1P00A

Nmr structure of etd151, mutant of the antifungal defensin ard1 from archaeoprepona demophon
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
DKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords defensin ARD1
publication title Lead optimization of antifungal peptides with 3D NMR structures analysis.
pubmed doi rcsb
source organism Archaeoprepona demophon
molecule tags Antifungal protein
total genus 7
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2003-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1p00A00
1B3CA 3E7UX 1C55A 2M8BB 2YBRC 1NPIA 1TI5A 1PTXA 1KV0A 1PE4A 1T7BA 4UJ0A 1ZUTA 1VNBA 4CQKA 2KYQA 1BRZA 5KK4A 1ZVEA 1LQIA 1LQHA 1ZVGA 1OMYA 1B7DA 2YEOA 1T7EA 1WT7A 1CHZA 2LKBA 2LJ7A 3E7RL 2LI7A 2KGQA 5CY0A 2KBHA 1ICAA 1ZYWA 4KYPA 1JXCA 1JZBA 2GL1A 2LY6A 1OZZA 4V1DC 4HE7A 1I6GA 2KPYA 2ASCA 4AAZA 2KJAA 1JZAA 4AEIA 2E3GA 1N4NA 1AHOA 2N69A 1P00A 1SN4A 2I61A 2NY8X 1BCGA 2MZ0A 2N66A 1BK8A 2LT8A 2LY5A 1C56A 1SEGA 1VNAA 1I2VA 1SN1A 2KBKA 2LJMA 2BRZA 2E0HA 1BMRA 1NRAA 1NE5A 2NY9X 3PSMA 2ATBA 1MYNA 1FH3A 1NH5A 2YC1C 1I2UA 2E3FA 1ZFUA 1PX9A 4AB0A 2KBJA 1I6FA 2LR3A 2N2QA 1WWNA 1AYJA 1ZU3A 2B3CA 1CN2A 1DQ7A 1T1TA 2KSKA 1T0ZA 1SNBA 1ZYVA 1LQQA 1T7AA 1GPTA 1GPSA 2B68A 1DJTA 1P0AA 1MR4A 2A7TA 1NRBA 1L4VA 1WMTA 4HHFA 2SN3A 1JKZA 2N2RA
chains in the Genus database with same CATH superfamily
1NGCA 3C7NB 1B3CA 3E7UX 3FZFA 2E88A 3KP0A 1C55A 2M8BB 2JDQD 2YBRC 1NPIA 1TI5A 1PTXA 1KV0A 1PE4A 2YIPA 1T7BA 5AR0A 4UJ0A 5AQNA 2QXLA 1NGDA 1ZUTA 1VNBA 2QWRA 4CQKA 2KYQA 1BRZA 4H5TA 5EVZA 5KK4A 1ZVEA 1LQIA 1LQHA 1ZVGA 5FPEA 2V7ZA 2YILA 1OMYA 1HX1A 1B7DA 2YEOA 3C7NA 5AQSA 2MN5A 3R2VA 1T7EA 5BPLA 1WT7A 1CHZA 4H5RA 3FZHA 1YUWA 2LJ7A 2LKBA 3E7RL 5AQKA 2LI7A 2KGQA 3LDNA 3AY9A 5AQIA 5AQXA 3QFUA 1QQNA 2KHOA 3KOZA 5AQGA 5CY0A 3KOXA 1BA1A 2KBHA 4KBOA 1ICAA 1POIA 5F2RA 1NGJA 5AQRA 1ZYWA 5EX5A 3QI7A 1HJOA 4KYPA 1JXCA 1BMRA 1JZBA 2GL1A 2LY6A 1OZZA 3HSCA 1BA0A 4HE7A 4V1DC 2KPYA 1I6GA 2GMOA 2ASCA 3ATVA 1KAYA 4AAZA 2KJAA 1JZAA 4FSVA 3GKUA 3IUCA 4AEIA 4HWIA 2E3GA 1N4NA 2QWOA 3KOYA 4GNIA 1AHOA 1QQOA 3BK3C 2N69A 1NGGA 1NGHA 1P00A 1SN4A 2LN8A 2I61A 2NY8X 4IO8A 1BCGA 5AQLA 1NGBA 2MZ0A 2N66A 1KAZA 5FPMA 1BK8A 3KP1A 1UGLA 2LT8A 2LY5A 4UADE 1C56A 1SEGA 5F0XA 3KC6A 4UAEF 1VNAA 1I2VA 1SN1A 3LDQA 5BPNA 3L56A 5BPMA 3LDOA 5F1XA 2KBKA 2LJMA 3GDQA 4UAFE 5AQZA 1NGFA 2BRZA 2E0HA 2VY6A 3M3ZA 1NRAA 5AQPA 3ATUA 2K35A 1NE5A 3I33A 2NY9X 3FZLA 2YIOA 3PSMA 2ATBA 1MYNA 2QWNA 1FH3A 1NH5A 2YC1C 3LDPA 3KVGA 1I2UA 3GL1A 3QFPA 2E3FA 2E8AA 3D2EB 1ZFUA 3D2FB 4H5WA 5AQFA 1PX9A 3QMLA 4AB0A 3SF4D 2KBJA 1I6FA 3LDLA 4FL9A 3CQXA 1NGAA 1QQMA 5AQOA 2LR3A 5FPNA 2N2QA 1WWNA 4H5NA 1AYJA 2QWLA 2E2FA 1ZU3A 2B3CA 3CW4A 3FZMA 1CN2A 5AQJA 1DQ7A 1T1TA 2KSKA 1NGEA 1SNBA 1T0ZA 1S3XA 1ZYVA 1LQQA 5AQMA 3KOWA 5AQVA 5AQHA 1T7AA 1GPTA 3D2EA 1ATRA 1KAXA 2G2KA 3D2FA 3FZKA 3A8YA 1ATSA 3L4IA 1GPSA 2B68A 3KHWA 3L6QA 1DJTA 1P0AA 5AQWA 1NGIA 1MR4A 2A7TA 5BN9A 1NRBA 2QWPA 1L4VA 5EY4A 1BUPA 3FE1A 3JXUA 5EXWA 2QWQA 2QW9A 5AQUA 2MBKA 2QWMA 1WMTA 1DKGD 5FPDA 1K8BA 1HPMA 4HHFA 1XRSB 2BUPA 5AQQA 4H5VA 5AQYA 2SN3A 1JKZA 2N2RA 2D56A 5AQTA 5BN8A
chains in the Genus database with same CATH topology
1B3CA 3E7UX 1C55A 2M8BB 2YBRC 1NPIA 1TI5A 1PTXA 1KV0A 1PE4A 1T7BA 4UJ0A 1ZUTA 1VNBA 4CQKA 2KYQA 1BRZA 5KK4A 1ZVEA 1LQIA 1LQHA 1ZVGA 1OMYA 1B7DA 2YEOA 1T7EA 1WT7A 1CHZA 2LKBA 2LJ7A 3E7RL 2LI7A 2KGQA 5CY0A 2KBHA 1ICAA 1ZYWA 4KYPA 1JXCA 1JZBA 2GL1A 2LY6A 1OZZA 4V1DC 4HE7A 1I6GA 2KPYA 2ASCA 4AAZA 2KJAA 1JZAA 4AEIA 2E3GA 1N4NA 1AHOA 2N69A 1P00A 1SN4A 2I61A 2NY8X 1BCGA 2MZ0A 2N66A 1BK8A 2LT8A 2LY5A 1C56A 1SEGA 1VNAA 1I2VA 1SN1A 2KBKA 2LJMA 2BRZA 2E0HA 1BMRA 1NRAA 1NE5A 2NY9X 3PSMA 2ATBA 1MYNA 1FH3A 1NH5A 2YC1C 1I2UA 2E3FA 1ZFUA 1PX9A 4AB0A 2KBJA 1I6FA 2LR3A 2N2QA 1WWNA 1AYJA 1ZU3A 2B3CA 1CN2A 1DQ7A 1T1TA 2KSKA 1T0ZA 1SNBA 1ZYVA 1LQQA 1T7AA 1GPTA 1GPSA 2B68A 1DJTA 1P0AA 1MR4A 2A7TA 1NRBA 1L4VA 1WMTA 4HHFA 2SN3A 1JKZA 2N2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3C A;  3E7U X;  1C55 A;  2M8B B;  2YBR C;  1NPI A;  1TI5 A;  1PTX A;  1KV0 A;  1PE4 A;  1T7B A;  4UJ0 A;  1ZUT A;  1VNB A;  4CQK A;  2KYQ A;  1BRZ A;  5KK4 A;  1ZVE A;  1LQI A;  1LQH A;  1ZVG A;  1OMY A;  1B7D A;  2YEO A;  1T7E A;  1WT7 A;  1CHZ A;  2LKB A;  2LJ7 A;  3E7R L;  2LI7 A;  2KGQ A;  5CY0 A;  2KBH A;  1ICA A;  1ZYW A;  4KYP A;  1JXC A;  1JZB A;  2GL1 A;  2LY6 A;  1OZZ A;  4V1D C;  4HE7 A;  1I6G A;  2KPY A;  2ASC A;  4AAZ A;  2KJA A;  1JZA A;  4AEI A;  2E3G A;  1N4N A;  1AHO A;  2N69 A;  1P00 A;  1SN4 A;  2I61 A;  2NY8 X;  1BCG A;  2MZ0 A;  2N66 A;  1BK8 A;  2LT8 A;  2LY5 A;  1C56 A;  1SEG A;  1VNA A;  1I2V A;  1SN1 A;  2KBK A;  2LJM A;  2BRZ A;  2E0H A;  1BMR A;  1NRA A;  1NE5 A;  2NY9 X;  3PSM A;  2ATB A;  1MYN A;  1FH3 A;  1NH5 A;  2YC1 C;  1I2U A;  2E3F A;  1ZFU A;  1PX9 A;  4AB0 A;  2KBJ A;  1I6F A;  2LR3 A;  2N2Q A;  1WWN A;  1AYJ A;  1ZU3 A;  2B3C A;  1CN2 A;  1DQ7 A;  1T1T A;  2KSK A;  1T0Z A;  1SNB A;  1ZYV A;  1LQQ A;  1T7A A;  1GPT A;  1GPS A;  2B68 A;  1DJT A;  1P0A A;  1MR4 A;  2A7T A;  1NRB A;  1L4V A;  1WMT A;  4HHF A;  2SN3 A;  1JKZ A;  2N2R A; 
#chains in the Genus database with same CATH topology
 1NGC A;  3C7N B;  1B3C A;  3E7U X;  3FZF A;  2E88 A;  3KP0 A;  1C55 A;  2M8B B;  2JDQ D;  2YBR C;  1NPI A;  1TI5 A;  1PTX A;  1KV0 A;  1PE4 A;  2YIP A;  1T7B A;  5AR0 A;  4UJ0 A;  5AQN A;  2QXL A;  1NGD A;  1ZUT A;  1VNB A;  2QWR A;  4CQK A;  2KYQ A;  1BRZ A;  4H5T A;  5EVZ A;  5KK4 A;  1ZVE A;  1LQI A;  1LQH A;  1ZVG A;  5FPE A;  2V7Z A;  2YIL A;  1OMY A;  1HX1 A;  1B7D A;  2YEO A;  3C7N A;  5AQS A;  2MN5 A;  3R2V A;  1T7E A;  5BPL A;  1WT7 A;  1CHZ A;  4H5R A;  3FZH A;  1YUW A;  2LJ7 A;  2LKB A;  3E7R L;  5AQK A;  2LI7 A;  2KGQ A;  3LDN A;  3AY9 A;  5AQI A;  5AQX A;  3QFU A;  1QQN A;  2KHO A;  3KOZ A;  5AQG A;  5CY0 A;  3KOX A;  1BA1 A;  2KBH A;  4KBO A;  1ICA A;  1POI A;  5F2R A;  1NGJ A;  5AQR A;  1ZYW A;  5EX5 A;  3QI7 A;  1HJO A;  4KYP A;  1JXC A;  1BMR A;  1JZB A;  2GL1 A;  2LY6 A;  1OZZ A;  3HSC A;  1BA0 A;  4HE7 A;  4V1D C;  2KPY A;  1I6G A;  2GMO A;  2ASC A;  3ATV A;  1KAY A;  4AAZ A;  2KJA A;  1JZA A;  4FSV A;  3GKU A;  3IUC A;  4AEI A;  4HWI A;  2E3G A;  1N4N A;  2QWO A;  3KOY A;  4GNI A;  1AHO A;  1QQO A;  3BK3 C;  2N69 A;  1NGG A;  1NGH A;  1P00 A;  1SN4 A;  2LN8 A;  2I61 A;  2NY8 X;  4IO8 A;  1BCG A;  5AQL A;  1NGB A;  2MZ0 A;  2N66 A;  1KAZ A;  5FPM A;  1BK8 A;  3KP1 A;  1UGL A;  2LT8 A;  2LY5 A;  4UAD E;  1C56 A;  1SEG A;  5F0X A;  3KC6 A;  4UAE F;  1VNA A;  1I2V A;  1SN1 A;  3LDQ A;  5BPN A;  3L56 A;  5BPM A;  3LDO A;  5F1X A;  2KBK A;  2LJM A;  3GDQ A;  4UAF E;  5AQZ A;  1NGF A;  2BRZ A;  2E0H A;  2VY6 A;  3M3Z A;  1NRA A;  5AQP A;  3ATU A;  2K35 A;  1NE5 A;  3I33 A;  2NY9 X;  3FZL A;  2YIO A;  3PSM A;  2ATB A;  1MYN A;  2QWN A;  1FH3 A;  1NH5 A;  2YC1 C;  3LDP A;  3KVG A;  1I2U A;  3GL1 A;  3QFP A;  2E3F A;  2E8A A;  3D2E B;  1ZFU A;  3D2F B;  4H5W A;  5AQF A;  1PX9 A;  3QML A;  4AB0 A;  3SF4 D;  2KBJ A;  1I6F A;  3LDL A;  4FL9 A;  3CQX A;  1NGA A;  1QQM A;  5AQO A;  2LR3 A;  5FPN A;  2N2Q A;  1WWN A;  4H5N A;  1AYJ A;  2QWL A;  2E2F A;  1ZU3 A;  2B3C A;  3CW4 A;  3FZM A;  1CN2 A;  5AQJ A;  1DQ7 A;  1T1T A;  2KSK A;  1NGE A;  1SNB A;  1T0Z A;  1S3X A;  1ZYV A;  1LQQ A;  5AQM A;  3KOW A;  5AQV A;  5AQH A;  1T7A A;  1GPT A;  3D2E A;  1ATR A;  1KAX A;  2G2K A;  3D2F A;  3FZK A;  3A8Y A;  1ATS A;  3L4I A;  1GPS A;  2B68 A;  3KHW A;  3L6Q A;  1DJT A;  1P0A A;  5AQW A;  1NGI A;  1MR4 A;  2A7T A;  5BN9 A;  1NRB A;  2QWP A;  1L4V A;  5EY4 A;  1BUP A;  3FE1 A;  3JXU A;  5EXW A;  2QWQ A;  2QW9 A;  5AQU A;  2MBK A;  2QWM A;  1WMT A;  1DKG D;  5FPD A;  1K8B A;  1HPM A;  4HHF A;  1XRS B;  2BUP A;  5AQQ A;  4H5V A;  5AQY A;  2SN3 A;  1JKZ A;  2N2R A;  2D56 A;  5AQT A;  5BN8 A; 
#chains in the Genus database with same CATH homology
 1B3C A;  3E7U X;  1C55 A;  2M8B B;  2YBR C;  1NPI A;  1TI5 A;  1PTX A;  1KV0 A;  1PE4 A;  1T7B A;  4UJ0 A;  1ZUT A;  1VNB A;  4CQK A;  2KYQ A;  1BRZ A;  5KK4 A;  1ZVE A;  1LQI A;  1LQH A;  1ZVG A;  1OMY A;  1B7D A;  2YEO A;  1T7E A;  1WT7 A;  1CHZ A;  2LKB A;  2LJ7 A;  3E7R L;  2LI7 A;  2KGQ A;  5CY0 A;  2KBH A;  1ICA A;  1ZYW A;  4KYP A;  1JXC A;  1JZB A;  2GL1 A;  2LY6 A;  1OZZ A;  4V1D C;  4HE7 A;  1I6G A;  2KPY A;  2ASC A;  4AAZ A;  2KJA A;  1JZA A;  4AEI A;  2E3G A;  1N4N A;  1AHO A;  2N69 A;  1P00 A;  1SN4 A;  2I61 A;  2NY8 X;  1BCG A;  2MZ0 A;  2N66 A;  1BK8 A;  2LT8 A;  2LY5 A;  1C56 A;  1SEG A;  1VNA A;  1I2V A;  1SN1 A;  2KBK A;  2LJM A;  2BRZ A;  2E0H A;  1BMR A;  1NRA A;  1NE5 A;  2NY9 X;  3PSM A;  2ATB A;  1MYN A;  1FH3 A;  1NH5 A;  2YC1 C;  1I2U A;  2E3F A;  1ZFU A;  1PX9 A;  4AB0 A;  2KBJ A;  1I6F A;  2LR3 A;  2N2Q A;  1WWN A;  1AYJ A;  1ZU3 A;  2B3C A;  1CN2 A;  1DQ7 A;  1T1T A;  2KSK A;  1T0Z A;  1SNB A;  1ZYV A;  1LQQ A;  1T7A A;  1GPT A;  1GPS A;  2B68 A;  1DJT A;  1P0A A;  1MR4 A;  2A7T A;  1NRB A;  1L4V A;  1WMT A;  4HHF A;  2SN3 A;  1JKZ A;  2N2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...