1JZBA

Crystal structure of variant 2 scorpion toxin from centruroides sculpturatus ewing
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
b'KEGYLVNKSTGCKYGCLKLGENEGCDKECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN 2
publication title Structure of variant 2 scorpion toxin from Centruroides sculpturatus Ewing.
pubmed doi rcsb
molecule tags Toxin
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2001-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1jzbA00
2GL1A 4AEIA 1I2UA 1NH5A 2LY6A 3PSMA 2KBJA 1VNBA 4HE7A 2BRZA 2KBHA 1I6GA 2A7TA 2LI7A 1MR4A 1OZZA 1JZBA 4HHFA 4UJ0A 1LQHA 1WWNA 2SN3A 2NY9X 2KGQA 1ZYWA 1P00A 1T7AA 1L4VA 2LT8A 2KBKA 1WT7A 2B68A 1BCGA 4V1DC 1N4NA 2LJMA 1BMRA 2KJAA 1JZAA 1LQQA 1NRAA 3E7UX 1NRBA 2KPYA 1OMYA 2YC1C 1I6FA 4CQKA 1ZVEA 1FH3A 1GPSA 2YBRC 1BK8A 1ZU3A 1LQIA 2E0HA 1C55A 1ZFUA 4KYPA 1JKZA 2N2RA 1SN4A 2I61A 2N66A 1GPTA 1SEGA 1CHZA 1WMTA 2N69A 1T0ZA 1ZYVA 1T7EA 1DJTA 1SNBA 1SN1A 2KYQA 2M8BB 2B3CA 2MZ0A 2LKBA 1I2VA 1VNAA 1MYNA 1T7BA 1DQ7A 1ICAA 1NPIA 2ATBA 2NY8X 1AYJA 1BRZA 1AHOA 1TI5A 1KV0A 1ZUTA 5CY0A 1T1TA 2LJ7A 4AAZA 1B7DA 1NE5A 1PTXA 2LY5A 1C56A 5KK4A 1B3CA 2E3FA 1JXCA 2ASCA 1PE4A 1P0AA 2YEOA 2N2QA 2E3GA 2KSKA 1PX9A 1ZVGA 1CN2A 3E7RL 4AB0A 2LR3A
chains in the Genus database with same CATH superfamily
5AQOA 2GL1A 2YIOA 4FL9A 4AEIA 1I2UA 1NH5A 2LY6A 5BPMA 5F0XA 3PSMA 2QWQA 5AQKA 5CY0A 2KBJA 1VNBA 5AR0A 5BPLA 4HE7A 1DKGD 2BRZA 2KBHA 3KC6A 5EVZA 1I6GA 2A7TA 2LI7A 1MR4A 1NGGA 1XRSB 3L56A 4H5RA 1OZZA 2KHOA 1JZBA 3KHWA 4HHFA 1LQHA 2VY6A 4UJ0A 1WWNA 3FZHA 1NGEA 2SN3A 1BUPA 1QQNA 5AQXA 4H5WA 2QWPA 2NY9X 2KGQA 1ZYWA 1P00A 3FZFA 1HPMA 3FZKA 1T7AA 2MBKA 1L4VA 2LT8A 2KBKA 1WT7A 2MN5A 3QMLA 2B68A 4UADE 1BCGA 5F1XA 5AQJA 2V7ZA 1N4NA 2LJMA 4V1DC 1BMRA 2KJAA 2QWOA 1JZAA 1LQQA 3D2FB 4H5TA 2E8AA 1NRAA 1QQOA 1NRBA 3E7UX 2KPYA 1OMYA 1NGHA 3LDOA 1YUWA 2YC1C 1I6FA 1NGJA 4CQKA 1ZVEA 5AQUA 5EXWA 1FH3A 1GPSA 2YBRC 3KOXA 3ATUA 5AQSA 3KP0A 3QI7A 1ZU3A 1LQIA 1BK8A 2BUPA 2E0HA 5FPMA 1C55A 3A8YA 1ZFUA 4KYPA 1JKZA 2N2RA 1SN4A 2I61A 1NGDA 5AQIA 2N66A 3FE1A 5AQLA 1GPTA 1SEGA 1UGLA 1CHZA 1BA0A 3LDNA 4HWIA 1WMTA 3L6QA 4IO8A 2N69A 2YIPA 5AQGA 3D2FA 5AQQA 1T0ZA 3C7NB 5AQRA 5EY4A 5AQYA 1S3XA 1ZYVA 3CW4A 1T7EA 1KAXA 1DJTA 5AQWA 1HJOA 1HX1A 5AQMA 2QWNA 3QFPA 2LR3A 1POIA 1SNBA 2QWLA 3CQXA 1SN1A 5FPEA 1ATSA 2K35A 2KYQA 2M8BB 3FZMA 2GMOA 2JDQD 5FPNA 3KVGA 4UAFE 2B3CA 3BK3C 5AQNA 2MZ0A 2LKBA 1I2VA 1VNAA 3LDPA 1KAYA 1MYNA 2E2FA 1T7BA 5AQPA 1DQ7A 2G2KA 5EX5A 3LDQA 1ICAA 1NPIA 1KAZA 2D56A 3LDLA 1NGIA 5BPNA 2ATBA 5BN9A 2NY8X 1AYJA 5AQFA 3SF4D 3D2EB 1AHOA 3KOWA 1BRZA 2QWRA 1NGAA 3IUCA 2QWMA 1TI5A 1KV0A 1ZUTA 3R2VA 4FSVA 1T1TA 2LJ7A 3C7NA 4AAZA 1BA1A 3KOZA 5AQHA 1B7DA 3M3ZA 4GNIA 5AQVA 1K8BA 3I33A 1NE5A 1ATRA 1PTXA 2LY5A 3ATVA 3QFUA 1C56A 3KP1A 5BN8A 5KK4A 5FPDA 4KBOA 2QW9A 4H5NA 1B3CA 2YILA 2E3FA 3AY9A 3KOYA 5AQZA 1JXCA 1NGCA 2ASCA 1PE4A 3L4IA 5AQTA 1P0AA 5F2RA 2QXLA 2YEOA 3GDQA 3FZLA 2N2QA 1NGFA 2E3GA 2KSKA 4UAEF 1PX9A 3D2EA 1QQMA 1ZVGA 3JXUA 1CN2A 3GKUA 3HSCA 3E7RL 4H5VA 3GL1A 4AB0A 2E88A 2LN8A 1NGBA
chains in the Genus database with same CATH topology
2GL1A 4AEIA 1I2UA 1NH5A 2LY6A 3PSMA 2KBJA 1VNBA 4HE7A 2BRZA 2KBHA 1I6GA 2A7TA 2LI7A 1MR4A 1OZZA 1JZBA 4HHFA 4UJ0A 1LQHA 1WWNA 2SN3A 2NY9X 2KGQA 1ZYWA 1P00A 1T7AA 1L4VA 2LT8A 2KBKA 1WT7A 2B68A 1BCGA 4V1DC 1N4NA 2LJMA 1BMRA 2KJAA 1JZAA 1LQQA 1NRAA 3E7UX 1NRBA 2KPYA 1OMYA 2YC1C 1I6FA 4CQKA 1ZVEA 1FH3A 1GPSA 2YBRC 1BK8A 1ZU3A 1LQIA 2E0HA 1C55A 1ZFUA 4KYPA 1JKZA 2N2RA 1SN4A 2I61A 2N66A 1GPTA 1SEGA 1CHZA 1WMTA 2N69A 1T0ZA 1ZYVA 1T7EA 1DJTA 1SNBA 1SN1A 2KYQA 2M8BB 2B3CA 2MZ0A 2LKBA 1I2VA 1VNAA 1MYNA 1T7BA 1DQ7A 1ICAA 1NPIA 2ATBA 2NY8X 1AYJA 1BRZA 1AHOA 1TI5A 1KV0A 1ZUTA 5CY0A 1T1TA 2LJ7A 4AAZA 1B7DA 1NE5A 1PTXA 2LY5A 1C56A 5KK4A 1B3CA 2E3FA 1JXCA 2ASCA 1PE4A 1P0AA 2YEOA 2N2QA 2E3GA 2KSKA 1PX9A 1ZVGA 1CN2A 3E7RL 4AB0A 2LR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GL1 A;  4AEI A;  1I2U A;  1NH5 A;  2LY6 A;  3PSM A;  2KBJ A;  1VNB A;  4HE7 A;  2BRZ A;  2KBH A;  1I6G A;  2A7T A;  2LI7 A;  1MR4 A;  1OZZ A;  1JZB A;  4HHF A;  4UJ0 A;  1LQH A;  1WWN A;  2SN3 A;  2NY9 X;  2KGQ A;  1ZYW A;  1P00 A;  1T7A A;  1L4V A;  2LT8 A;  2KBK A;  1WT7 A;  2B68 A;  1BCG A;  4V1D C;  1N4N A;  2LJM A;  1BMR A;  2KJA A;  1JZA A;  1LQQ A;  1NRA A;  3E7U X;  1NRB A;  2KPY A;  1OMY A;  2YC1 C;  1I6F A;  4CQK A;  1ZVE A;  1FH3 A;  1GPS A;  2YBR C;  1BK8 A;  1ZU3 A;  1LQI A;  2E0H A;  1C55 A;  1ZFU A;  4KYP A;  1JKZ A;  2N2R A;  1SN4 A;  2I61 A;  2N66 A;  1GPT A;  1SEG A;  1CHZ A;  1WMT A;  2N69 A;  1T0Z A;  1ZYV A;  1T7E A;  1DJT A;  1SNB A;  1SN1 A;  2KYQ A;  2M8B B;  2B3C A;  2MZ0 A;  2LKB A;  1I2V A;  1VNA A;  1MYN A;  1T7B A;  1DQ7 A;  1ICA A;  1NPI A;  2ATB A;  2NY8 X;  1AYJ A;  1BRZ A;  1AHO A;  1TI5 A;  1KV0 A;  1ZUT A;  5CY0 A;  1T1T A;  2LJ7 A;  4AAZ A;  1B7D A;  1NE5 A;  1PTX A;  2LY5 A;  1C56 A;  5KK4 A;  1B3C A;  2E3F A;  1JXC A;  2ASC A;  1PE4 A;  1P0A A;  2YEO A;  2N2Q A;  2E3G A;  2KSK A;  1PX9 A;  1ZVG A;  1CN2 A;  3E7R L;  4AB0 A;  2LR3 A; 
#chains in the Genus database with same CATH topology
 5AQO A;  2GL1 A;  2YIO A;  4FL9 A;  4AEI A;  1I2U A;  1NH5 A;  2LY6 A;  5BPM A;  5F0X A;  3PSM A;  2QWQ A;  5AQK A;  5CY0 A;  2KBJ A;  1VNB A;  5AR0 A;  5BPL A;  4HE7 A;  1DKG D;  2BRZ A;  2KBH A;  3KC6 A;  5EVZ A;  1I6G A;  2A7T A;  2LI7 A;  1MR4 A;  1NGG A;  1XRS B;  3L56 A;  4H5R A;  1OZZ A;  2KHO A;  1JZB A;  3KHW A;  4HHF A;  1LQH A;  2VY6 A;  4UJ0 A;  1WWN A;  3FZH A;  1NGE A;  2SN3 A;  1BUP A;  1QQN A;  5AQX A;  4H5W A;  2QWP A;  2NY9 X;  2KGQ A;  1ZYW A;  1P00 A;  3FZF A;  1HPM A;  3FZK A;  1T7A A;  2MBK A;  1L4V A;  2LT8 A;  2KBK A;  1WT7 A;  2MN5 A;  3QML A;  2B68 A;  4UAD E;  1BCG A;  5F1X A;  5AQJ A;  2V7Z A;  1N4N A;  2LJM A;  4V1D C;  1BMR A;  2KJA A;  2QWO A;  1JZA A;  1LQQ A;  3D2F B;  4H5T A;  2E8A A;  1NRA A;  1QQO A;  1NRB A;  3E7U X;  2KPY A;  1OMY A;  1NGH A;  3LDO A;  1YUW A;  2YC1 C;  1I6F A;  1NGJ A;  4CQK A;  1ZVE A;  5AQU A;  5EXW A;  1FH3 A;  1GPS A;  2YBR C;  3KOX A;  3ATU A;  5AQS A;  3KP0 A;  3QI7 A;  1ZU3 A;  1LQI A;  1BK8 A;  2BUP A;  2E0H A;  5FPM A;  1C55 A;  3A8Y A;  1ZFU A;  4KYP A;  1JKZ A;  2N2R A;  1SN4 A;  2I61 A;  1NGD A;  5AQI A;  2N66 A;  3FE1 A;  5AQL A;  1GPT A;  1SEG A;  1UGL A;  1CHZ A;  1BA0 A;  3LDN A;  4HWI A;  1WMT A;  3L6Q A;  4IO8 A;  2N69 A;  2YIP A;  5AQG A;  3D2F A;  5AQQ A;  1T0Z A;  3C7N B;  5AQR A;  5EY4 A;  5AQY A;  1S3X A;  1ZYV A;  3CW4 A;  1T7E A;  1KAX A;  1DJT A;  5AQW A;  1HJO A;  1HX1 A;  5AQM A;  2QWN A;  3QFP A;  2LR3 A;  1POI A;  1SNB A;  2QWL A;  3CQX A;  1SN1 A;  5FPE A;  1ATS A;  2K35 A;  2KYQ A;  2M8B B;  3FZM A;  2GMO A;  2JDQ D;  5FPN A;  3KVG A;  4UAF E;  2B3C A;  3BK3 C;  5AQN A;  2MZ0 A;  2LKB A;  1I2V A;  1VNA A;  3LDP A;  1KAY A;  1MYN A;  2E2F A;  1T7B A;  5AQP A;  1DQ7 A;  2G2K A;  5EX5 A;  3LDQ A;  1ICA A;  1NPI A;  1KAZ A;  2D56 A;  3LDL A;  1NGI A;  5BPN A;  2ATB A;  5BN9 A;  2NY8 X;  1AYJ A;  5AQF A;  3SF4 D;  3D2E B;  1AHO A;  3KOW A;  1BRZ A;  2QWR A;  1NGA A;  3IUC A;  2QWM A;  1TI5 A;  1KV0 A;  1ZUT A;  3R2V A;  4FSV A;  1T1T A;  2LJ7 A;  3C7N A;  4AAZ A;  1BA1 A;  3KOZ A;  5AQH A;  1B7D A;  3M3Z A;  4GNI A;  5AQV A;  1K8B A;  3I33 A;  1NE5 A;  1ATR A;  1PTX A;  2LY5 A;  3ATV A;  3QFU A;  1C56 A;  3KP1 A;  5BN8 A;  5KK4 A;  5FPD A;  4KBO A;  2QW9 A;  4H5N A;  1B3C A;  2YIL A;  2E3F A;  3AY9 A;  3KOY A;  5AQZ A;  1JXC A;  1NGC A;  2ASC A;  1PE4 A;  3L4I A;  5AQT A;  1P0A A;  5F2R A;  2QXL A;  2YEO A;  3GDQ A;  3FZL A;  2N2Q A;  1NGF A;  2E3G A;  2KSK A;  4UAE F;  1PX9 A;  3D2E A;  1QQM A;  1ZVG A;  3JXU A;  1CN2 A;  3GKU A;  3HSC A;  3E7R L;  4H5V A;  3GL1 A;  4AB0 A;  2E88 A;  2LN8 A;  1NGB A; 
#chains in the Genus database with same CATH homology
 2GL1 A;  4AEI A;  1I2U A;  1NH5 A;  2LY6 A;  3PSM A;  2KBJ A;  1VNB A;  4HE7 A;  2BRZ A;  2KBH A;  1I6G A;  2A7T A;  2LI7 A;  1MR4 A;  1OZZ A;  1JZB A;  4HHF A;  4UJ0 A;  1LQH A;  1WWN A;  2SN3 A;  2NY9 X;  2KGQ A;  1ZYW A;  1P00 A;  1T7A A;  1L4V A;  2LT8 A;  2KBK A;  1WT7 A;  2B68 A;  1BCG A;  4V1D C;  1N4N A;  2LJM A;  1BMR A;  2KJA A;  1JZA A;  1LQQ A;  1NRA A;  3E7U X;  1NRB A;  2KPY A;  1OMY A;  2YC1 C;  1I6F A;  4CQK A;  1ZVE A;  1FH3 A;  1GPS A;  2YBR C;  1BK8 A;  1ZU3 A;  1LQI A;  2E0H A;  1C55 A;  1ZFU A;  4KYP A;  1JKZ A;  2N2R A;  1SN4 A;  2I61 A;  2N66 A;  1GPT A;  1SEG A;  1CHZ A;  1WMT A;  2N69 A;  1T0Z A;  1ZYV A;  1T7E A;  1DJT A;  1SNB A;  1SN1 A;  2KYQ A;  2M8B B;  2B3C A;  2MZ0 A;  2LKB A;  1I2V A;  1VNA A;  1MYN A;  1T7B A;  1DQ7 A;  1ICA A;  1NPI A;  2ATB A;  2NY8 X;  1AYJ A;  1BRZ A;  1AHO A;  1TI5 A;  1KV0 A;  1ZUT A;  5CY0 A;  1T1T A;  2LJ7 A;  4AAZ A;  1B7D A;  1NE5 A;  1PTX A;  2LY5 A;  1C56 A;  5KK4 A;  1B3C A;  2E3F A;  1JXC A;  2ASC A;  1PE4 A;  1P0A A;  2YEO A;  2N2Q A;  2E3G A;  2KSK A;  1PX9 A;  1ZVG A;  1CN2 A;  3E7R L;  4AB0 A;  2LR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...