1DQ7A

Three-dimensional structure of a neurotoxin from red scorpion (buthus tamulus) at 2.2a resolution.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords NEUROTOXIN
publication title Three-dimensional Structure of a Neurotoxin from Red Scorpion (Buthus tamulus) at 2.2A Resolution
rcsb
total genus 15
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1dq7A00
1LQIA 1T0ZA 2E3FA 5KK4A 2B68A 2LJ7A 1WWNA 1JZBA 1L4VA 2LI7A 2N2QA 1PTXA 2E3GA 1B7DA 1NRBA 1CN2A 1T7AA 3E7RL 2KBJA 1BRZA 2LKBA 1MR4A 2KBHA 2LT8A 4V1DC 1WT7A 2KSKA 1BCGA 1ZFUA 2M8BB 1SN1A 1MYNA 2NY9X 1CHZA 2YC1C 2ATBA 2N2RA 4UJ0A 2LJMA 1VNBA 2NY8X 4HE7A 1SN4A 2KYQA 4KYPA 1I2VA 2YEOA 4CQKA 2KPYA 1VNAA 1T7BA 1P00A 1ZYVA 1LQQA 1N4NA 2LR3A 2YBRC 1OMYA 1DJTA 1LQHA 3PSMA 4HHFA 5CY0A 1FH3A 1T1TA 1OZZA 1P0AA 1I2UA 4AB0A 2ASCA 1GPSA 1PX9A 1T7EA 1NH5A 1SNBA 1B3CA 2N66A 1I6GA 1ZU3A 2E0HA 2KBKA 1AHOA 2A7TA 1ZUTA 1ZVEA 1WMTA 1PE4A 2SN3A 2LY6A 1I6FA 4AAZA 4AEIA 2KJAA 2LY5A 2N69A 1BMRA 1JKZA 1GPTA 1ICAA 2I61A 1C56A 1TI5A 3E7UX 2BRZA 1KV0A 2MZ0A 1NPIA 1NRAA 1ZYWA 1BK8A 1SEGA 1NE5A 2KGQA 2GL1A 1JZAA 1ZVGA 1DQ7A 2B3CA 1JXCA 1AYJA 1C55A
chains in the Genus database with same CATH superfamily
3I33A 5AQUA 1NGEA 5AQKA 1LQIA 3SF4D 1S3XA 1T0ZA 4H5TA 2E3FA 5KK4A 2B68A 5AQGA 2LJ7A 1NGAA 1WWNA 1NGFA 1JZBA 1NGDA 2MBKA 2LI7A 3LDOA 1L4VA 2N2QA 5AQWA 1PTXA 5F0XA 1K8BA 2E3GA 3FZLA 1B7DA 3C7NA 3KOWA 1NRBA 5AQTA 5AQYA 1CN2A 1T7AA 3L4IA 3E7RL 3GL1A 2KBJA 1BRZA 1QQOA 5AQNA 1HX1A 1BUPA 5AQMA 2LKBA 4IO8A 5AQPA 5FPMA 1MR4A 2KBHA 2YILA 2LT8A 3A8YA 3CQXA 4V1DC 1WT7A 1QQMA 2KSKA 1BCGA 1NGCA 1ZFUA 2M8BB 1SN1A 5AQRA 1MYNA 5AQXA 3KC6A 3LDPA 3ATVA 2NY9X 3GDQA 3ATUA 1XRSB 3QFUA 1POIA 1CHZA 2YC1C 3D2EB 5F2RA 2QXLA 5BPMA 5BN9A 3QI7A 2ATBA 2N2RA 4UJ0A 2LJMA 1VNBA 4FSVA 5FPEA 2NY8X 1QQNA 5AQVA 1DKGD 3LDLA 4HE7A 1SN4A 3M3ZA 1KAYA 3KOZA 3FZHA 2KYQA 2QWOA 4FL9A 3D2EA 4KYPA 1I2VA 2YEOA 5AQIA 2KPYA 4CQKA 1VNAA 3KP1A 5EXWA 3D2FA 5AQOA 5AQHA 1T7BA 1P00A 4UAFE 1ZYVA 2QWNA 1LQQA 1N4NA 2E2FA 2LR3A 2YBRC 1OMYA 3KP0A 1DJTA 1LQHA 3PSMA 3QMLA 4H5VA 4HHFA 5BN8A 5CY0A 4KBOA 2BUPA 1FH3A 5AQFA 1T1TA 1OZZA 2LN8A 1P0AA 2D56A 3IUCA 1I2UA 2QWRA 4AB0A 3KVGA 5EY4A 2QW9A 1KAXA 5AQLA 5AQQA 2G2KA 3KOYA 5F1XA 5AQJA 2ASCA 2E88A 2QWPA 1GPSA 1PX9A 3HSCA 1T7EA 1NGHA 4UADE 1NH5A 1SNBA 2V7ZA 3CW4A 3D2FB 4UAEF 1B3CA 2N66A 2GMOA 1NGGA 1I6GA 1ZU3A 2QWMA 3LDNA 5FPNA 2E0HA 2KBKA 5AQZA 1NGJA 2MN5A 1AHOA 2E8AA 1HJOA 2A7TA 1ZUTA 1ZVEA 1WMTA 1PE4A 2SN3A 2YIOA 3FZFA 2LY6A 4H5RA 1I6FA 5EVZA 1UGLA 2QWQA 4AAZA 4AEIA 1HPMA 3FE1A 3GKUA 2KJAA 1ATSA 2QWLA 5AQSA 2LY5A 2N69A 5EX5A 1BMRA 1JKZA 1GPTA 1BA1A 2KHOA 1BA0A 1ICAA 2I61A 3AY9A 4H5NA 1ATRA 2VY6A 5BPLA 1C56A 1KAZA 1TI5A 3E7UX 5AR0A 2BRZA 2K35A 1KV0A 3QFPA 5FPDA 2MZ0A 3FZMA 1YUWA 3BK3C 4GNIA 4H5WA 1NPIA 1NRAA 1NGBA 1ZYWA 1BK8A 1SEGA 1NE5A 2KGQA 2GL1A 3KHWA 3LDQA 3FZKA 1JZAA 1ZVGA 1DQ7A 5BPNA 3L56A 2B3CA 4HWIA 2JDQD 1JXCA 3JXUA 1NGIA 2YIPA 1AYJA 3KOXA 1C55A 3R2VA 3L6QA 3C7NB
chains in the Genus database with same CATH topology
1LQIA 1T0ZA 2E3FA 5KK4A 2B68A 2LJ7A 1WWNA 1JZBA 1L4VA 2LI7A 2N2QA 1PTXA 2E3GA 1B7DA 1NRBA 1CN2A 1T7AA 3E7RL 2KBJA 1BRZA 2LKBA 1MR4A 2KBHA 2LT8A 4V1DC 1WT7A 2KSKA 1BCGA 1ZFUA 2M8BB 1SN1A 1MYNA 2NY9X 1CHZA 2YC1C 2ATBA 2N2RA 4UJ0A 2LJMA 1VNBA 2NY8X 4HE7A 1SN4A 2KYQA 4KYPA 1I2VA 2YEOA 4CQKA 2KPYA 1VNAA 1T7BA 1P00A 1ZYVA 1LQQA 1N4NA 2LR3A 2YBRC 1OMYA 1DJTA 1LQHA 3PSMA 4HHFA 5CY0A 1FH3A 1T1TA 1OZZA 1P0AA 1I2UA 4AB0A 2ASCA 1GPSA 1PX9A 1T7EA 1NH5A 1SNBA 1B3CA 2N66A 1I6GA 1ZU3A 2E0HA 2KBKA 1AHOA 2A7TA 1ZUTA 1ZVEA 1WMTA 1PE4A 2SN3A 2LY6A 1I6FA 4AAZA 4AEIA 2KJAA 2LY5A 2N69A 1BMRA 1JKZA 1GPTA 1ICAA 2I61A 1C56A 1TI5A 3E7UX 2BRZA 1KV0A 2MZ0A 1NPIA 1NRAA 1ZYWA 1BK8A 1SEGA 1NE5A 2KGQA 2GL1A 1JZAA 1ZVGA 1DQ7A 2B3CA 1JXCA 1AYJA 1C55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQI A;  1T0Z A;  2E3F A;  5KK4 A;  2B68 A;  2LJ7 A;  1WWN A;  1JZB A;  1L4V A;  2LI7 A;  2N2Q A;  1PTX A;  2E3G A;  1B7D A;  1NRB A;  1CN2 A;  1T7A A;  3E7R L;  2KBJ A;  1BRZ A;  2LKB A;  1MR4 A;  2KBH A;  2LT8 A;  4V1D C;  1WT7 A;  2KSK A;  1BCG A;  1ZFU A;  2M8B B;  1SN1 A;  1MYN A;  2NY9 X;  1CHZ A;  2YC1 C;  2ATB A;  2N2R A;  4UJ0 A;  2LJM A;  1VNB A;  2NY8 X;  4HE7 A;  1SN4 A;  2KYQ A;  4KYP A;  1I2V A;  2YEO A;  4CQK A;  2KPY A;  1VNA A;  1T7B A;  1P00 A;  1ZYV A;  1LQQ A;  1N4N A;  2LR3 A;  2YBR C;  1OMY A;  1DJT A;  1LQH A;  3PSM A;  4HHF A;  5CY0 A;  1FH3 A;  1T1T A;  1OZZ A;  1P0A A;  1I2U A;  4AB0 A;  2ASC A;  1GPS A;  1PX9 A;  1T7E A;  1NH5 A;  1SNB A;  1B3C A;  2N66 A;  1I6G A;  1ZU3 A;  2E0H A;  2KBK A;  1AHO A;  2A7T A;  1ZUT A;  1ZVE A;  1WMT A;  1PE4 A;  2SN3 A;  2LY6 A;  1I6F A;  4AAZ A;  4AEI A;  2KJA A;  2LY5 A;  2N69 A;  1BMR A;  1JKZ A;  1GPT A;  1ICA A;  2I61 A;  1C56 A;  1TI5 A;  3E7U X;  2BRZ A;  1KV0 A;  2MZ0 A;  1NPI A;  1NRA A;  1ZYW A;  1BK8 A;  1SEG A;  1NE5 A;  2KGQ A;  2GL1 A;  1JZA A;  1ZVG A;  1DQ7 A;  2B3C A;  1JXC A;  1AYJ A;  1C55 A; 
#chains in the Genus database with same CATH topology
 3I33 A;  5AQU A;  1NGE A;  5AQK A;  1LQI A;  3SF4 D;  1S3X A;  1T0Z A;  4H5T A;  2E3F A;  5KK4 A;  2B68 A;  5AQG A;  2LJ7 A;  1NGA A;  1WWN A;  1NGF A;  1JZB A;  1NGD A;  2MBK A;  2LI7 A;  3LDO A;  1L4V A;  2N2Q A;  5AQW A;  1PTX A;  5F0X A;  1K8B A;  2E3G A;  3FZL A;  1B7D A;  3C7N A;  3KOW A;  1NRB A;  5AQT A;  5AQY A;  1CN2 A;  1T7A A;  3L4I A;  3E7R L;  3GL1 A;  2KBJ A;  1BRZ A;  1QQO A;  5AQN A;  1HX1 A;  1BUP A;  5AQM A;  2LKB A;  4IO8 A;  5AQP A;  5FPM A;  1MR4 A;  2KBH A;  2YIL A;  2LT8 A;  3A8Y A;  3CQX A;  4V1D C;  1WT7 A;  1QQM A;  2KSK A;  1BCG A;  1NGC A;  1ZFU A;  2M8B B;  1SN1 A;  5AQR A;  1MYN A;  5AQX A;  3KC6 A;  3LDP A;  3ATV A;  2NY9 X;  3GDQ A;  3ATU A;  1XRS B;  3QFU A;  1POI A;  1CHZ A;  2YC1 C;  3D2E B;  5F2R A;  2QXL A;  5BPM A;  5BN9 A;  3QI7 A;  2ATB A;  2N2R A;  4UJ0 A;  2LJM A;  1VNB A;  4FSV A;  5FPE A;  2NY8 X;  1QQN A;  5AQV A;  1DKG D;  3LDL A;  4HE7 A;  1SN4 A;  3M3Z A;  1KAY A;  3KOZ A;  3FZH A;  2KYQ A;  2QWO A;  4FL9 A;  3D2E A;  4KYP A;  1I2V A;  2YEO A;  5AQI A;  2KPY A;  4CQK A;  1VNA A;  3KP1 A;  5EXW A;  3D2F A;  5AQO A;  5AQH A;  1T7B A;  1P00 A;  4UAF E;  1ZYV A;  2QWN A;  1LQQ A;  1N4N A;  2E2F A;  2LR3 A;  2YBR C;  1OMY A;  3KP0 A;  1DJT A;  1LQH A;  3PSM A;  3QML A;  4H5V A;  4HHF A;  5BN8 A;  5CY0 A;  4KBO A;  2BUP A;  1FH3 A;  5AQF A;  1T1T A;  1OZZ A;  2LN8 A;  1P0A A;  2D56 A;  3IUC A;  1I2U A;  2QWR A;  4AB0 A;  3KVG A;  5EY4 A;  2QW9 A;  1KAX A;  5AQL A;  5AQQ A;  2G2K A;  3KOY A;  5F1X A;  5AQJ A;  2ASC A;  2E88 A;  2QWP A;  1GPS A;  1PX9 A;  3HSC A;  1T7E A;  1NGH A;  4UAD E;  1NH5 A;  1SNB A;  2V7Z A;  3CW4 A;  3D2F B;  4UAE F;  1B3C A;  2N66 A;  2GMO A;  1NGG A;  1I6G A;  1ZU3 A;  2QWM A;  3LDN A;  5FPN A;  2E0H A;  2KBK A;  5AQZ A;  1NGJ A;  2MN5 A;  1AHO A;  2E8A A;  1HJO A;  2A7T A;  1ZUT A;  1ZVE A;  1WMT A;  1PE4 A;  2SN3 A;  2YIO A;  3FZF A;  2LY6 A;  4H5R A;  1I6F A;  5EVZ A;  1UGL A;  2QWQ A;  4AAZ A;  4AEI A;  1HPM A;  3FE1 A;  3GKU A;  2KJA A;  1ATS A;  2QWL A;  5AQS A;  2LY5 A;  2N69 A;  5EX5 A;  1BMR A;  1JKZ A;  1GPT A;  1BA1 A;  2KHO A;  1BA0 A;  1ICA A;  2I61 A;  3AY9 A;  4H5N A;  1ATR A;  2VY6 A;  5BPL A;  1C56 A;  1KAZ A;  1TI5 A;  3E7U X;  5AR0 A;  2BRZ A;  2K35 A;  1KV0 A;  3QFP A;  5FPD A;  2MZ0 A;  3FZM A;  1YUW A;  3BK3 C;  4GNI A;  4H5W A;  1NPI A;  1NRA A;  1NGB A;  1ZYW A;  1BK8 A;  1SEG A;  1NE5 A;  2KGQ A;  2GL1 A;  3KHW A;  3LDQ A;  3FZK A;  1JZA A;  1ZVG A;  1DQ7 A;  5BPN A;  3L56 A;  2B3C A;  4HWI A;  2JDQ D;  1JXC A;  3JXU A;  1NGI A;  2YIP A;  1AYJ A;  3KOX A;  1C55 A;  3R2V A;  3L6Q A;  3C7N B; 
#chains in the Genus database with same CATH homology
 1LQI A;  1T0Z A;  2E3F A;  5KK4 A;  2B68 A;  2LJ7 A;  1WWN A;  1JZB A;  1L4V A;  2LI7 A;  2N2Q A;  1PTX A;  2E3G A;  1B7D A;  1NRB A;  1CN2 A;  1T7A A;  3E7R L;  2KBJ A;  1BRZ A;  2LKB A;  1MR4 A;  2KBH A;  2LT8 A;  4V1D C;  1WT7 A;  2KSK A;  1BCG A;  1ZFU A;  2M8B B;  1SN1 A;  1MYN A;  2NY9 X;  1CHZ A;  2YC1 C;  2ATB A;  2N2R A;  4UJ0 A;  2LJM A;  1VNB A;  2NY8 X;  4HE7 A;  1SN4 A;  2KYQ A;  4KYP A;  1I2V A;  2YEO A;  4CQK A;  2KPY A;  1VNA A;  1T7B A;  1P00 A;  1ZYV A;  1LQQ A;  1N4N A;  2LR3 A;  2YBR C;  1OMY A;  1DJT A;  1LQH A;  3PSM A;  4HHF A;  5CY0 A;  1FH3 A;  1T1T A;  1OZZ A;  1P0A A;  1I2U A;  4AB0 A;  2ASC A;  1GPS A;  1PX9 A;  1T7E A;  1NH5 A;  1SNB A;  1B3C A;  2N66 A;  1I6G A;  1ZU3 A;  2E0H A;  2KBK A;  1AHO A;  2A7T A;  1ZUT A;  1ZVE A;  1WMT A;  1PE4 A;  2SN3 A;  2LY6 A;  1I6F A;  4AAZ A;  4AEI A;  2KJA A;  2LY5 A;  2N69 A;  1BMR A;  1JKZ A;  1GPT A;  1ICA A;  2I61 A;  1C56 A;  1TI5 A;  3E7U X;  2BRZ A;  1KV0 A;  2MZ0 A;  1NPI A;  1NRA A;  1ZYW A;  1BK8 A;  1SEG A;  1NE5 A;  2KGQ A;  2GL1 A;  1JZA A;  1ZVG A;  1DQ7 A;  2B3C A;  1JXC A;  1AYJ A;  1C55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...