2N2RA

Nmr solution structure of rsafp2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
b'QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin-like protein 2
publication title The radish defensins RsAFP1 and RsAFP2 act synergistically with caspofungin against Candida albicans biofilms.
pubmed doi rcsb
source organism Raphanus sativus
molecule tags Antifungal protein
total genus 11
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2n2rA00
4KYPA 1NRBA 2KBHA 1OZZA 1VNBA 1WWNA 5CY0A 1I6FA 1MYNA 1T1TA 1ZU3A 1PX9A 3E7UX 2YBRC 1NH5A 1NRAA 1SNBA 4V1DC 2ATBA 2LI7A 2N2RA 2E3GA 1JZBA 2NY9X 1ZYWA 1AYJA 1N4NA 1P00A 1T7EA 3E7RL 2KBJA 1LQHA 1AHOA 2KPYA 2NY8X 2KGQA 1DQ7A 1C55A 4HE7A 1BK8A 2LKBA 1CN2A 1BRZA 1I2UA 2M8BB 2N69A 2B3CA 1WMTA 4HHFA 1FH3A 1OMYA 1I2VA 4CQKA 4AEIA 1SEGA 1BCGA 1PE4A 1WT7A 1PTXA 1JXCA 4AAZA 2LY6A 1T0ZA 2SN3A 2KYQA 5KK4A 3PSMA 2I61A 2LY5A 2E3FA 1ZFUA 2B68A 2KJAA 2LJMA 2BRZA 1SN4A 2GL1A 2N2QA 2ASCA 1VNAA 1I6GA 4UJ0A 1B7DA 1KV0A 2A7TA 1L4VA 1DJTA 1BMRA 2YC1C 1JKZA 1ZVGA 1C56A 1MR4A 1T7AA 2N66A 2YEOA 1ZVEA 1B3CA 1ZUTA 1GPSA 1ZYVA 2LR3A 2LT8A 2KSKA 1CHZA 1JZAA 1LQQA 1TI5A 1LQIA 1T7BA 2KBKA 2LJ7A 1NE5A 1ICAA 4AB0A 1NPIA 1SN1A 1P0AA 2MZ0A 2E0HA 1GPTA
chains in the Genus database with same CATH superfamily
5AQWA 4KYPA 2V7ZA 1NRBA 2KBHA 1OZZA 1VNBA 1WWNA 5AQLA 5AQIA 5CY0A 1I6FA 1MYNA 5AQFA 3LDOA 1T1TA 1QQMA 1ZU3A 2YIPA 3KOWA 3CW4A 4KBOA 1PX9A 3E7UX 3FZKA 2QWQA 1NGHA 2G2KA 2QXLA 3FZHA 5EX5A 2YBRC 5AQTA 1NH5A 1KAZA 1NRAA 1SNBA 2GMOA 2BUPA 1HX1A 4V1DC 2ATBA 3KOYA 2LI7A 3KP0A 3BK3C 3KOXA 2N2RA 1YUWA 5AQXA 2E3GA 1JZBA 2E8AA 2QWRA 1ATSA 2NY9X 1ZYWA 2YILA 3ATVA 3CQXA 3KP1A 5FPMA 1AYJA 1NGJA 1N4NA 4H5RA 1P00A 1T7EA 1BA1A 3E7RL 1BUPA 4UAEF 5AQZA 4GNIA 3R2VA 2KBJA 1LQHA 1AHOA 1HPMA 1ATRA 3LDNA 2KPYA 2NY8X 2QWMA 2KGQA 3KOZA 5BN8A 2MN5A 3SF4D 5BPNA 3C7NA 1DQ7A 1C55A 2YIOA 3KHWA 3QFPA 3D2EA 1XRSB 3KC6A 4HE7A 1BK8A 5AQVA 5AQGA 1NGGA 3FZLA 2LKBA 3LDLA 3L4IA 4UAFE 2QWNA 1CN2A 1BRZA 1I2UA 2M8BB 2N69A 4FL9A 3A8YA 2B3CA 1KAYA 1WMTA 4HHFA 4HWIA 5FPEA 1FH3A 1OMYA 3GKUA 5AQOA 2D56A 5AQNA 1NGDA 5AQQA 4CQKA 1I2VA 4AEIA 1SEGA 1BCGA 3AY9A 1NGFA 1PE4A 5F1XA 1WT7A 1PTXA 1JXCA 3LDPA 1BA0A 2E88A 4AAZA 1K8BA 2LY6A 1QQOA 1T0ZA 2LN8A 2QWLA 2SN3A 5AQSA 2KYQA 3KVGA 5F2RA 5BPMA 1NGBA 3QMLA 3C7NB 3PSMA 5AQPA 5BPLA 5KK4A 3ATUA 4IO8A 2I61A 2LY5A 3D2EB 2E3FA 1ZFUA 5EVZA 1KAXA 4H5NA 2B68A 2KJAA 2LJMA 2BRZA 1SN4A 2GL1A 1POIA 1S3XA 2K35A 2N2QA 2E2FA 2QW9A 3FZMA 3JXUA 2ASCA 4H5TA 2VY6A 3FE1A 1VNAA 1I6GA 1NGAA 2MBKA 1B7DA 1KV0A 2A7TA 3IUCA 4UJ0A 3QI7A 5AR0A 2QWOA 1L4VA 1DJTA 1UGLA 1BMRA 2YC1C 1JKZA 5AQHA 1ZVGA 1C56A 1MR4A 1T7AA 1NGEA 2N66A 1ZVEA 2YEOA 1B3CA 1ZUTA 3GL1A 5AQMA 5AQJA 1GPSA 5AQKA 4UADE 1ZYVA 2LR3A 3LDQA 2LT8A 3GDQA 3L6QA 5AQYA 5EXWA 2KSKA 5FPNA 1CHZA 1JZAA 5AQRA 1LQQA 1TI5A 4H5WA 1LQIA 3D2FA 4FSVA 5AQUA 5EY4A 2KHOA 1T7BA 2KBKA 2LJ7A 3QFUA 3D2FB 1HJOA 1NE5A 4H5VA 5BN9A 1ICAA 4AB0A 1NGIA 1NPIA 1QQNA 2JDQD 1NGCA 5FPDA 3HSCA 2QWPA 3I33A 1SN1A 1P0AA 5F0XA 2MZ0A 2E0HA 3L56A 1GPTA 3FZFA 3M3ZA 1DKGD
chains in the Genus database with same CATH topology
4KYPA 1NRBA 2KBHA 1OZZA 1VNBA 1WWNA 5CY0A 1I6FA 1MYNA 1T1TA 1ZU3A 1PX9A 3E7UX 2YBRC 1NH5A 1NRAA 1SNBA 4V1DC 2ATBA 2LI7A 2N2RA 2E3GA 1JZBA 2NY9X 1ZYWA 1AYJA 1N4NA 1P00A 1T7EA 3E7RL 2KBJA 1LQHA 1AHOA 2KPYA 2NY8X 2KGQA 1DQ7A 1C55A 4HE7A 1BK8A 2LKBA 1CN2A 1BRZA 1I2UA 2M8BB 2N69A 2B3CA 1WMTA 4HHFA 1FH3A 1OMYA 1I2VA 4CQKA 4AEIA 1SEGA 1BCGA 1PE4A 1WT7A 1PTXA 1JXCA 4AAZA 2LY6A 1T0ZA 2SN3A 2KYQA 5KK4A 3PSMA 2I61A 2LY5A 2E3FA 1ZFUA 2B68A 2KJAA 2LJMA 2BRZA 1SN4A 2GL1A 2N2QA 2ASCA 1VNAA 1I6GA 4UJ0A 1B7DA 1KV0A 2A7TA 1L4VA 1DJTA 1BMRA 2YC1C 1JKZA 1ZVGA 1C56A 1MR4A 1T7AA 2N66A 2YEOA 1ZVEA 1B3CA 1ZUTA 1GPSA 1ZYVA 2LR3A 2LT8A 2KSKA 1CHZA 1JZAA 1LQQA 1TI5A 1LQIA 1T7BA 2KBKA 2LJ7A 1NE5A 1ICAA 4AB0A 1NPIA 1SN1A 1P0AA 2MZ0A 2E0HA 1GPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYP A;  1NRB A;  2KBH A;  1OZZ A;  1VNB A;  1WWN A;  5CY0 A;  1I6F A;  1MYN A;  1T1T A;  1ZU3 A;  1PX9 A;  3E7U X;  2YBR C;  1NH5 A;  1NRA A;  1SNB A;  4V1D C;  2ATB A;  2LI7 A;  2N2R A;  2E3G A;  1JZB A;  2NY9 X;  1ZYW A;  1AYJ A;  1N4N A;  1P00 A;  1T7E A;  3E7R L;  2KBJ A;  1LQH A;  1AHO A;  2KPY A;  2NY8 X;  2KGQ A;  1DQ7 A;  1C55 A;  4HE7 A;  1BK8 A;  2LKB A;  1CN2 A;  1BRZ A;  1I2U A;  2M8B B;  2N69 A;  2B3C A;  1WMT A;  4HHF A;  1FH3 A;  1OMY A;  1I2V A;  4CQK A;  4AEI A;  1SEG A;  1BCG A;  1PE4 A;  1WT7 A;  1PTX A;  1JXC A;  4AAZ A;  2LY6 A;  1T0Z A;  2SN3 A;  2KYQ A;  5KK4 A;  3PSM A;  2I61 A;  2LY5 A;  2E3F A;  1ZFU A;  2B68 A;  2KJA A;  2LJM A;  2BRZ A;  1SN4 A;  2GL1 A;  2N2Q A;  2ASC A;  1VNA A;  1I6G A;  4UJ0 A;  1B7D A;  1KV0 A;  2A7T A;  1L4V A;  1DJT A;  1BMR A;  2YC1 C;  1JKZ A;  1ZVG A;  1C56 A;  1MR4 A;  1T7A A;  2N66 A;  2YEO A;  1ZVE A;  1B3C A;  1ZUT A;  1GPS A;  1ZYV A;  2LR3 A;  2LT8 A;  2KSK A;  1CHZ A;  1JZA A;  1LQQ A;  1TI5 A;  1LQI A;  1T7B A;  2KBK A;  2LJ7 A;  1NE5 A;  1ICA A;  4AB0 A;  1NPI A;  1SN1 A;  1P0A A;  2MZ0 A;  2E0H A;  1GPT A; 
#chains in the Genus database with same CATH topology
 5AQW A;  4KYP A;  2V7Z A;  1NRB A;  2KBH A;  1OZZ A;  1VNB A;  1WWN A;  5AQL A;  5AQI A;  5CY0 A;  1I6F A;  1MYN A;  5AQF A;  3LDO A;  1T1T A;  1QQM A;  1ZU3 A;  2YIP A;  3KOW A;  3CW4 A;  4KBO A;  1PX9 A;  3E7U X;  3FZK A;  2QWQ A;  1NGH A;  2G2K A;  2QXL A;  3FZH A;  5EX5 A;  2YBR C;  5AQT A;  1NH5 A;  1KAZ A;  1NRA A;  1SNB A;  2GMO A;  2BUP A;  1HX1 A;  4V1D C;  2ATB A;  3KOY A;  2LI7 A;  3KP0 A;  3BK3 C;  3KOX A;  2N2R A;  1YUW A;  5AQX A;  2E3G A;  1JZB A;  2E8A A;  2QWR A;  1ATS A;  2NY9 X;  1ZYW A;  2YIL A;  3ATV A;  3CQX A;  3KP1 A;  5FPM A;  1AYJ A;  1NGJ A;  1N4N A;  4H5R A;  1P00 A;  1T7E A;  1BA1 A;  3E7R L;  1BUP A;  4UAE F;  5AQZ A;  4GNI A;  3R2V A;  2KBJ A;  1LQH A;  1AHO A;  1HPM A;  1ATR A;  3LDN A;  2KPY A;  2NY8 X;  2QWM A;  2KGQ A;  3KOZ A;  5BN8 A;  2MN5 A;  3SF4 D;  5BPN A;  3C7N A;  1DQ7 A;  1C55 A;  2YIO A;  3KHW A;  3QFP A;  3D2E A;  1XRS B;  3KC6 A;  4HE7 A;  1BK8 A;  5AQV A;  5AQG A;  1NGG A;  3FZL A;  2LKB A;  3LDL A;  3L4I A;  4UAF E;  2QWN A;  1CN2 A;  1BRZ A;  1I2U A;  2M8B B;  2N69 A;  4FL9 A;  3A8Y A;  2B3C A;  1KAY A;  1WMT A;  4HHF A;  4HWI A;  5FPE A;  1FH3 A;  1OMY A;  3GKU A;  5AQO A;  2D56 A;  5AQN A;  1NGD A;  5AQQ A;  4CQK A;  1I2V A;  4AEI A;  1SEG A;  1BCG A;  3AY9 A;  1NGF A;  1PE4 A;  5F1X A;  1WT7 A;  1PTX A;  1JXC A;  3LDP A;  1BA0 A;  2E88 A;  4AAZ A;  1K8B A;  2LY6 A;  1QQO A;  1T0Z A;  2LN8 A;  2QWL A;  2SN3 A;  5AQS A;  2KYQ A;  3KVG A;  5F2R A;  5BPM A;  1NGB A;  3QML A;  3C7N B;  3PSM A;  5AQP A;  5BPL A;  5KK4 A;  3ATU A;  4IO8 A;  2I61 A;  2LY5 A;  3D2E B;  2E3F A;  1ZFU A;  5EVZ A;  1KAX A;  4H5N A;  2B68 A;  2KJA A;  2LJM A;  2BRZ A;  1SN4 A;  2GL1 A;  1POI A;  1S3X A;  2K35 A;  2N2Q A;  2E2F A;  2QW9 A;  3FZM A;  3JXU A;  2ASC A;  4H5T A;  2VY6 A;  3FE1 A;  1VNA A;  1I6G A;  1NGA A;  2MBK A;  1B7D A;  1KV0 A;  2A7T A;  3IUC A;  4UJ0 A;  3QI7 A;  5AR0 A;  2QWO A;  1L4V A;  1DJT A;  1UGL A;  1BMR A;  2YC1 C;  1JKZ A;  5AQH A;  1ZVG A;  1C56 A;  1MR4 A;  1T7A A;  1NGE A;  2N66 A;  1ZVE A;  2YEO A;  1B3C A;  1ZUT A;  3GL1 A;  5AQM A;  5AQJ A;  1GPS A;  5AQK A;  4UAD E;  1ZYV A;  2LR3 A;  3LDQ A;  2LT8 A;  3GDQ A;  3L6Q A;  5AQY A;  5EXW A;  2KSK A;  5FPN A;  1CHZ A;  1JZA A;  5AQR A;  1LQQ A;  1TI5 A;  4H5W A;  1LQI A;  3D2F A;  4FSV A;  5AQU A;  5EY4 A;  2KHO A;  1T7B A;  2KBK A;  2LJ7 A;  3QFU A;  3D2F B;  1HJO A;  1NE5 A;  4H5V A;  5BN9 A;  1ICA A;  4AB0 A;  1NGI A;  1NPI A;  1QQN A;  2JDQ D;  1NGC A;  5FPD A;  3HSC A;  2QWP A;  3I33 A;  1SN1 A;  1P0A A;  5F0X A;  2MZ0 A;  2E0H A;  3L56 A;  1GPT A;  3FZF A;  3M3Z A;  1DKG D; 
#chains in the Genus database with same CATH homology
 4KYP A;  1NRB A;  2KBH A;  1OZZ A;  1VNB A;  1WWN A;  5CY0 A;  1I6F A;  1MYN A;  1T1T A;  1ZU3 A;  1PX9 A;  3E7U X;  2YBR C;  1NH5 A;  1NRA A;  1SNB A;  4V1D C;  2ATB A;  2LI7 A;  2N2R A;  2E3G A;  1JZB A;  2NY9 X;  1ZYW A;  1AYJ A;  1N4N A;  1P00 A;  1T7E A;  3E7R L;  2KBJ A;  1LQH A;  1AHO A;  2KPY A;  2NY8 X;  2KGQ A;  1DQ7 A;  1C55 A;  4HE7 A;  1BK8 A;  2LKB A;  1CN2 A;  1BRZ A;  1I2U A;  2M8B B;  2N69 A;  2B3C A;  1WMT A;  4HHF A;  1FH3 A;  1OMY A;  1I2V A;  4CQK A;  4AEI A;  1SEG A;  1BCG A;  1PE4 A;  1WT7 A;  1PTX A;  1JXC A;  4AAZ A;  2LY6 A;  1T0Z A;  2SN3 A;  2KYQ A;  5KK4 A;  3PSM A;  2I61 A;  2LY5 A;  2E3F A;  1ZFU A;  2B68 A;  2KJA A;  2LJM A;  2BRZ A;  1SN4 A;  2GL1 A;  2N2Q A;  2ASC A;  1VNA A;  1I6G A;  4UJ0 A;  1B7D A;  1KV0 A;  2A7T A;  1L4V A;  1DJT A;  1BMR A;  2YC1 C;  1JKZ A;  1ZVG A;  1C56 A;  1MR4 A;  1T7A A;  2N66 A;  2YEO A;  1ZVE A;  1B3C A;  1ZUT A;  1GPS A;  1ZYV A;  2LR3 A;  2LT8 A;  2KSK A;  1CHZ A;  1JZA A;  1LQQ A;  1TI5 A;  1LQI A;  1T7B A;  2KBK A;  2LJ7 A;  1NE5 A;  1ICA A;  4AB0 A;  1NPI A;  1SN1 A;  1P0A A;  2MZ0 A;  2E0H A;  1GPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...