQIA 1ZUTA 1MR4A 1LQQA 1ZVEA 2LJMA 1ICAA 1LQHA 2KBKA 2LY6A 5KK4A 2E3FA 4CQKA 1SNBA
chains in the Genus database with same CATH superfamily
1T0ZA 2VY6A 1ZFUA 1NGEA 3FZHA 5FPMA 3R2VA 3D2FA 1VNBA 5CY0A 5F0XA 2MZ0A 1BUPA 5AQJA 5AQMA 3BK3C 2KPYA 3KOYA 4UADE 1OZZA 5AQUA 4HWIA 1BCGA 1NRBA 1BA0A 2N2QA 2YC1C 1JXCA 2N69A 1NGJA 2NY9X 3LDLA 4GNIA 5AR0A 3QMLA 2LR3A 1NPIA 1ZU3A 3C7NA 1BA1A 5AQKA 3KHWA 1ATRA 1KAYA 2A7TA 5AQGA 4AAZA 1AYJA 1AHOA 3M3ZA 2GMOA 1JZBA 1BMRA 2B68A 3E7UX 1UGLA 1FH3A 3KVGA 1VNAA 1NGAA 3AY9A 1CHZA 3HSCA 3E7RL 4HE7A 2LN8A 3KOXA 1HPMA 4H5RA 1HX1A 1QQOA 2KYQA 2B3CA 2N2RA 2KGQA 1WWNA 5EX5A 3IUCA 2E3GA 1POIA 1ZVGA 5FPEA 2GL1A 3FZLA 3LDPA 4AB0A 5F1XA 5AQYA 2MBKA 3QI7A 3ATUA 1OMYA 3FZMA 3L4IA 2QWLA 5AQSA 2G2KA 2NY8X 2YIPA 1B3CA 4KYPA 5AQRA 1MYNA 5AQLA 1DKGD 2BRZA 5AQFA 2QWOA 2K35A 1I2VA 1SEGA 3LDQA 2E0HA 1NGCA 2KBHA 1I6FA 5AQHA 2QW9A 1K8BA 1T7BA 3PSMA 4V1DC 1GPSA 1T7AA 1C55A 1NGFA 4AEIA 1P00A 1NGBA 2I61A 1DQ7A 2QWMA 1T1TA 1ZYWA 2ASCA 1S3XA 2SN3A 1B7DA 3GKUA 4H5WA 3FZFA 2KHOA 2V7ZA 2QWNA 2KJAA 1PTXA 1YUWA 2E88A 3KC6A 1JKZA 5BN9A 2QWPA 5BPMA 1JZAA 1TI5A 4H5VA 3L6QA 2KBJA 3KOZA 2N66A 4FL9A 2LI7A 5AQQA 1NGIA 4HHFA 1KAXA 5BPNA 1N4NA 1ZYVA 5AQWA 3ATVA 2ATBA 5AQNA 1HJOA 2YIOA 2D56A 2E2FA 3GDQA 5BN8A 1BK8A 5AQIA 1DJTA 1NH5A 2QWQA 3KOWA 1KAZA 1T7EA 2QWRA 1I2UA 1NE5A 1WMTA 1NRAA 5EXWA 4UJ0A 1NGGA 2YILA 3D2EB 4H5NA 4FSVA 1GPTA 2E8AA 1QQNA 1C56A 1WT7A 3QFPA 1SN1A 1SN4A 1P0AA 2LKBA 3I33A 2LJ7A 3KP0A 4IO8A 3GL1A 1PX9A 3JXUA 5AQZA 1CN2A 4UAEF 2KSKA 5BPLA 2JDQD 2YBRC 3L56A 5FPDA 1BRZA 2M8BB 5EY4A 3FZKA 4UAFE 2LT8A 5FPNA 2YEOA 5F2RA 1L4VA 2QXLA 4KBOA 3FE1A 5AQVA 3QFUA 1NGHA 2LY5A 1PE4A 3D2EA 4H5TA 1I6GA 1KV0A 3D2FB 1LQIA 3A8YA 3KP1A 3LDNA 1ZUTA 3CQXA 5AQTA 3SF4D 1MR4A 5EVZA 2BUPA 1LQQA 2MN5A 1ZVEA 5AQXA 2LJMA 1ATSA 1QQMA 1LQHA 1ICAA 2KBKA 2LY6A 5KK4A 1NGDA 2E3FA 3C7NB 4CQKA 5AQPA 3CW4A 3LDOA 5AQOA 1SNBA 1XRSB
chains in the Genus database with same CATH topology
1T0ZA 1ZFUA 5CY0A 1VNBA 2MZ0A 2KPYA 1OZZA 1BCGA 1NRBA 2N2QA 2YC1C 1JXCA 2N69A 2NY9X 2LR3A 1NPIA 1ZU3A 4AAZA 2A7TA 1AYJA 1AHOA 1JZBA 1BMRA 2B68A 3E7UX 1FH3A 1VNAA 1CHZA 3E7RL 4HE7A 2KYQA 2B3CA 2N2RA 2KGQA 1WWNA 2E3GA 1ZVGA 2GL1A 4AB0A 1OMYA 2NY8X 1B3CA 4KYPA 1MYNA 2BRZA 1I2VA 1SEGA 2E0HA 2KBHA 1I6FA 1T7BA 3PSMA 4V1DC 1GPSA 1T7AA 1C55A 1L4VA 4AEIA 1P00A 2I61A 1DQ7A 2SN3A 1T1TA 2ASCA 1ZYWA 1B7DA 2KJAA 1PTXA 1JKZA 1JZAA 1TI5A 2KBJA 2N66A 2LI7A 4HHFA 1N4NA 1ZYVA 2ATBA 1BK8A 1DJTA 1NH5A 1T7EA 1I2UA 1NE5A 1WMTA 1NRAA 4UJ0A 1GPTA 1C56A 1WT7A 1SN1A 1SN4A 1P0AA 2LKBA 2LJ7A 1PX9A 1CN2A 2KSKA 2YBRC 1BRZA 2M8BB 2LT8A 2YEOA 2LY5A 1PE4A 1I6GA 1KV0A 1LQIA 1ZUTA 1MR4A 1LQQA 1ZVEA 2LJMA 1ICAA 1LQHA 2KBKA 2LY6A 5KK4A 2E3FA 4CQKA 1SNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Z A;  1ZFU A;  5CY0 A;  1VNB A;  2MZ0 A;  2KPY A;  1OZZ A;  1BCG A;  1NRB A;  2N2Q A;  2YC1 C;  1JXC A;  2N69 A;  2NY9 X;  2LR3 A;  1NPI A;  1ZU3 A;  4AAZ A;  2A7T A;  1AYJ A;  1AHO A;  1JZB A;  1BMR A;  2B68 A;  3E7U X;  1FH3 A;  1VNA A;  1CHZ A;  3E7R L;  4HE7 A;  2KYQ A;  2B3C A;  2N2R A;  2KGQ A;  1WWN A;  2E3G A;  1ZVG A;  2GL1 A;  4AB0 A;  1OMY A;  2NY8 X;  1B3C A;  4KYP A;  1MYN A;  2BRZ A;  1I2V A;  1SEG A;  2E0H A;  2KBH A;  1I6F A;  1T7B A;  3PSM A;  4V1D C;  1GPS A;  1T7A A;  1C55 A;  1L4V A;  4AEI A;  1P00 A;  2I61 A;  1DQ7 A;  2SN3 A;  1T1T A;  2ASC A;  1ZYW A;  1B7D A;  2KJA A;  1PTX A;  1JKZ A;  1JZA A;  1TI5 A;  2KBJ A;  2N66 A;  2LI7 A;  4HHF A;  1N4N A;  1ZYV A;  2ATB A;  1BK8 A;  1DJT A;  1NH5 A;  1T7E A;  1I2U A;  1NE5 A;  1WMT A;  1NRA A;  4UJ0 A;  1GPT A;  1C56 A;  1WT7 A;  1SN1 A;  1SN4 A;  1P0A A;  2LKB A;  2LJ7 A;  1PX9 A;  1CN2 A;  2KSK A;  2YBR C;  1BRZ A;  2M8B B;  2LT8 A;  2YEO A;  2LY5 A;  1PE4 A;  1I6G A;  1KV0 A;  1LQI A;  1ZUT A;  1MR4 A;  1LQQ A;  1ZVE A;  2LJM A;  1ICA A;  1LQH A;  2KBK A;  2LY6 A;  5KK4 A;  2E3F A;  4CQK A;  1SNB A; 
#chains in the Genus database with same CATH topology
 1T0Z A;  2VY6 A;  1ZFU A;  1NGE A;  3FZH A;  5FPM A;  3R2V A;  3D2F A;  1VNB A;  5CY0 A;  5F0X A;  2MZ0 A;  1BUP A;  5AQJ A;  5AQM A;  3BK3 C;  2KPY A;  3KOY A;  4UAD E;  1OZZ A;  5AQU A;  4HWI A;  1BCG A;  1NRB A;  1BA0 A;  2N2Q A;  2YC1 C;  1JXC A;  2N69 A;  1NGJ A;  2NY9 X;  3LDL A;  4GNI A;  5AR0 A;  3QML A;  2LR3 A;  1NPI A;  1ZU3 A;  3C7N A;  1BA1 A;  5AQK A;  3KHW A;  1ATR A;  1KAY A;  2A7T A;  5AQG A;  4AAZ A;  1AYJ A;  1AHO A;  3M3Z A;  2GMO A;  1JZB A;  1BMR A;  2B68 A;  3E7U X;  1UGL A;  1FH3 A;  3KVG A;  1VNA A;  1NGA A;  3AY9 A;  1CHZ A;  3HSC A;  3E7R L;  4HE7 A;  2LN8 A;  3KOX A;  1HPM A;  4H5R A;  1HX1 A;  1QQO A;  2KYQ A;  2B3C A;  2N2R A;  2KGQ A;  1WWN A;  5EX5 A;  3IUC A;  2E3G A;  1POI A;  1ZVG A;  5FPE A;  2GL1 A;  3FZL A;  3LDP A;  4AB0 A;  5F1X A;  5AQY A;  2MBK A;  3QI7 A;  3ATU A;  1OMY A;  3FZM A;  3L4I A;  2QWL A;  5AQS A;  2G2K A;  2NY8 X;  2YIP A;  1B3C A;  4KYP A;  5AQR A;  1MYN A;  5AQL A;  1DKG D;  2BRZ A;  5AQF A;  2QWO A;  2K35 A;  1I2V A;  1SEG A;  3LDQ A;  2E0H A;  1NGC A;  2KBH A;  1I6F A;  5AQH A;  2QW9 A;  1K8B A;  1T7B A;  3PSM A;  4V1D C;  1GPS A;  1T7A A;  1C55 A;  1NGF A;  4AEI A;  1P00 A;  1NGB A;  2I61 A;  1DQ7 A;  2QWM A;  1T1T A;  1ZYW A;  2ASC A;  1S3X A;  2SN3 A;  1B7D A;  3GKU A;  4H5W A;  3FZF A;  2KHO A;  2V7Z A;  2QWN A;  2KJA A;  1PTX A;  1YUW A;  2E88 A;  3KC6 A;  1JKZ A;  5BN9 A;  2QWP A;  5BPM A;  1JZA A;  1TI5 A;  4H5V A;  3L6Q A;  2KBJ A;  3KOZ A;  2N66 A;  4FL9 A;  2LI7 A;  5AQQ A;  1NGI A;  4HHF A;  1KAX A;  5BPN A;  1N4N A;  1ZYV A;  5AQW A;  3ATV A;  2ATB A;  5AQN A;  1HJO A;  2YIO A;  2D56 A;  2E2F A;  3GDQ A;  5BN8 A;  1BK8 A;  5AQI A;  1DJT A;  1NH5 A;  2QWQ A;  3KOW A;  1KAZ A;  1T7E A;  2QWR A;  1I2U A;  1NE5 A;  1WMT A;  1NRA A;  5EXW A;  4UJ0 A;  1NGG A;  2YIL A;  3D2E B;  4H5N A;  4FSV A;  1GPT A;  2E8A A;  1QQN A;  1C56 A;  1WT7 A;  3QFP A;  1SN1 A;  1SN4 A;  1P0A A;  2LKB A;  3I33 A;  2LJ7 A;  3KP0 A;  4IO8 A;  3GL1 A;  1PX9 A;  3JXU A;  5AQZ A;  1CN2 A;  4UAE F;  2KSK A;  5BPL A;  2JDQ D;  2YBR C;  3L56 A;  5FPD A;  1BRZ A;  2M8B B;  5EY4 A;  3FZK A;  4UAF E;  2LT8 A;  5FPN A;  2YEO A;  5F2R A;  1L4V A;  2QXL A;  4KBO A;  3FE1 A;  5AQV A;  3QFU A;  1NGH A;  2LY5 A;  1PE4 A;  3D2E A;  4H5T A;  1I6G A;  1KV0 A;  3D2F B;  1LQI A;  3A8Y A;  3KP1 A;  3LDN A;  1ZUT A;  3CQX A;  5AQT A;  3SF4 D;  1MR4 A;  5EVZ A;  2BUP A;  1LQQ A;  2MN5 A;  1ZVE A;  5AQX A;  2LJM A;  1ATS A;  1QQM A;  1LQH A;  1ICA A;  2KBK A;  2LY6 A;  5KK4 A;  1NGD A;  2E3F A;  3C7N B;  4CQK A;  5AQP A;  3CW4 A;  3LDO A;  5AQO A;  1SNB A;  1XRS B; 
#chains in the Genus database with same CATH homology
 1T0Z A;  1ZFU A;  5CY0 A;  1VNB A;  2MZ0 A;  2KPY A;  1OZZ A;  1BCG A;  1NRB A;  2N2Q A;  2YC1 C;  1JXC A;  2N69 A;  2NY9 X;  2LR3 A;  1NPI A;  1ZU3 A;  4AAZ A;  2A7T A;  1AYJ A;  1AHO A;  1JZB A;  1BMR A;  2B68 A;  3E7U X;  1FH3 A;  1VNA A;  1CHZ A;  3E7R L;  4HE7 A;  2KYQ A;  2B3C A;  2N2R A;  2KGQ A;  1WWN A;  2E3G A;  1ZVG A;  2GL1 A;  4AB0 A;  1OMY A;  2NY8 X;  1B3C A;  4KYP A;  1MYN A;  2BRZ A;  1I2V A;  1SEG A;  2E0H A;  2KBH A;  1I6F A;  1T7B A;  3PSM A;  4V1D C;  1GPS A;  1T7A A;  1C55 A;  1L4V A;  4AEI A;  1P00 A;  2I61 A;  1DQ7 A;  2SN3 A;  1T1T A;  2ASC A;  1ZYW A;  1B7D A;  2KJA A;  1PTX A;  1JKZ A;  1JZA A;  1TI5 A;  2KBJ A;  2N66 A;  2LI7 A;  4HHF A;  1N4N A;  1ZYV A;  2ATB A;  1BK8 A;  1DJT A;  1NH5 A;  1T7E A;  1I2U A;  1NE5 A;  1WMT A;  1NRA A;  4UJ0 A;  1GPT A;  1C56 A;  1WT7 A;  1SN1 A;  1SN4 A;  1P0A A;  2LKB A;  2LJ7 A;  1PX9 A;  1CN2 A;  2KSK A;  2YBR C;  1BRZ A;  2M8B B;  2LT8 A;  2YEO A;  2LY5 A;  1PE4 A;  1I6G A;  1KV0 A;  1LQI A;  1ZUT A;  1MR4 A;  1LQQ A;  1ZVE A;  2LJM A;  1ICA A;  1LQH A;  2KBK A;  2LY6 A;  5KK4 A;  2E3F A;  4CQK A;  1SNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...