1LQQA

Anti-mammal and anti-insect lqqiii scorpion toxin, nmr, 15 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
VRDAYIAKNYNCVYECFRDSYCNDLCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LQQIII
publication title 1H-NMR-derived secondary structure and the overall fold of the potent anti-mammal and anti-insect toxin III from the scorpion Leiurus quinquestriatus quinquestriatus.
pubmed doi rcsb
molecule tags Neurotoxin
total genus 15
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1997-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1lqqA00
1C56A 1WMTA 1GPTA 1BMRA 1PX9A 1L4VA 1P0AA 1ZUTA 1BRZA 1B3CA 2ASCA 4AB0A 1NH5A 2N66A 1I2VA 1MYNA 2KPYA 3E7RL 2YEOA 1JZBA 2LJMA 2SN3A 1T1TA 2KBHA 2BRZA 1CN2A 1SN1A 1WT7A 4AEIA 5CY0A 2A7TA 1I2UA 3E7UX 1PE4A 1JZAA 2LY6A 1FH3A 1I6GA 1LQHA 1C55A 2LKBA 2NY8X 2E3GA 1ICAA 2LY5A 2MZ0A 1T7BA 1WWNA 1JXCA 2E3FA 1I6FA 2KYQA 1MR4A 1OMYA 2GL1A 1PTXA 1LQIA 1T0ZA 1BCGA 1VNAA 4UJ0A 2ATBA 2M8BB 2B3CA 4CQKA 1ZYVA 1SN4A 1T7AA 1N4NA 2N2RA 4V1DC 2KBJA 1NRBA 1ZVGA 2KSKA 4HHFA 1AYJA 1VNBA 4AAZA 1DQ7A 2KGQA 1T7EA 1SEGA 1NPIA 1ZU3A 2N69A 1BK8A 1B7DA 2LT8A 1AHOA 1ZYWA 2E0HA 1NRAA 1TI5A 1ZFUA 2LR3A 2YBRC 2KJAA 1P00A 2LI7A 4HE7A 2KBKA 5KK4A 1NE5A 1JKZA 2YC1C 1CHZA 1LQQA 2NY9X 3PSMA 1DJTA 1KV0A 2N2QA 1OZZA 1ZVEA 2LJ7A 4KYPA 1SNBA 2I61A 1GPSA 2B68A
chains in the Genus database with same CATH superfamily
1C56A 5F0XA 5AQRA 2YILA 3KOWA 1WMTA 3HSCA 3KP1A 5AQYA 1NGGA 1GPTA 3I33A 3IUCA 2BUPA 3FZFA 1BMRA 3QFPA 1PX9A 1NGBA 1P0AA 1QQNA 5FPNA 1L4VA 1ZUTA 1BRZA 1B3CA 4H5TA 2ASCA 5BPLA 1QQOA 3FZMA 5AQQA 1XRSB 2QWRA 3KHWA 1NH5A 4AB0A 2QWMA 3D2EB 2N66A 1I2VA 1MYNA 4UAFE 2KPYA 3KOYA 5AQXA 2QWLA 2YEOA 3CW4A 3E7RL 1JZBA 1NGHA 2LJMA 2SN3A 3M3ZA 1DKGD 1T1TA 5AQMA 3D2EA 2KBHA 1NGCA 2BRZA 2QWQA 5AQKA 1KAZA 5FPDA 3KOXA 4H5RA 1SN1A 1WT7A 2MN5A 2QW9A 4AEIA 4HWIA 5CY0A 4H5NA 5AQTA 2A7TA 1I2UA 3E7UX 3L56A 1CN2A 1PE4A 2D56A 1JZAA 3LDOA 3GKUA 3KOZA 2LY6A 5AQFA 2V7ZA 1FH3A 3QMLA 3C7NB 2GMOA 3BK3C 5BPMA 1I6GA 1NGFA 1LQHA 3L4IA 1C55A 5AQUA 1S3XA 3GDQA 3ATUA 2LKBA 2NY8X 2E3GA 1ICAA 2E88A 5F1XA 1QQMA 2LY5A 1T7BA 2MZ0A 4H5VA 5BN9A 5BN8A 1WWNA 3C7NA 4FSVA 1JXCA 2E3FA 1I6FA 5EX5A 3A8YA 1YUWA 3KC6A 2KYQA 5FPEA 1MR4A 1OMYA 4IO8A 2GL1A 1PTXA 1LQIA 2VY6A 3D2FB 5AQVA 2E2FA 1KAYA 1ATRA 5FPMA 1T0ZA 3LDPA 1NGAA 3KVGA 1BUPA 1BCGA 1VNAA 2QWPA 4UJ0A 1NGIA 3AY9A 4KBOA 2ATBA 2E8AA 3SF4D 1NGEA 1UGLA 3R2VA 2M8BB 2B3CA 4CQKA 1ZYVA 1SN4A 1T7AA 2QXLA 3LDNA 4FL9A 1NGDA 1N4NA 2YIPA 2JDQD 5AQIA 5AQJA 5AQOA 2N2RA 4V1DC 1K8BA 2KBJA 5AQGA 5BPNA 1NRBA 3L6QA 3QI7A 2YIOA 1ZVGA 2KSKA 4HHFA 3GL1A 1AYJA 1VNBA 3FZLA 4AAZA 2KHOA 2QWOA 5F2RA 1DQ7A 3FZKA 2MBKA 2KGQA 1BA0A 1T7EA 4UAEF 1NPIA 1SEGA 1ZU3A 2N69A 2QWNA 3ATVA 4UADE 1BK8A 1B7DA 2LT8A 3QFUA 1AHOA 2LN8A 3KP0A 1KAXA 3LDLA 1ZYWA 2E0HA 1NRAA 1TI5A 3D2FA 4GNIA 1ZFUA 3CQXA 5AQNA 5AQLA 2LR3A 3LDQA 2YBRC 5AQPA 2G2KA 2KJAA 4H5WA 5AQHA 1P00A 2LI7A 4HE7A 1NGJA 5EY4A 2KBKA 5KK4A 1ATSA 5AQSA 1NE5A 1JKZA 1POIA 2YC1C 5AR0A 5AQZA 1CHZA 1LQQA 2NY9X 3PSMA 1DJTA 3FE1A 1KV0A 1HX1A 3FZHA 5EVZA 5EXWA 2N2QA 1OZZA 3JXUA 1HPMA 1ZVEA 2LJ7A 5AQWA 4KYPA 1BA1A 1SNBA 2I61A 1GPSA 2K35A 2B68A 1HJOA
chains in the Genus database with same CATH topology
1C56A 1WMTA 1GPTA 1BMRA 1PX9A 1L4VA 1P0AA 1ZUTA 1BRZA 1B3CA 2ASCA 4AB0A 1NH5A 2N66A 1I2VA 1MYNA 2KPYA 3E7RL 2YEOA 1JZBA 2LJMA 2SN3A 1T1TA 2KBHA 2BRZA 1CN2A 1SN1A 1WT7A 4AEIA 5CY0A 2A7TA 1I2UA 3E7UX 1PE4A 1JZAA 2LY6A 1FH3A 1I6GA 1LQHA 1C55A 2LKBA 2NY8X 2E3GA 1ICAA 2LY5A 2MZ0A 1T7BA 1WWNA 1JXCA 2E3FA 1I6FA 2KYQA 1MR4A 1OMYA 2GL1A 1PTXA 1LQIA 1T0ZA 1BCGA 1VNAA 4UJ0A 2ATBA 2M8BB 2B3CA 4CQKA 1ZYVA 1SN4A 1T7AA 1N4NA 2N2RA 4V1DC 2KBJA 1NRBA 1ZVGA 2KSKA 4HHFA 1AYJA 1VNBA 4AAZA 1DQ7A 2KGQA 1T7EA 1SEGA 1NPIA 1ZU3A 2N69A 1BK8A 1B7DA 2LT8A 1AHOA 1ZYWA 2E0HA 1NRAA 1TI5A 1ZFUA 2LR3A 2YBRC 2KJAA 1P00A 2LI7A 4HE7A 2KBKA 5KK4A 1NE5A 1JKZA 2YC1C 1CHZA 1LQQA 2NY9X 3PSMA 1DJTA 1KV0A 2N2QA 1OZZA 1ZVEA 2LJ7A 4KYPA 1SNBA 2I61A 1GPSA 2B68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C56 A;  1WMT A;  1GPT A;  1BMR A;  1PX9 A;  1L4V A;  1P0A A;  1ZUT A;  1BRZ A;  1B3C A;  2ASC A;  4AB0 A;  1NH5 A;  2N66 A;  1I2V A;  1MYN A;  2KPY A;  3E7R L;  2YEO A;  1JZB A;  2LJM A;  2SN3 A;  1T1T A;  2KBH A;  2BRZ A;  1CN2 A;  1SN1 A;  1WT7 A;  4AEI A;  5CY0 A;  2A7T A;  1I2U A;  3E7U X;  1PE4 A;  1JZA A;  2LY6 A;  1FH3 A;  1I6G A;  1LQH A;  1C55 A;  2LKB A;  2NY8 X;  2E3G A;  1ICA A;  2LY5 A;  2MZ0 A;  1T7B A;  1WWN A;  1JXC A;  2E3F A;  1I6F A;  2KYQ A;  1MR4 A;  1OMY A;  2GL1 A;  1PTX A;  1LQI A;  1T0Z A;  1BCG A;  1VNA A;  4UJ0 A;  2ATB A;  2M8B B;  2B3C A;  4CQK A;  1ZYV A;  1SN4 A;  1T7A A;  1N4N A;  2N2R A;  4V1D C;  2KBJ A;  1NRB A;  1ZVG A;  2KSK A;  4HHF A;  1AYJ A;  1VNB A;  4AAZ A;  1DQ7 A;  2KGQ A;  1T7E A;  1SEG A;  1NPI A;  1ZU3 A;  2N69 A;  1BK8 A;  1B7D A;  2LT8 A;  1AHO A;  1ZYW A;  2E0H A;  1NRA A;  1TI5 A;  1ZFU A;  2LR3 A;  2YBR C;  2KJA A;  1P00 A;  2LI7 A;  4HE7 A;  2KBK A;  5KK4 A;  1NE5 A;  1JKZ A;  2YC1 C;  1CHZ A;  1LQQ A;  2NY9 X;  3PSM A;  1DJT A;  1KV0 A;  2N2Q A;  1OZZ A;  1ZVE A;  2LJ7 A;  4KYP A;  1SNB A;  2I61 A;  1GPS A;  2B68 A; 
#chains in the Genus database with same CATH topology
 1C56 A;  5F0X A;  5AQR A;  2YIL A;  3KOW A;  1WMT A;  3HSC A;  3KP1 A;  5AQY A;  1NGG A;  1GPT A;  3I33 A;  3IUC A;  2BUP A;  3FZF A;  1BMR A;  3QFP A;  1PX9 A;  1NGB A;  1P0A A;  1QQN A;  5FPN A;  1L4V A;  1ZUT A;  1BRZ A;  1B3C A;  4H5T A;  2ASC A;  5BPL A;  1QQO A;  3FZM A;  5AQQ A;  1XRS B;  2QWR A;  3KHW A;  1NH5 A;  4AB0 A;  2QWM A;  3D2E B;  2N66 A;  1I2V A;  1MYN A;  4UAF E;  2KPY A;  3KOY A;  5AQX A;  2QWL A;  2YEO A;  3CW4 A;  3E7R L;  1JZB A;  1NGH A;  2LJM A;  2SN3 A;  3M3Z A;  1DKG D;  1T1T A;  5AQM A;  3D2E A;  2KBH A;  1NGC A;  2BRZ A;  2QWQ A;  5AQK A;  1KAZ A;  5FPD A;  3KOX A;  4H5R A;  1SN1 A;  1WT7 A;  2MN5 A;  2QW9 A;  4AEI A;  4HWI A;  5CY0 A;  4H5N A;  5AQT A;  2A7T A;  1I2U A;  3E7U X;  3L56 A;  1CN2 A;  1PE4 A;  2D56 A;  1JZA A;  3LDO A;  3GKU A;  3KOZ A;  2LY6 A;  5AQF A;  2V7Z A;  1FH3 A;  3QML A;  3C7N B;  2GMO A;  3BK3 C;  5BPM A;  1I6G A;  1NGF A;  1LQH A;  3L4I A;  1C55 A;  5AQU A;  1S3X A;  3GDQ A;  3ATU A;  2LKB A;  2NY8 X;  2E3G A;  1ICA A;  2E88 A;  5F1X A;  1QQM A;  2LY5 A;  1T7B A;  2MZ0 A;  4H5V A;  5BN9 A;  5BN8 A;  1WWN A;  3C7N A;  4FSV A;  1JXC A;  2E3F A;  1I6F A;  5EX5 A;  3A8Y A;  1YUW A;  3KC6 A;  2KYQ A;  5FPE A;  1MR4 A;  1OMY A;  4IO8 A;  2GL1 A;  1PTX A;  1LQI A;  2VY6 A;  3D2F B;  5AQV A;  2E2F A;  1KAY A;  1ATR A;  5FPM A;  1T0Z A;  3LDP A;  1NGA A;  3KVG A;  1BUP A;  1BCG A;  1VNA A;  2QWP A;  4UJ0 A;  1NGI A;  3AY9 A;  4KBO A;  2ATB A;  2E8A A;  3SF4 D;  1NGE A;  1UGL A;  3R2V A;  2M8B B;  2B3C A;  4CQK A;  1ZYV A;  1SN4 A;  1T7A A;  2QXL A;  3LDN A;  4FL9 A;  1NGD A;  1N4N A;  2YIP A;  2JDQ D;  5AQI A;  5AQJ A;  5AQO A;  2N2R A;  4V1D C;  1K8B A;  2KBJ A;  5AQG A;  5BPN A;  1NRB A;  3L6Q A;  3QI7 A;  2YIO A;  1ZVG A;  2KSK A;  4HHF A;  3GL1 A;  1AYJ A;  1VNB A;  3FZL A;  4AAZ A;  2KHO A;  2QWO A;  5F2R A;  1DQ7 A;  3FZK A;  2MBK A;  2KGQ A;  1BA0 A;  1T7E A;  4UAE F;  1NPI A;  1SEG A;  1ZU3 A;  2N69 A;  2QWN A;  3ATV A;  4UAD E;  1BK8 A;  1B7D A;  2LT8 A;  3QFU A;  1AHO A;  2LN8 A;  3KP0 A;  1KAX A;  3LDL A;  1ZYW A;  2E0H A;  1NRA A;  1TI5 A;  3D2F A;  4GNI A;  1ZFU A;  3CQX A;  5AQN A;  5AQL A;  2LR3 A;  3LDQ A;  2YBR C;  5AQP A;  2G2K A;  2KJA A;  4H5W A;  5AQH A;  1P00 A;  2LI7 A;  4HE7 A;  1NGJ A;  5EY4 A;  2KBK A;  5KK4 A;  1ATS A;  5AQS A;  1NE5 A;  1JKZ A;  1POI A;  2YC1 C;  5AR0 A;  5AQZ A;  1CHZ A;  1LQQ A;  2NY9 X;  3PSM A;  1DJT A;  3FE1 A;  1KV0 A;  1HX1 A;  3FZH A;  5EVZ A;  5EXW A;  2N2Q A;  1OZZ A;  3JXU A;  1HPM A;  1ZVE A;  2LJ7 A;  5AQW A;  4KYP A;  1BA1 A;  1SNB A;  2I61 A;  1GPS A;  2K35 A;  2B68 A;  1HJO A; 
#chains in the Genus database with same CATH homology
 1C56 A;  1WMT A;  1GPT A;  1BMR A;  1PX9 A;  1L4V A;  1P0A A;  1ZUT A;  1BRZ A;  1B3C A;  2ASC A;  4AB0 A;  1NH5 A;  2N66 A;  1I2V A;  1MYN A;  2KPY A;  3E7R L;  2YEO A;  1JZB A;  2LJM A;  2SN3 A;  1T1T A;  2KBH A;  2BRZ A;  1CN2 A;  1SN1 A;  1WT7 A;  4AEI A;  5CY0 A;  2A7T A;  1I2U A;  3E7U X;  1PE4 A;  1JZA A;  2LY6 A;  1FH3 A;  1I6G A;  1LQH A;  1C55 A;  2LKB A;  2NY8 X;  2E3G A;  1ICA A;  2LY5 A;  2MZ0 A;  1T7B A;  1WWN A;  1JXC A;  2E3F A;  1I6F A;  2KYQ A;  1MR4 A;  1OMY A;  2GL1 A;  1PTX A;  1LQI A;  1T0Z A;  1BCG A;  1VNA A;  4UJ0 A;  2ATB A;  2M8B B;  2B3C A;  4CQK A;  1ZYV A;  1SN4 A;  1T7A A;  1N4N A;  2N2R A;  4V1D C;  2KBJ A;  1NRB A;  1ZVG A;  2KSK A;  4HHF A;  1AYJ A;  1VNB A;  4AAZ A;  1DQ7 A;  2KGQ A;  1T7E A;  1SEG A;  1NPI A;  1ZU3 A;  2N69 A;  1BK8 A;  1B7D A;  2LT8 A;  1AHO A;  1ZYW A;  2E0H A;  1NRA A;  1TI5 A;  1ZFU A;  2LR3 A;  2YBR C;  2KJA A;  1P00 A;  2LI7 A;  4HE7 A;  2KBK A;  5KK4 A;  1NE5 A;  1JKZ A;  2YC1 C;  1CHZ A;  1LQQ A;  2NY9 X;  3PSM A;  1DJT A;  1KV0 A;  2N2Q A;  1OZZ A;  1ZVE A;  2LJ7 A;  4KYP A;  1SNB A;  2I61 A;  1GPS A;  2B68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...