1P00A

Nmr structure of etd151, mutant of the antifungal defensin ard1 from archaeoprepona demophon
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
b'DKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords defensin ARD1
publication title Lead optimization of antifungal peptides with 3D NMR structures analysis.
pubmed doi rcsb
source organism Archaeoprepona demophon
molecule tags Antifungal protein
total genus 7
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2003-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1p00A00
1T1TA 1PE4A 2SN3A 2NY8X 1I6FA 1AYJA 2KJAA 1ICAA 5CY0A 1WT7A 2N66A 2A7TA 2B68A 1C55A 1MR4A 1NRBA 2LT8A 1LQHA 1T7EA 2NY9X 4HHFA 1OMYA 1WWNA 4AB0A 2YEOA 1PX9A 2KBKA 1KV0A 2E0HA 4UJ0A 2ASCA 2LJMA 2MZ0A 4AEIA 2LR3A 2LY6A 4CQKA 1VNAA 1FH3A 2KGQA 1ZYVA 2E3FA 1AHOA 3PSMA 1NPIA 1N4NA 1GPSA 3E7RL 1SN1A 1BMRA 1DJTA 2LY5A 1SN4A 1P0AA 1TI5A 2LKBA 2KYQA 2KBHA 2KSKA 2LJ7A 1MYNA 2GL1A 2KBJA 1BK8A 1GPTA 2N2QA 2YC1C 1ZFUA 1B7DA 1LQQA 1OZZA 1ZVEA 4KYPA 1ZUTA 2N69A 1ZYWA 2N2RA 1JZBA 1BRZA 2BRZA 1I2VA 4HE7A 1T0ZA 1P00A 1NE5A 1LQIA 1C56A 1JKZA 2E3GA 5KK4A 1CHZA 2M8BB 1L4VA 1SEGA 4V1DC 1VNBA 2KPYA 1B3CA 1PTXA 1I2UA 1T7BA 1BCGA 1NH5A 1SNBA 1ZVGA 1I6GA 2I61A 4AAZA 1JZAA 1T7AA 2YBRC 1DQ7A 1NRAA 1WMTA 3E7UX 2B3CA 1ZU3A 1CN2A 2LI7A 2ATBA 1JXCA
chains in the Genus database with same CATH superfamily
1T1TA 3GL1A 3KP0A 1NGEA 2VY6A 5AQRA 1PE4A 2SN3A 3QMLA 2NY8X 3GDQA 1I6FA 1AYJA 1BA1A 5BPMA 2KJAA 1XRSB 1BUPA 3BK3C 3ATUA 1HJOA 5AQFA 3KVGA 1NGFA 1ICAA 1K8BA 5CY0A 1WT7A 2N66A 5FPEA 3LDQA 1YUWA 2A7TA 2B68A 5AQMA 1C55A 2QWPA 1MR4A 1NRBA 2BUPA 2LT8A 1LQHA 4H5TA 1NGCA 1T7EA 1S3XA 2NY9X 3FZLA 4H5RA 5BN8A 5AQVA 3IUCA 3QFPA 3CQXA 4H5NA 4HHFA 1OMYA 1WWNA 4AB0A 2YEOA 1QQMA 1PX9A 2KBKA 1KV0A 2GMOA 2E0HA 3D2EB 5EXWA 2MBKA 4UJ0A 2ASCA 2D56A 2LJMA 3A8YA 2MZ0A 3LDLA 4AEIA 5FPMA 2QW9A 2LR3A 2QWLA 3FZMA 5FPDA 1BA0A 2LY6A 1VNAA 3I33A 2KGQA 1ZYVA 2E3FA 4CQKA 1FH3A 1AHOA 3PSMA 5AR0A 4HWIA 2E88A 1NPIA 3HSCA 3KOWA 2K35A 3FZFA 1N4NA 5AQIA 1GPSA 3SF4D 5AQTA 3AY9A 1L4VA 1NGJA 3FZHA 3QI7A 3D2EA 3E7RL 1POIA 1SN1A 4H5VA 1BMRA 5AQGA 2LN8A 5FPNA 1HX1A 1DJTA 2LY5A 1SN4A 4FL9A 2KHOA 1P0AA 1TI5A 2LKBA 2KYQA 2KBHA 2KSKA 2LJ7A 2QXLA 1MYNA 5BN9A 2GL1A 2KBJA 1BK8A 1GPTA 3KC6A 2N2QA 3D2FB 1KAZA 2YC1C 1ZFUA 1B7DA 1LQQA 1OZZA 5AQHA 1ZVEA 3JXUA 4KYPA 1DKGD 1NGBA 1ZUTA 2N69A 2QWQA 3KHWA 5F0XA 2G2KA 2YIPA 5AQKA 1ZYWA 2N2RA 3C7NB 1JZBA 3KOZA 3LDNA 4H5WA 4KBOA 5AQLA 5AQQA 5AQWA 2BRZA 4IO8A 1BRZA 1I2VA 5AQPA 4HE7A 5AQOA 1NGHA 1T0ZA 1P00A 1NE5A 3L4IA 3GKUA 1NGGA 1LQIA 4UAEF 5BPLA 3L6QA 1C56A 3CW4A 1JKZA 2E3GA 4UADE 1KAYA 5AQJA 1CHZA 2MN5A 2YIOA 3D2FA 2M8BB 3M3ZA 1ATSA 5BPNA 5KK4A 1NGAA 2E8AA 3KOYA 3QFUA 1SEGA 2QWMA 1VNBA 4GNIA 4UAFE 1QQOA 4V1DC 5AQNA 5AQSA 2QWRA 2E2FA 2KPYA 1B3CA 2QWNA 3KP1A 1ATRA 1PTXA 3KOXA 5EY4A 5AQZA 1I2UA 1HPMA 3R2VA 1T7BA 3ATVA 4FSVA 1BCGA 1UGLA 1NH5A 1NGDA 1SNBA 3C7NA 1ZVGA 3FE1A 5F1XA 5EX5A 5EVZA 1I6GA 1NGIA 3FZKA 2I61A 4AAZA 1JZAA 2JDQD 5AQYA 1T7AA 1QQNA 5AQXA 1KAXA 5AQUA 3L56A 2YBRC 1DQ7A 1NRAA 1WMTA 3E7UX 2B3CA 3LDPA 1ZU3A 1CN2A 2LI7A 2YILA 2QWOA 3LDOA 2V7ZA 2ATBA 5F2RA 1JXCA
chains in the Genus database with same CATH topology
1T1TA 1PE4A 2SN3A 2NY8X 1I6FA 1AYJA 2KJAA 1ICAA 5CY0A 1WT7A 2N66A 2A7TA 2B68A 1C55A 1MR4A 1NRBA 2LT8A 1LQHA 1T7EA 2NY9X 4HHFA 1OMYA 1WWNA 4AB0A 2YEOA 1PX9A 2KBKA 1KV0A 2E0HA 4UJ0A 2ASCA 2LJMA 2MZ0A 4AEIA 2LR3A 2LY6A 4CQKA 1VNAA 1FH3A 2KGQA 1ZYVA 2E3FA 1AHOA 3PSMA 1NPIA 1N4NA 1GPSA 3E7RL 1SN1A 1BMRA 1DJTA 2LY5A 1SN4A 1P0AA 1TI5A 2LKBA 2KYQA 2KBHA 2KSKA 2LJ7A 1MYNA 2GL1A 2KBJA 1BK8A 1GPTA 2N2QA 2YC1C 1ZFUA 1B7DA 1LQQA 1OZZA 1ZVEA 4KYPA 1ZUTA 2N69A 1ZYWA 2N2RA 1JZBA 1BRZA 2BRZA 1I2VA 4HE7A 1T0ZA 1P00A 1NE5A 1LQIA 1C56A 1JKZA 2E3GA 5KK4A 1CHZA 2M8BB 1L4VA 1SEGA 4V1DC 1VNBA 2KPYA 1B3CA 1PTXA 1I2UA 1T7BA 1BCGA 1NH5A 1SNBA 1ZVGA 1I6GA 2I61A 4AAZA 1JZAA 1T7AA 2YBRC 1DQ7A 1NRAA 1WMTA 3E7UX 2B3CA 1ZU3A 1CN2A 2LI7A 2ATBA 1JXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1T A;  1PE4 A;  2SN3 A;  2NY8 X;  1I6F A;  1AYJ A;  2KJA A;  1ICA A;  5CY0 A;  1WT7 A;  2N66 A;  2A7T A;  2B68 A;  1C55 A;  1MR4 A;  1NRB A;  2LT8 A;  1LQH A;  1T7E A;  2NY9 X;  4HHF A;  1OMY A;  1WWN A;  4AB0 A;  2YEO A;  1PX9 A;  2KBK A;  1KV0 A;  2E0H A;  4UJ0 A;  2ASC A;  2LJM A;  2MZ0 A;  4AEI A;  2LR3 A;  2LY6 A;  4CQK A;  1VNA A;  1FH3 A;  2KGQ A;  1ZYV A;  2E3F A;  1AHO A;  3PSM A;  1NPI A;  1N4N A;  1GPS A;  3E7R L;  1SN1 A;  1BMR A;  1DJT A;  2LY5 A;  1SN4 A;  1P0A A;  1TI5 A;  2LKB A;  2KYQ A;  2KBH A;  2KSK A;  2LJ7 A;  1MYN A;  2GL1 A;  2KBJ A;  1BK8 A;  1GPT A;  2N2Q A;  2YC1 C;  1ZFU A;  1B7D A;  1LQQ A;  1OZZ A;  1ZVE A;  4KYP A;  1ZUT A;  2N69 A;  1ZYW A;  2N2R A;  1JZB A;  1BRZ A;  2BRZ A;  1I2V A;  4HE7 A;  1T0Z A;  1P00 A;  1NE5 A;  1LQI A;  1C56 A;  1JKZ A;  2E3G A;  5KK4 A;  1CHZ A;  2M8B B;  1L4V A;  1SEG A;  4V1D C;  1VNB A;  2KPY A;  1B3C A;  1PTX A;  1I2U A;  1T7B A;  1BCG A;  1NH5 A;  1SNB A;  1ZVG A;  1I6G A;  2I61 A;  4AAZ A;  1JZA A;  1T7A A;  2YBR C;  1DQ7 A;  1NRA A;  1WMT A;  3E7U X;  2B3C A;  1ZU3 A;  1CN2 A;  2LI7 A;  2ATB A;  1JXC A; 
#chains in the Genus database with same CATH topology
 1T1T A;  3GL1 A;  3KP0 A;  1NGE A;  2VY6 A;  5AQR A;  1PE4 A;  2SN3 A;  3QML A;  2NY8 X;  3GDQ A;  1I6F A;  1AYJ A;  1BA1 A;  5BPM A;  2KJA A;  1XRS B;  1BUP A;  3BK3 C;  3ATU A;  1HJO A;  5AQF A;  3KVG A;  1NGF A;  1ICA A;  1K8B A;  5CY0 A;  1WT7 A;  2N66 A;  5FPE A;  3LDQ A;  1YUW A;  2A7T A;  2B68 A;  5AQM A;  1C55 A;  2QWP A;  1MR4 A;  1NRB A;  2BUP A;  2LT8 A;  1LQH A;  4H5T A;  1NGC A;  1T7E A;  1S3X A;  2NY9 X;  3FZL A;  4H5R A;  5BN8 A;  5AQV A;  3IUC A;  3QFP A;  3CQX A;  4H5N A;  4HHF A;  1OMY A;  1WWN A;  4AB0 A;  2YEO A;  1QQM A;  1PX9 A;  2KBK A;  1KV0 A;  2GMO A;  2E0H A;  3D2E B;  5EXW A;  2MBK A;  4UJ0 A;  2ASC A;  2D56 A;  2LJM A;  3A8Y A;  2MZ0 A;  3LDL A;  4AEI A;  5FPM A;  2QW9 A;  2LR3 A;  2QWL A;  3FZM A;  5FPD A;  1BA0 A;  2LY6 A;  1VNA A;  3I33 A;  2KGQ A;  1ZYV A;  2E3F A;  4CQK A;  1FH3 A;  1AHO A;  3PSM A;  5AR0 A;  4HWI A;  2E88 A;  1NPI A;  3HSC A;  3KOW A;  2K35 A;  3FZF A;  1N4N A;  5AQI A;  1GPS A;  3SF4 D;  5AQT A;  3AY9 A;  1L4V A;  1NGJ A;  3FZH A;  3QI7 A;  3D2E A;  3E7R L;  1POI A;  1SN1 A;  4H5V A;  1BMR A;  5AQG A;  2LN8 A;  5FPN A;  1HX1 A;  1DJT A;  2LY5 A;  1SN4 A;  4FL9 A;  2KHO A;  1P0A A;  1TI5 A;  2LKB A;  2KYQ A;  2KBH A;  2KSK A;  2LJ7 A;  2QXL A;  1MYN A;  5BN9 A;  2GL1 A;  2KBJ A;  1BK8 A;  1GPT A;  3KC6 A;  2N2Q A;  3D2F B;  1KAZ A;  2YC1 C;  1ZFU A;  1B7D A;  1LQQ A;  1OZZ A;  5AQH A;  1ZVE A;  3JXU A;  4KYP A;  1DKG D;  1NGB A;  1ZUT A;  2N69 A;  2QWQ A;  3KHW A;  5F0X A;  2G2K A;  2YIP A;  5AQK A;  1ZYW A;  2N2R A;  3C7N B;  1JZB A;  3KOZ A;  3LDN A;  4H5W A;  4KBO A;  5AQL A;  5AQQ A;  5AQW A;  2BRZ A;  4IO8 A;  1BRZ A;  1I2V A;  5AQP A;  4HE7 A;  5AQO A;  1NGH A;  1T0Z A;  1P00 A;  1NE5 A;  3L4I A;  3GKU A;  1NGG A;  1LQI A;  4UAE F;  5BPL A;  3L6Q A;  1C56 A;  3CW4 A;  1JKZ A;  2E3G A;  4UAD E;  1KAY A;  5AQJ A;  1CHZ A;  2MN5 A;  2YIO A;  3D2F A;  2M8B B;  3M3Z A;  1ATS A;  5BPN A;  5KK4 A;  1NGA A;  2E8A A;  3KOY A;  3QFU A;  1SEG A;  2QWM A;  1VNB A;  4GNI A;  4UAF E;  1QQO A;  4V1D C;  5AQN A;  5AQS A;  2QWR A;  2E2F A;  2KPY A;  1B3C A;  2QWN A;  3KP1 A;  1ATR A;  1PTX A;  3KOX A;  5EY4 A;  5AQZ A;  1I2U A;  1HPM A;  3R2V A;  1T7B A;  3ATV A;  4FSV A;  1BCG A;  1UGL A;  1NH5 A;  1NGD A;  1SNB A;  3C7N A;  1ZVG A;  3FE1 A;  5F1X A;  5EX5 A;  5EVZ A;  1I6G A;  1NGI A;  3FZK A;  2I61 A;  4AAZ A;  1JZA A;  2JDQ D;  5AQY A;  1T7A A;  1QQN A;  5AQX A;  1KAX A;  5AQU A;  3L56 A;  2YBR C;  1DQ7 A;  1NRA A;  1WMT A;  3E7U X;  2B3C A;  3LDP A;  1ZU3 A;  1CN2 A;  2LI7 A;  2YIL A;  2QWO A;  3LDO A;  2V7Z A;  2ATB A;  5F2R A;  1JXC A; 
#chains in the Genus database with same CATH homology
 1T1T A;  1PE4 A;  2SN3 A;  2NY8 X;  1I6F A;  1AYJ A;  2KJA A;  1ICA A;  5CY0 A;  1WT7 A;  2N66 A;  2A7T A;  2B68 A;  1C55 A;  1MR4 A;  1NRB A;  2LT8 A;  1LQH A;  1T7E A;  2NY9 X;  4HHF A;  1OMY A;  1WWN A;  4AB0 A;  2YEO A;  1PX9 A;  2KBK A;  1KV0 A;  2E0H A;  4UJ0 A;  2ASC A;  2LJM A;  2MZ0 A;  4AEI A;  2LR3 A;  2LY6 A;  4CQK A;  1VNA A;  1FH3 A;  2KGQ A;  1ZYV A;  2E3F A;  1AHO A;  3PSM A;  1NPI A;  1N4N A;  1GPS A;  3E7R L;  1SN1 A;  1BMR A;  1DJT A;  2LY5 A;  1SN4 A;  1P0A A;  1TI5 A;  2LKB A;  2KYQ A;  2KBH A;  2KSK A;  2LJ7 A;  1MYN A;  2GL1 A;  2KBJ A;  1BK8 A;  1GPT A;  2N2Q A;  2YC1 C;  1ZFU A;  1B7D A;  1LQQ A;  1OZZ A;  1ZVE A;  4KYP A;  1ZUT A;  2N69 A;  1ZYW A;  2N2R A;  1JZB A;  1BRZ A;  2BRZ A;  1I2V A;  4HE7 A;  1T0Z A;  1P00 A;  1NE5 A;  1LQI A;  1C56 A;  1JKZ A;  2E3G A;  5KK4 A;  1CHZ A;  2M8B B;  1L4V A;  1SEG A;  4V1D C;  1VNB A;  2KPY A;  1B3C A;  1PTX A;  1I2U A;  1T7B A;  1BCG A;  1NH5 A;  1SNB A;  1ZVG A;  1I6G A;  2I61 A;  4AAZ A;  1JZA A;  1T7A A;  2YBR C;  1DQ7 A;  1NRA A;  1WMT A;  3E7U X;  2B3C A;  1ZU3 A;  1CN2 A;  2LI7 A;  2ATB A;  1JXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...