1DQ7A

Three-dimensional structure of a neurotoxin from red scorpion (buthus tamulus) at 2.2a resolution.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN
publication title Three-dimensional Structure of a Neurotoxin from Red Scorpion (Buthus tamulus) at 2.2A Resolution
rcsb
molecule tags Toxin
total genus 15
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1dq7A00
1B3CA 1KV0A 1CN2A 4HHFA 1GPTA 1CHZA 1BCGA 4KYPA 2KBJA 2B68A 2LJMA 2E3GA 2YEOA 1ICAA 2N69A 1BMRA 1NRAA 1NRBA 1SEGA 2KJAA 2N2RA 2KPYA 1LQHA 2YC1C 1AYJA 1PX9A 2SN3A 2LR3A 2KBHA 1JXCA 3E7RL 1NPIA 2YBRC 2A7TA 2KSKA 1T1TA 1DJTA 2E3FA 2N2QA 1I6GA 1FH3A 4CQKA 1JKZA 1ZVEA 1MR4A 3PSMA 4V1DC 2KYQA 1TI5A 1BRZA 1JZBA 1ZUTA 1BK8A 1JZAA 4AB0A 5CY0A 2GL1A 1DQ7A 2ATBA 2M8BB 2ASCA 1ZYVA 1T7EA 1OZZA 1PTXA 1WT7A 2MZ0A 1AHOA 1WMTA 1MYNA 1VNBA 2LJ7A 4AEIA 2LY5A 4AAZA 4UJ0A 1VNAA 1B7DA 2LY6A 1C55A 2I61A 1N4NA 2NY9X 2N66A 1T7BA 1LQIA 2BRZA 1I6FA 1C56A 2LT8A 4HE7A 1L4VA 5KK4A 1NH5A 2NY8X 1P0AA 1OMYA 1ZVGA 1PE4A 2LI7A 1I2VA 1WWNA 2KBKA 2KGQA 1P00A 2B3CA 2LKBA 1SN4A 1GPSA 1T7AA 1ZFUA 1T0ZA 1ZYWA 3E7UX 1SN1A 1ZU3A 1I2UA 1NE5A 1SNBA 1LQQA 2E0HA
chains in the Genus database with same CATH superfamily
1B3CA 1KV0A 3ATVA 1CN2A 3L6QA 3FZKA 1QQOA 5F0XA 5FPDA 4HHFA 2YIPA 3M3ZA 1GPTA 3GL1A 3GDQA 3A8YA 1CHZA 1BA1A 5EVZA 1BCGA 4KYPA 3GKUA 3C7NA 2BUPA 2KBJA 3FZHA 2B68A 1KAYA 2LJMA 2E3GA 5FPMA 2YEOA 1ICAA 2K35A 2N69A 1BMRA 1NRAA 1NRBA 3LDNA 1YUWA 3LDOA 1SEGA 2KJAA 2N2RA 2V7ZA 2KPYA 5AQQA 2QWOA 1LQHA 2MBKA 2YC1C 3D2FB 3KP1A 1AYJA 1QQNA 5BPMA 2QWQA 1NGDA 1PX9A 2SN3A 2LR3A 5AR0A 2KBHA 1JXCA 3E7RL 5EY4A 2D56A 5AQPA 3AY9A 1HX1A 1NPIA 2YBRC 3LDPA 4KBOA 2A7TA 2YIOA 2KSKA 1T1TA 1NGGA 1DJTA 2E3FA 2N2QA 5AQMA 1FH3A 1I6GA 4H5RA 4CQKA 1JKZA 3KVGA 4FSVA 1ZVEA 1MR4A 2JDQD 2QWMA 3JXUA 3KOXA 3PSMA 4V1DC 2KYQA 1TI5A 1BRZA 1JZBA 1ZUTA 4UAEF 3QI7A 5AQVA 1BK8A 1JZAA 1QQMA 2VY6A 4AB0A 1XRSB 5CY0A 3LDLA 2GL1A 5BPLA 1DQ7A 2ATBA 2M8BB 3QMLA 2GMOA 2ASCA 1ZYVA 1T7EA 3KOZA 1OZZA 1KAXA 3QFUA 3KHWA 3KOYA 1PTXA 1WT7A 5BN8A 4HWIA 3D2FA 5AQGA 2MZ0A 3BK3C 1NGEA 1AHOA 1BUPA 1NGAA 5AQLA 1BA0A 1NGHA 3FE1A 5AQOA 5F2RA 1NGJA 1WMTA 2YILA 1MYNA 2E2FA 1VNBA 1S3XA 2KHOA 3CW4A 2LJ7A 3FZMA 1ATRA 2LY5A 2LN8A 3ATUA 3KP0A 4AAZA 4AEIA 4UJ0A 1VNAA 2E8AA 2QWNA 1B7DA 3KC6A 5AQKA 2LY6A 3I33A 3R2VA 5EXWA 2I61A 3D2EB 5AQYA 1C55A 2QWRA 1N4NA 5BN9A 5BPNA 1KAZA 1NGBA 3HSCA 2E88A 2N66A 1ATSA 2NY9X 1T7BA 5AQSA 5F1XA 5FPEA 2MN5A 2QWPA 1NGIA 1LQIA 3QFPA 2BRZA 1I6FA 1UGLA 5AQRA 5EX5A 5AQIA 1C56A 2LT8A 3L56A 4IO8A 5AQFA 4UAFE 1DKGD 3IUCA 3SF4D 2QW9A 4HE7A 1L4VA 5KK4A 1NH5A 5FPNA 2QWLA 3C7NB 4H5TA 2NY8X 3KOWA 1NGFA 1POIA 3L4IA 1NGCA 5AQXA 1P0AA 3CQXA 1OMYA 3LDQA 1ZVGA 1PE4A 2LI7A 1I2VA 4H5WA 1WWNA 2KBKA 2KGQA 4FL9A 1P00A 5AQTA 2B3CA 2LKBA 4GNIA 1HJOA 1HPMA 5AQZA 1SN4A 3D2EA 1GPSA 1T7AA 1ZFUA 3FZFA 4UADE 1T0ZA 5AQJA 1K8BA 5AQWA 1ZYWA 3E7UX 2QXLA 1SN1A 1ZU3A 2G2KA 4H5NA 5AQHA 1I2UA 3FZLA 1NE5A 1SNBA 5AQUA 4H5VA 1LQQA 2E0HA 5AQNA
chains in the Genus database with same CATH topology
1B3CA 1KV0A 1CN2A 4HHFA 1GPTA 1CHZA 1BCGA 4KYPA 2KBJA 2B68A 2LJMA 2E3GA 2YEOA 1ICAA 2N69A 1BMRA 1NRAA 1NRBA 1SEGA 2KJAA 2N2RA 2KPYA 1LQHA 2YC1C 1AYJA 1PX9A 2SN3A 2LR3A 2KBHA 1JXCA 3E7RL 1NPIA 2YBRC 2A7TA 2KSKA 1T1TA 1DJTA 2E3FA 2N2QA 1I6GA 1FH3A 4CQKA 1JKZA 1ZVEA 1MR4A 3PSMA 4V1DC 2KYQA 1TI5A 1BRZA 1JZBA 1ZUTA 1BK8A 1JZAA 4AB0A 5CY0A 2GL1A 1DQ7A 2ATBA 2M8BB 2ASCA 1ZYVA 1T7EA 1OZZA 1PTXA 1WT7A 2MZ0A 1AHOA 1WMTA 1MYNA 1VNBA 2LJ7A 4AEIA 2LY5A 4AAZA 4UJ0A 1VNAA 1B7DA 2LY6A 1C55A 2I61A 1N4NA 2NY9X 2N66A 1T7BA 1LQIA 2BRZA 1I6FA 1C56A 2LT8A 4HE7A 1L4VA 5KK4A 1NH5A 2NY8X 1P0AA 1OMYA 1ZVGA 1PE4A 2LI7A 1I2VA 1WWNA 2KBKA 2KGQA 1P00A 2B3CA 2LKBA 1SN4A 1GPSA 1T7AA 1ZFUA 1T0ZA 1ZYWA 3E7UX 1SN1A 1ZU3A 1I2UA 1NE5A 1SNBA 1LQQA 2E0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3C A;  1KV0 A;  1CN2 A;  4HHF A;  1GPT A;  1CHZ A;  1BCG A;  4KYP A;  2KBJ A;  2B68 A;  2LJM A;  2E3G A;  2YEO A;  1ICA A;  2N69 A;  1BMR A;  1NRA A;  1NRB A;  1SEG A;  2KJA A;  2N2R A;  2KPY A;  1LQH A;  2YC1 C;  1AYJ A;  1PX9 A;  2SN3 A;  2LR3 A;  2KBH A;  1JXC A;  3E7R L;  1NPI A;  2YBR C;  2A7T A;  2KSK A;  1T1T A;  1DJT A;  2E3F A;  2N2Q A;  1I6G A;  1FH3 A;  4CQK A;  1JKZ A;  1ZVE A;  1MR4 A;  3PSM A;  4V1D C;  2KYQ A;  1TI5 A;  1BRZ A;  1JZB A;  1ZUT A;  1BK8 A;  1JZA A;  4AB0 A;  5CY0 A;  2GL1 A;  1DQ7 A;  2ATB A;  2M8B B;  2ASC A;  1ZYV A;  1T7E A;  1OZZ A;  1PTX A;  1WT7 A;  2MZ0 A;  1AHO A;  1WMT A;  1MYN A;  1VNB A;  2LJ7 A;  4AEI A;  2LY5 A;  4AAZ A;  4UJ0 A;  1VNA A;  1B7D A;  2LY6 A;  1C55 A;  2I61 A;  1N4N A;  2NY9 X;  2N66 A;  1T7B A;  1LQI A;  2BRZ A;  1I6F A;  1C56 A;  2LT8 A;  4HE7 A;  1L4V A;  5KK4 A;  1NH5 A;  2NY8 X;  1P0A A;  1OMY A;  1ZVG A;  1PE4 A;  2LI7 A;  1I2V A;  1WWN A;  2KBK A;  2KGQ A;  1P00 A;  2B3C A;  2LKB A;  1SN4 A;  1GPS A;  1T7A A;  1ZFU A;  1T0Z A;  1ZYW A;  3E7U X;  1SN1 A;  1ZU3 A;  1I2U A;  1NE5 A;  1SNB A;  1LQQ A;  2E0H A; 
#chains in the Genus database with same CATH topology
 1B3C A;  1KV0 A;  3ATV A;  1CN2 A;  3L6Q A;  3FZK A;  1QQO A;  5F0X A;  5FPD A;  4HHF A;  2YIP A;  3M3Z A;  1GPT A;  3GL1 A;  3GDQ A;  3A8Y A;  1CHZ A;  1BA1 A;  5EVZ A;  1BCG A;  4KYP A;  3GKU A;  3C7N A;  2BUP A;  2KBJ A;  3FZH A;  2B68 A;  1KAY A;  2LJM A;  2E3G A;  5FPM A;  2YEO A;  1ICA A;  2K35 A;  2N69 A;  1BMR A;  1NRA A;  1NRB A;  3LDN A;  1YUW A;  3LDO A;  1SEG A;  2KJA A;  2N2R A;  2V7Z A;  2KPY A;  5AQQ A;  2QWO A;  1LQH A;  2MBK A;  2YC1 C;  3D2F B;  3KP1 A;  1AYJ A;  1QQN A;  5BPM A;  2QWQ A;  1NGD A;  1PX9 A;  2SN3 A;  2LR3 A;  5AR0 A;  2KBH A;  1JXC A;  3E7R L;  5EY4 A;  2D56 A;  5AQP A;  3AY9 A;  1HX1 A;  1NPI A;  2YBR C;  3LDP A;  4KBO A;  2A7T A;  2YIO A;  2KSK A;  1T1T A;  1NGG A;  1DJT A;  2E3F A;  2N2Q A;  5AQM A;  1FH3 A;  1I6G A;  4H5R A;  4CQK A;  1JKZ A;  3KVG A;  4FSV A;  1ZVE A;  1MR4 A;  2JDQ D;  2QWM A;  3JXU A;  3KOX A;  3PSM A;  4V1D C;  2KYQ A;  1TI5 A;  1BRZ A;  1JZB A;  1ZUT A;  4UAE F;  3QI7 A;  5AQV A;  1BK8 A;  1JZA A;  1QQM A;  2VY6 A;  4AB0 A;  1XRS B;  5CY0 A;  3LDL A;  2GL1 A;  5BPL A;  1DQ7 A;  2ATB A;  2M8B B;  3QML A;  2GMO A;  2ASC A;  1ZYV A;  1T7E A;  3KOZ A;  1OZZ A;  1KAX A;  3QFU A;  3KHW A;  3KOY A;  1PTX A;  1WT7 A;  5BN8 A;  4HWI A;  3D2F A;  5AQG A;  2MZ0 A;  3BK3 C;  1NGE A;  1AHO A;  1BUP A;  1NGA A;  5AQL A;  1BA0 A;  1NGH A;  3FE1 A;  5AQO A;  5F2R A;  1NGJ A;  1WMT A;  2YIL A;  1MYN A;  2E2F A;  1VNB A;  1S3X A;  2KHO A;  3CW4 A;  2LJ7 A;  3FZM A;  1ATR A;  2LY5 A;  2LN8 A;  3ATU A;  3KP0 A;  4AAZ A;  4AEI A;  4UJ0 A;  1VNA A;  2E8A A;  2QWN A;  1B7D A;  3KC6 A;  5AQK A;  2LY6 A;  3I33 A;  3R2V A;  5EXW A;  2I61 A;  3D2E B;  5AQY A;  1C55 A;  2QWR A;  1N4N A;  5BN9 A;  5BPN A;  1KAZ A;  1NGB A;  3HSC A;  2E88 A;  2N66 A;  1ATS A;  2NY9 X;  1T7B A;  5AQS A;  5F1X A;  5FPE A;  2MN5 A;  2QWP A;  1NGI A;  1LQI A;  3QFP A;  2BRZ A;  1I6F A;  1UGL A;  5AQR A;  5EX5 A;  5AQI A;  1C56 A;  2LT8 A;  3L56 A;  4IO8 A;  5AQF A;  4UAF E;  1DKG D;  3IUC A;  3SF4 D;  2QW9 A;  4HE7 A;  1L4V A;  5KK4 A;  1NH5 A;  5FPN A;  2QWL A;  3C7N B;  4H5T A;  2NY8 X;  3KOW A;  1NGF A;  1POI A;  3L4I A;  1NGC A;  5AQX A;  1P0A A;  3CQX A;  1OMY A;  3LDQ A;  1ZVG A;  1PE4 A;  2LI7 A;  1I2V A;  4H5W A;  1WWN A;  2KBK A;  2KGQ A;  4FL9 A;  1P00 A;  5AQT A;  2B3C A;  2LKB A;  4GNI A;  1HJO A;  1HPM A;  5AQZ A;  1SN4 A;  3D2E A;  1GPS A;  1T7A A;  1ZFU A;  3FZF A;  4UAD E;  1T0Z A;  5AQJ A;  1K8B A;  5AQW A;  1ZYW A;  3E7U X;  2QXL A;  1SN1 A;  1ZU3 A;  2G2K A;  4H5N A;  5AQH A;  1I2U A;  3FZL A;  1NE5 A;  1SNB A;  5AQU A;  4H5V A;  1LQQ A;  2E0H A;  5AQN A; 
#chains in the Genus database with same CATH homology
 1B3C A;  1KV0 A;  1CN2 A;  4HHF A;  1GPT A;  1CHZ A;  1BCG A;  4KYP A;  2KBJ A;  2B68 A;  2LJM A;  2E3G A;  2YEO A;  1ICA A;  2N69 A;  1BMR A;  1NRA A;  1NRB A;  1SEG A;  2KJA A;  2N2R A;  2KPY A;  1LQH A;  2YC1 C;  1AYJ A;  1PX9 A;  2SN3 A;  2LR3 A;  2KBH A;  1JXC A;  3E7R L;  1NPI A;  2YBR C;  2A7T A;  2KSK A;  1T1T A;  1DJT A;  2E3F A;  2N2Q A;  1I6G A;  1FH3 A;  4CQK A;  1JKZ A;  1ZVE A;  1MR4 A;  3PSM A;  4V1D C;  2KYQ A;  1TI5 A;  1BRZ A;  1JZB A;  1ZUT A;  1BK8 A;  1JZA A;  4AB0 A;  5CY0 A;  2GL1 A;  1DQ7 A;  2ATB A;  2M8B B;  2ASC A;  1ZYV A;  1T7E A;  1OZZ A;  1PTX A;  1WT7 A;  2MZ0 A;  1AHO A;  1WMT A;  1MYN A;  1VNB A;  2LJ7 A;  4AEI A;  2LY5 A;  4AAZ A;  4UJ0 A;  1VNA A;  1B7D A;  2LY6 A;  1C55 A;  2I61 A;  1N4N A;  2NY9 X;  2N66 A;  1T7B A;  1LQI A;  2BRZ A;  1I6F A;  1C56 A;  2LT8 A;  4HE7 A;  1L4V A;  5KK4 A;  1NH5 A;  2NY8 X;  1P0A A;  1OMY A;  1ZVG A;  1PE4 A;  2LI7 A;  1I2V A;  1WWN A;  2KBK A;  2KGQ A;  1P00 A;  2B3C A;  2LKB A;  1SN4 A;  1GPS A;  1T7A A;  1ZFU A;  1T0Z A;  1ZYW A;  3E7U X;  1SN1 A;  1ZU3 A;  1I2U A;  1NE5 A;  1SNB A;  1LQQ A;  2E0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...