1DQ7A

Three-dimensional structure of a neurotoxin from red scorpion (buthus tamulus) at 2.2a resolution.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
b'GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN
publication title Three-dimensional Structure of a Neurotoxin from Red Scorpion (Buthus tamulus) at 2.2A Resolution
rcsb
molecule tags Toxin
total genus 15
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1dq7A00
1N4NA 1ZVEA 1DQ7A 2KBKA 2KJAA 4HE7A 1ZFUA 1C56A 1DJTA 1BCGA 1NE5A 4AB0A 1T7AA 2N69A 2LKBA 2LI7A 1VNBA 4CQKA 1BRZA 1SN1A 2YC1C 4V1DC 1WMTA 2LJMA 2BRZA 2KBJA 1I2UA 2LY6A 3PSMA 2KBHA 2N2QA 2KGQA 2E3GA 1PTXA 1I6FA 1SEGA 5CY0A 2E0HA 1CN2A 1GPSA 2LT8A 1PX9A 2NY8X 2N2RA 2I61A 1T7EA 1GPTA 2A7TA 1I6GA 2KSKA 3E7UX 1NH5A 2LJ7A 4AAZA 1NRAA 1CHZA 1ZVGA 1JXCA 2KYQA 1FH3A 1ZYWA 1NRBA 1WWNA 1NPIA 2N66A 1TI5A 2B3CA 1ZUTA 1JKZA 2YEOA 1P00A 1MR4A 1LQIA 1LQHA 2YBRC 2MZ0A 2GL1A 1SN4A 2SN3A 2M8BB 2NY9X 1KV0A 1L4VA 2ASCA 1OZZA 1B7DA 5KK4A 1B3CA 1C55A 1ZYVA 1JZAA 1VNAA 1I2VA 1OMYA 2ATBA 1LQQA 1AHOA 3E7RL 1BK8A 1ZU3A 2LR3A 4HHFA 1WT7A 4UJ0A 1SNBA 1T7BA 1AYJA 1BMRA 4AEIA 1P0AA 1T0ZA 2KPYA 1ICAA 2LY5A 1JZBA 2E3FA 2B68A 4KYPA 1MYNA 1PE4A 1T1TA
chains in the Genus database with same CATH superfamily
2E88A 1BA1A 1N4NA 1ZVEA 2QW9A 1DQ7A 1NGEA 2KBKA 5EVZA 5AQWA 2QWQA 3FZLA 2QWOA 2JDQD 3JXUA 2MN5A 3QFUA 4UAFE 5AQXA 1HPMA 2KJAA 4HE7A 3KOYA 1ZFUA 1C56A 2K35A 3KP0A 3L56A 1DJTA 1BCGA 5AQOA 1NE5A 4AB0A 1T7AA 3ATUA 2N69A 5FPEA 2LKBA 3ATVA 1DKGD 2LI7A 1VNBA 4CQKA 1BRZA 1SN1A 2YC1C 3QI7A 1KAXA 3I33A 3QMLA 5AQHA 2QWLA 5BN8A 4H5WA 5BPLA 1QQMA 2VY6A 4V1DC 5BPNA 1BA0A 1WMTA 2LJMA 2BRZA 2KBJA 4H5TA 1I2UA 2QXLA 3C7NB 4UAEF 2LY6A 3KOXA 1QQOA 3PSMA 1HJOA 5AQNA 2KBHA 3CW4A 2N2QA 2KGQA 2E3GA 5FPNA 1PTXA 1I6FA 1KAZA 1SEGA 5CY0A 5AQUA 2E0HA 1CN2A 1GPSA 3L4IA 3GL1A 3IUCA 5EX5A 2G2KA 2LT8A 3HSCA 1NGBA 1PX9A 5AQLA 5EXWA 2NY8X 3AY9A 1ATSA 2V7ZA 2N2RA 2I61A 1T7EA 5AQFA 1GPTA 2A7TA 4HWIA 1NGIA 5BPMA 2KSKA 1I6GA 3D2EB 4IO8A 3L6QA 3E7UX 5BN9A 3KOZA 1NH5A 1UGLA 2BUPA 2LJ7A 1NRAA 2MBKA 1POIA 1NGCA 3FE1A 5AQKA 5AQSA 1CHZA 3M3ZA 3FZFA 1ZVGA 1JXCA 2KYQA 3SF4D 5AQYA 3KOWA 5AQZA 3FZHA 5AQMA 1FH3A 2YILA 1KAYA 1ZYWA 1NRBA 1ATRA 3C7NA 1WWNA 1NPIA 2N66A 3KC6A 3A8YA 1TI5A 3KVGA 2B3CA 5FPDA 1ZUTA 1JKZA 2YEOA 1P00A 5AQQA 1MR4A 1LQIA 1LQHA 3D2FB 5EY4A 2YBRC 5F2RA 2MZ0A 2E2FA 1NGFA 1SN4A 2GL1A 2SN3A 2YIPA 2M8BB 2NY9X 1KV0A 1XRSB 4H5RA 2D56A 3LDNA 4H5VA 1L4VA 4GNIA 2ASCA 3QFPA 5AQJA 3D2EA 1OZZA 1B7DA 5FPMA 5KK4A 1B3CA 1C55A 1NGJA 3BK3C 2KHOA 4UADE 1JZAA 1VNAA 1ZYVA 5AQTA 1I2VA 1HX1A 1OMYA 3KHWA 4H5NA 2ATBA 1LQQA 2QWPA 1AHOA 1BUPA 3E7RL 2QWMA 1BK8A 1ZU3A 4KBOA 2E8AA 1K8BA 4FSVA 5AQVA 1YUWA 4FL9A 5AR0A 1NGDA 1QQNA 3FZKA 2LR3A 4HHFA 1WT7A 3R2VA 3GDQA 2GMOA 5AQIA 5F0XA 2YIOA 5AQRA 4UJ0A 1NGAA 2QWRA 1SNBA 1NGHA 2LN8A 1T7BA 5AQPA 1AYJA 1S3XA 1BMRA 2QWNA 4AEIA 3LDLA 1P0AA 1T0ZA 2KPYA 3D2FA 3LDOA 4AAZA 5F1XA 1ICAA 2LY5A 3FZMA 3CQXA 1JZBA 2E3FA 2B68A 3LDQA 4KYPA 1NGGA 1MYNA 3KP1A 5AQGA 3GKUA 1PE4A 1T1TA 3LDPA
chains in the Genus database with same CATH topology
1N4NA 1ZVEA 1DQ7A 2KBKA 2KJAA 4HE7A 1ZFUA 1C56A 1DJTA 1BCGA 1NE5A 4AB0A 1T7AA 2N69A 2LKBA 2LI7A 1VNBA 4CQKA 1BRZA 1SN1A 2YC1C 4V1DC 1WMTA 2LJMA 2BRZA 2KBJA 1I2UA 2LY6A 3PSMA 2KBHA 2N2QA 2KGQA 2E3GA 1PTXA 1I6FA 1SEGA 5CY0A 2E0HA 1CN2A 1GPSA 2LT8A 1PX9A 2NY8X 2N2RA 2I61A 1T7EA 1GPTA 2A7TA 1I6GA 2KSKA 3E7UX 1NH5A 2LJ7A 4AAZA 1NRAA 1CHZA 1ZVGA 1JXCA 2KYQA 1FH3A 1ZYWA 1NRBA 1WWNA 1NPIA 2N66A 1TI5A 2B3CA 1ZUTA 1JKZA 2YEOA 1P00A 1MR4A 1LQIA 1LQHA 2YBRC 2MZ0A 2GL1A 1SN4A 2SN3A 2M8BB 2NY9X 1KV0A 1L4VA 2ASCA 1OZZA 1B7DA 5KK4A 1B3CA 1C55A 1ZYVA 1JZAA 1VNAA 1I2VA 1OMYA 2ATBA 1LQQA 1AHOA 3E7RL 1BK8A 1ZU3A 2LR3A 4HHFA 1WT7A 4UJ0A 1SNBA 1T7BA 1AYJA 1BMRA 4AEIA 1P0AA 1T0ZA 2KPYA 1ICAA 2LY5A 1JZBA 2E3FA 2B68A 4KYPA 1MYNA 1PE4A 1T1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4N A;  1ZVE A;  1DQ7 A;  2KBK A;  2KJA A;  4HE7 A;  1ZFU A;  1C56 A;  1DJT A;  1BCG A;  1NE5 A;  4AB0 A;  1T7A A;  2N69 A;  2LKB A;  2LI7 A;  1VNB A;  4CQK A;  1BRZ A;  1SN1 A;  2YC1 C;  4V1D C;  1WMT A;  2LJM A;  2BRZ A;  2KBJ A;  1I2U A;  2LY6 A;  3PSM A;  2KBH A;  2N2Q A;  2KGQ A;  2E3G A;  1PTX A;  1I6F A;  1SEG A;  5CY0 A;  2E0H A;  1CN2 A;  1GPS A;  2LT8 A;  1PX9 A;  2NY8 X;  2N2R A;  2I61 A;  1T7E A;  1GPT A;  2A7T A;  1I6G A;  2KSK A;  3E7U X;  1NH5 A;  2LJ7 A;  4AAZ A;  1NRA A;  1CHZ A;  1ZVG A;  1JXC A;  2KYQ A;  1FH3 A;  1ZYW A;  1NRB A;  1WWN A;  1NPI A;  2N66 A;  1TI5 A;  2B3C A;  1ZUT A;  1JKZ A;  2YEO A;  1P00 A;  1MR4 A;  1LQI A;  1LQH A;  2YBR C;  2MZ0 A;  2GL1 A;  1SN4 A;  2SN3 A;  2M8B B;  2NY9 X;  1KV0 A;  1L4V A;  2ASC A;  1OZZ A;  1B7D A;  5KK4 A;  1B3C A;  1C55 A;  1ZYV A;  1JZA A;  1VNA A;  1I2V A;  1OMY A;  2ATB A;  1LQQ A;  1AHO A;  3E7R L;  1BK8 A;  1ZU3 A;  2LR3 A;  4HHF A;  1WT7 A;  4UJ0 A;  1SNB A;  1T7B A;  1AYJ A;  1BMR A;  4AEI A;  1P0A A;  1T0Z A;  2KPY A;  1ICA A;  2LY5 A;  1JZB A;  2E3F A;  2B68 A;  4KYP A;  1MYN A;  1PE4 A;  1T1T A; 
#chains in the Genus database with same CATH topology
 2E88 A;  1BA1 A;  1N4N A;  1ZVE A;  2QW9 A;  1DQ7 A;  1NGE A;  2KBK A;  5EVZ A;  5AQW A;  2QWQ A;  3FZL A;  2QWO A;  2JDQ D;  3JXU A;  2MN5 A;  3QFU A;  4UAF E;  5AQX A;  1HPM A;  2KJA A;  4HE7 A;  3KOY A;  1ZFU A;  1C56 A;  2K35 A;  3KP0 A;  3L56 A;  1DJT A;  1BCG A;  5AQO A;  1NE5 A;  4AB0 A;  1T7A A;  3ATU A;  2N69 A;  5FPE A;  2LKB A;  3ATV A;  1DKG D;  2LI7 A;  1VNB A;  4CQK A;  1BRZ A;  1SN1 A;  2YC1 C;  3QI7 A;  1KAX A;  3I33 A;  3QML A;  5AQH A;  2QWL A;  5BN8 A;  4H5W A;  5BPL A;  1QQM A;  2VY6 A;  4V1D C;  5BPN A;  1BA0 A;  1WMT A;  2LJM A;  2BRZ A;  2KBJ A;  4H5T A;  1I2U A;  2QXL A;  3C7N B;  4UAE F;  2LY6 A;  3KOX A;  1QQO A;  3PSM A;  1HJO A;  5AQN A;  2KBH A;  3CW4 A;  2N2Q A;  2KGQ A;  2E3G A;  5FPN A;  1PTX A;  1I6F A;  1KAZ A;  1SEG A;  5CY0 A;  5AQU A;  2E0H A;  1CN2 A;  1GPS A;  3L4I A;  3GL1 A;  3IUC A;  5EX5 A;  2G2K A;  2LT8 A;  3HSC A;  1NGB A;  1PX9 A;  5AQL A;  5EXW A;  2NY8 X;  3AY9 A;  1ATS A;  2V7Z A;  2N2R A;  2I61 A;  1T7E A;  5AQF A;  1GPT A;  2A7T A;  4HWI A;  1NGI A;  5BPM A;  2KSK A;  1I6G A;  3D2E B;  4IO8 A;  3L6Q A;  3E7U X;  5BN9 A;  3KOZ A;  1NH5 A;  1UGL A;  2BUP A;  2LJ7 A;  1NRA A;  2MBK A;  1POI A;  1NGC A;  3FE1 A;  5AQK A;  5AQS A;  1CHZ A;  3M3Z A;  3FZF A;  1ZVG A;  1JXC A;  2KYQ A;  3SF4 D;  5AQY A;  3KOW A;  5AQZ A;  3FZH A;  5AQM A;  1FH3 A;  2YIL A;  1KAY A;  1ZYW A;  1NRB A;  1ATR A;  3C7N A;  1WWN A;  1NPI A;  2N66 A;  3KC6 A;  3A8Y A;  1TI5 A;  3KVG A;  2B3C A;  5FPD A;  1ZUT A;  1JKZ A;  2YEO A;  1P00 A;  5AQQ A;  1MR4 A;  1LQI A;  1LQH A;  3D2F B;  5EY4 A;  2YBR C;  5F2R A;  2MZ0 A;  2E2F A;  1NGF A;  1SN4 A;  2GL1 A;  2SN3 A;  2YIP A;  2M8B B;  2NY9 X;  1KV0 A;  1XRS B;  4H5R A;  2D56 A;  3LDN A;  4H5V A;  1L4V A;  4GNI A;  2ASC A;  3QFP A;  5AQJ A;  3D2E A;  1OZZ A;  1B7D A;  5FPM A;  5KK4 A;  1B3C A;  1C55 A;  1NGJ A;  3BK3 C;  2KHO A;  4UAD E;  1JZA A;  1VNA A;  1ZYV A;  5AQT A;  1I2V A;  1HX1 A;  1OMY A;  3KHW A;  4H5N A;  2ATB A;  1LQQ A;  2QWP A;  1AHO A;  1BUP A;  3E7R L;  2QWM A;  1BK8 A;  1ZU3 A;  4KBO A;  2E8A A;  1K8B A;  4FSV A;  5AQV A;  1YUW A;  4FL9 A;  5AR0 A;  1NGD A;  1QQN A;  3FZK A;  2LR3 A;  4HHF A;  1WT7 A;  3R2V A;  3GDQ A;  2GMO A;  5AQI A;  5F0X A;  2YIO A;  5AQR A;  4UJ0 A;  1NGA A;  2QWR A;  1SNB A;  1NGH A;  2LN8 A;  1T7B A;  5AQP A;  1AYJ A;  1S3X A;  1BMR A;  2QWN A;  4AEI A;  3LDL A;  1P0A A;  1T0Z A;  2KPY A;  3D2F A;  3LDO A;  4AAZ A;  5F1X A;  1ICA A;  2LY5 A;  3FZM A;  3CQX A;  1JZB A;  2E3F A;  2B68 A;  3LDQ A;  4KYP A;  1NGG A;  1MYN A;  3KP1 A;  5AQG A;  3GKU A;  1PE4 A;  1T1T A;  3LDP A; 
#chains in the Genus database with same CATH homology
 1N4N A;  1ZVE A;  1DQ7 A;  2KBK A;  2KJA A;  4HE7 A;  1ZFU A;  1C56 A;  1DJT A;  1BCG A;  1NE5 A;  4AB0 A;  1T7A A;  2N69 A;  2LKB A;  2LI7 A;  1VNB A;  4CQK A;  1BRZ A;  1SN1 A;  2YC1 C;  4V1D C;  1WMT A;  2LJM A;  2BRZ A;  2KBJ A;  1I2U A;  2LY6 A;  3PSM A;  2KBH A;  2N2Q A;  2KGQ A;  2E3G A;  1PTX A;  1I6F A;  1SEG A;  5CY0 A;  2E0H A;  1CN2 A;  1GPS A;  2LT8 A;  1PX9 A;  2NY8 X;  2N2R A;  2I61 A;  1T7E A;  1GPT A;  2A7T A;  1I6G A;  2KSK A;  3E7U X;  1NH5 A;  2LJ7 A;  4AAZ A;  1NRA A;  1CHZ A;  1ZVG A;  1JXC A;  2KYQ A;  1FH3 A;  1ZYW A;  1NRB A;  1WWN A;  1NPI A;  2N66 A;  1TI5 A;  2B3C A;  1ZUT A;  1JKZ A;  2YEO A;  1P00 A;  1MR4 A;  1LQI A;  1LQH A;  2YBR C;  2MZ0 A;  2GL1 A;  1SN4 A;  2SN3 A;  2M8B B;  2NY9 X;  1KV0 A;  1L4V A;  2ASC A;  1OZZ A;  1B7D A;  5KK4 A;  1B3C A;  1C55 A;  1ZYV A;  1JZA A;  1VNA A;  1I2V A;  1OMY A;  2ATB A;  1LQQ A;  1AHO A;  3E7R L;  1BK8 A;  1ZU3 A;  2LR3 A;  4HHF A;  1WT7 A;  4UJ0 A;  1SNB A;  1T7B A;  1AYJ A;  1BMR A;  4AEI A;  1P0A A;  1T0Z A;  2KPY A;  1ICA A;  2LY5 A;  1JZB A;  2E3F A;  2B68 A;  4KYP A;  1MYN A;  1PE4 A;  1T1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...